HHsearch alignment for GI: 254780822 and conserved domain: KOG0191

>KOG0191 consensus.
Probab=99.68  E-value=8.2e-17  Score=117.97  Aligned_cols=104  Identities=25%  Similarity=0.536  Sum_probs=94.1

Q ss_pred             EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHCCCCCCEEEEE
Q ss_conf             17757677999998489949999876997022213466665421000--1233322672326577776231568879999
Q gi|254780822|r    3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIEESSEISTRYQISSIPTLILF   80 (107)
Q Consensus         3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~--~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~   80 (107)
T Consensus       146 v~~l~~~~~~~~~~~~~~~~lv~f~aPwc~~ck~l~~~~~~~a~~~~~~~~v~~~~~d~~~~~~~~~~~~v~~~Pt~~~f  225 (383)
T KOG0191         146 VFELTKDNFDETVKDSDADWLVEFYAPWCGHCKKLAPEWEKLAKLLKSKENVELGKIDATVHKSLASRLEVRGYPTLKLF  225 (383)
T ss_pred             CHHCCCCCHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEE
T ss_conf             10024421133322046653899966765688764078999899860456648996036511767777630459648995


Q ss_pred             ECCEEEEEEECCCCCHHHHHHHHHHC
Q ss_conf             79989858874899989999999841
Q gi|254780822|r   81 KDGKVIDRMMPGASSQSDIIEWILSR  106 (107)
Q Consensus        81 ~~g~~~~~~~~g~~~~~~l~~~i~~~  106 (107)
T Consensus       226 ~~~~~~~~~~~~~R~~~~i~~~v~~~  251 (383)
T KOG0191         226 PPGEEDIYYYSGLRDSDSIVSFVEKK  251 (383)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             48986556573223568899999863