>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad. Signal peptide peptidase A (SppA; Peptidase S49; Protease IV): SppAs in this subfamily are found in all three domains of life and are involved in the cleavage of signal peptides after their removal from the precursor proteins by signal peptidases. Site-directed mutagenesis and sequence analysis have shown these bacterial, archaeal and thylakoid SppAs to be serine proteases. The predicted active site serine for members in this family occurs in a transmembrane domain. Mutagenesis studies also suggest that the catalytic center comprises a Ser-Lys dyad (both residues absolutely conserved within bacteria, chloroplast and mitochondrial signal peptidase family members) and not the usual Ser-His-Asp catalytic triad found in the majority of serine proteases. In addition to the carboxyl-terminal protease domain that is conserved in all the S49 family members, the E. coli SppA contains an amino-te

Probab=96.05 E-value=0.09 Score=34.29 Aligned_cols=102 Identities=20% Similarity=0.265 Sum_probs=64.8 Q ss_pred CEEEEEEEEECEEEEEEEEECHHHCCCCCHHHHHHHHHHHHHHHHHCC--CEEEEECCCCCCCCCCHHHHHHHHHHHHHH Q ss_conf 169998787041499999833031853577899999999999986289--689997688877652124677778899999 Q gi|254780820|r 109 SIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKC--PLVMFTASGGARMQEGILSLMQLPRTTIAI 186 (284) Q Consensus 109 avv~G~G~I~G~~vvv~~~df~F~GGSmG~~~geki~~a~e~A~~~~~--PlI~~~~SGGaRMqEG~~sL~qMakt~~a~ 186 (284) T Consensus 3 aVi~~~G~I~~~~------------~~~~~~~~~~i~~~l~~A~~d~~Vkavvl~InSpGG----~~~~---s~~i~~~i 63 (211) T cd07019 3 GVVFANGAIVDGE------------ETQGNVGGDTTAAQIRDARLDPKVKAIVLRVNSPGG----SVTA---SEVIRAEL 63 (211) T ss_pred EEEEEEEEECCCC------------CCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCC----CHHH---HHHHHHHH T ss_conf 9999887883798------------878875899999999999528997389999769697----6899---99999999 Q ss_pred HHHHHCCCCEEEEECC-CCCCEEEEEECCCCCEEEEECCCEEECCC Q ss_conf 9998629988998567-64201111201468525553142110232 Q gi|254780820|r 187 NMLKDAGLPYIVVLTN-PTTGGVTASYAMLGDIHLAEPGAEIGFAG 231 (284) Q Consensus 187 ~~l~~~~lP~I~vl~~-pt~GGv~AS~a~lgDiiiaep~a~igFaG 231 (284) T Consensus 64 ~~~~~~~KPVva~~~~~aaSggY~i--Asaad~I~a~p~s~vGSIG 107 (211) T cd07019 64 AAARAAGKPVVVSAGGAAASGGYWI--STPANYIVANPSTLTGSIG 107 (211) T ss_pred HHHHHCCCCEEEEECCCCCHHHHHH--HHCCCEEEECCCCCEEEEE T ss_conf 9986469979999778443488999--8558989984887356556

HHsearch alignment for GI: 254780820 and conserved domain: cd07019