>cd06128 DNA_polA_exo The 3'-5' exonuclease domain of family-A DNA polymerases has a fundamental role in reducing polymerase errors and is involved in proofreading activity. Family-A DNA polymerases contain a DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-B DNA polymerases. The exonuclease domain contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, which are clustered around the active site and contain four invariant acidic residues that serve as ligands for the two metal ions required for catalysis. The Klenow fragment (KF) of Escherichia coli pol I, the Thermus aquaticus (Taq) pol I, and Bacillus stearothermophilus (BF) pol I are examples of family-A DNA polymerases. They are involved in nucleotide excision repair and in the processing of Okazaki fragments that are generated during lagging strand synthesis. The N-terminal domains of BF pol I and Taq pol I resemble the fold of the 3'-5' exonuclease domain of KF

Probab=99.19 E-value=1e-10 Score=86.90 Aligned_cols=115 Identities=17% Similarity=0.243 Sum_probs=78.8 Q ss_pred EEEEECCCCCCCCCCCEEEEEEEEEEECCEECCCEEEEEECCCCCCCCHHHEEECCCCCCCCCCCCCCCHHHHHHHHHHH Q ss_conf 89998467888888888999999999999880313798985888228865724202101232248521002344777530 Q gi|254780818|r 9 KIVFDIETTGLDSKNDRIIEIGAVELLDYSKTNRTFQVFLCPNGRKNSPEALKLHGITDEFLKDKPSFSSIFSEFWDFFN 88 (245) Q Consensus 9 ~iv~D~ETTGl~~~~d~Iieigav~i~~~~~~~~~f~~~i~P~~~~i~~~~~~ihGIt~~~l~~~p~f~ev~~~f~~fi~ 88 (245) T Consensus 3 ~~a~DtETt~ld~~~a~iVGis~s-~~----~~~a~--YiP~~h-~~~~------------~~~~l~~~~vl~~L~p~le 62 (166) T cd06128 3 VFAFDTETDSLDNISANLVGLSFA-IE----PGVAA--YIPVAH-DYLD------------APDQISRERALELLKPLLE 62 (166) T ss_pred EEEEECCCCCCCCCCCEEEEEEEE-CC----CCEEE--EEECCC-CCCC------------CHHHHHHHHHHHHHHHHHC T ss_conf 899978879989043549999998-00----89699--995267-7667------------5257789999999999973 Q ss_pred CCCCEEEEECCCCCCCEEEECHHCCCCCCCCCCHHCCCHHCCCCCCCCC-CCCHHHHHHHHC Q ss_conf 0232023102322431121000001122221000011000000017764-222378999718 Q gi|254780818|r 89 EQNAEWIAHNAKFDVGFINAELQRINKDPLDPSRIIDTLSIARRKHPSS-RNDLNSLCKRYG 149 (245) Q Consensus 89 ~~~~~lVaHNa~FD~~fL~~el~r~~~~~~~~~~~iDTl~lar~~~p~~-~~~L~~l~~~~~ 149 (245) T Consensus 63 d~~i~KighNlK~D~~vL----~~~Gi~l--~g~~fDTMlaaylldp~~~~h~Ld~La~~~L 118 (166) T cd06128 63 DEKALKVGQNLKYDRGIL----ANYGIEL--RGIAFDTMLESYILNSVAGRHDMDSLAERWL 118 (166) T ss_pred CCCCCEEEECHHHHHHHH----HHCCCCC--CCCCCCHHHHHHHCCCCCCCCCHHHHHHHHC T ss_conf 999764531156679999----6199668--9998457679876289998899699999983

HHsearch alignment for GI: 254780818 and conserved domain: cd06128