>pfam05876 Terminase_GpA Phage terminase large subunit (GpA). This family consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities.

Probab=92.89 E-value=0.059 Score=35.65 Aligned_cols=48 Identities=17% Similarity=0.369 Sum_probs=32.3 Q ss_pred CCCEECCCCCCE--------EEHHH--HHHHCCCCCCCCCCEECCHHHHHHHHCCCCCCCC Q ss_conf 601056676872--------21788--9863383889989624379999998455654201 Q gi|254780820|r 24 NLWVKCPETGAM--------VYHKD--LKENQWVISSSDFHMKIPAKERLKFLFDNAKYCL 74 (284) Q Consensus 24 ~lW~kCp~C~~~--------i~~~~--l~~n~~VCp~C~~H~rl~areRi~~l~D~gsf~E 74 (284) T Consensus 198 ~~~vpCPhCg~~q~l~~~~l~w~~~~~p~~a~y~C~~Cg~--~i~e~~k~~m~~-~G~W~~ 255 (552) T pfam05876 198 RYYVPCPHCGEEQELRWERLKWDKGEAPETARYVCPHCGC--VIEEHHKRAMLR-AGRWIA 255 (552) T ss_pred EEEEECCCCCCCCCCCCCCEEECCCCCCCCEEEECCCCCC--CCCHHHHHHHHH-CCEEEE T ss_conf 9986898999865550054664799985534998988988--889999998876-899980

HHsearch alignment for GI: 254780820 and conserved domain: pfam05876