>cd06130 DNA_pol_III_epsilon_like This subfamily is composed of uncharacterized bacterial proteins with similarity to the epsilon subunit of DNA polymerase III (polIII), a multisubunit polymerase which is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. The pol III holoenzyme is a complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The polIII epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The epsilon subunit of polIII also functions as a stabilizer of the holoenzyme complex

Probab=100.00 E-value=2.9e-43 Score=290.29 Aligned_cols=155 Identities=28% Similarity=0.481 Sum_probs=141.2 Q ss_pred EEEEECCCCCCCCCCCEEEEEEEEEEECCEECCCEEEEEECCCCCCCCHHHEEECCCCCCCCCCCCCCCHHHHHHHHHHH Q ss_conf 89998467888888888999999999999880313798985888228865724202101232248521002344777530 Q gi|254780818|r 9 KIVFDIETTGLDSKNDRIIEIGAVELLDYSKTNRTFQVFLCPNGRKNSPEALKLHGITDEFLKDKPSFSSIFSEFWDFFN 88 (245) Q Consensus 9 ~iv~D~ETTGl~~~~d~Iieigav~i~~~~~~~~~f~~~i~P~~~~i~~~~~~ihGIt~~~l~~~p~f~ev~~~f~~fi~ 88 (245) T Consensus 1 fvv~D~ETT~--~~~d~IieIgav~i~~g~i~-~~f~~lv~P~-~~i~~~~~~ihGIt~~~v~~~p~~~~v~~~l~~~l~ 76 (156) T cd06130 1 FVAIDFETAN--ADRASACSIGLVKVRDGQIV-DTFYTLIRPP-TRFDPFNIAIHGITPEDVADAPTFPEVWPEIKPFLG 76 (156) T ss_pred CEEEEEECCC--CCCCEEEEEEEEEEECCEEE-EEEEEEECCC-CCCCHHHHHHHCCCHHHHHCCCCHHHHHHHHHHHCC T ss_conf 9899977898--99996999999999999998-9999987789-879988932208887998409999999999998558 Q ss_pred CCCCEEEEECCCCCCCEEEECHHCCCCCCCCCCHHCCCHHCCCCCCCCC-CCCHHHHHHHHCCCCCCCCCCCCHHHHHHH Q ss_conf 0232023102322431121000001122221000011000000017764-222378999718754555666402699999 Q gi|254780818|r 89 EQNAEWIAHNAKFDVGFINAELQRINKDPLDPSRIIDTLSIARRKHPSS-RNDLNSLCKRYGITISHRSKHGALLDSHLL 167 (245) Q Consensus 89 ~~~~~lVaHNa~FD~~fL~~el~r~~~~~~~~~~~iDTl~lar~~~p~~-~~~L~~l~~~~~i~~~~r~~H~Al~Da~~~ 167 (245) T Consensus 77 --~~~lVaHn~~FD~~fL~~~~~~~~~~~~-~~~~iDtl~l~r~~~~~~~~~~L~~l~~~~gi~~~---~H~Al~DA~at 150 (156) T cd06130 77 --GSLVVAHNASFDRSVLRAALEAYGLPPP-PYQYLCTVRLARRVWPLLPNHKLNTVAEHLGIELN---HHDALEDARAC 150 (156) T ss_pred --CCEEEEECHHHHHHHHHHHHHHCCCCCC-CCCEECHHHHHHHHCCCCCCCCHHHHHHHCCCCCC---CCCCHHHHHHH T ss_conf --9889995778899999999998199998-98588189999997388888999999998599987---87968999999 Q ss_pred HHHHHH Q ss_conf 999999 Q gi|254780818|r 168 SDVYIK 173 (245) Q Consensus 168 a~v~~~ 173 (245) T Consensus 151 a~l~la 156 (156) T cd06130 151 AEILLA 156 (156) T ss_pred HHHHCC T ss_conf 999819

HHsearch alignment for GI: 254780818 and conserved domain: cd06130