HHsearch alignment for GI: 254780822 and conserved domain: KOG0907

>KOG0907 consensus.
Probab=99.84  E-value=1.7e-20  Score=139.14  Aligned_cols=88  Identities=30%  Similarity=0.729  Sum_probs=79.5

Q ss_pred             HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCC
Q ss_conf             84899499998769970222134666654210001233322672326577776231568879999799898588748999
Q gi|254780822|r   16 LECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASS   95 (107)
Q Consensus        16 ~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~   95 (107)
T Consensus        18 ~~~~kliVvdF~a~wCgPCk~i~P~~~~La~~y~~-~~Flkvdvde~~~~~~~~~V~~~PTf~f~k~g~~~~~~v-Ga-~   94 (106)
T KOG0907          18 EAGDKLVVVDFYATWCGPCKAIAPKFEKLAEKYPD-VVFLKVDVDELEEVAKEFNVKAMPTFVFYKGGEEVDEVV-GA-N   94 (106)
T ss_pred             HCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHCCC-CEEEEEECCCHHHHHHHCCCEEEEEEEEEECCEEEEEEE-CC-C
T ss_conf             18997699999889888876502179999977889-789998342208778760861646999998988889984-69-9


Q ss_pred             HHHHHHHHHHC
Q ss_conf             89999999841
Q gi|254780822|r   96 QSDIIEWILSR  106 (107)
Q Consensus        96 ~~~l~~~i~~~  106 (107)
T Consensus        95 ~~~l~~~i~~~  105 (106)
T KOG0907          95 KAELEKKIAKH  105 (106)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999998631