HHsearch alignment for GI: 254780822 and conserved domain: COG2761

>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].
Probab=90.77  E-value=0.43  Score=27.41  Aligned_cols=38  Identities=21%  Similarity=0.370  Sum_probs=29.9

Q ss_pred             HHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHHHC
Q ss_conf             7777623156887999979989858874899989999999841
Q gi|254780822|r   64 EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR  106 (107)
Q Consensus        64 ~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~  106 (107)
T Consensus       175 ~~A~e~gI~gVP~fv~--d~~~---~V~Gaq~~~v~~~al~~~  212 (225)
T COG2761         175 AAAQEMGIRGVPTFVF--DGKY---AVSGAQPYDVLEDALRQL  212 (225)
T ss_pred             HHHHHCCCCCCCEEEE--CCCE---EECCCCCHHHHHHHHHHH
T ss_conf             9999779866866997--1757---653888789999999999