HHsearch alignment for GI: 254780822 and conserved domain: KOG0913

>KOG0913 consensus.
Probab=99.19  E-value=3.9e-12  Score=91.04  Aligned_cols=99  Identities=28%  Similarity=0.617  Sum_probs=86.4

Q ss_pred             EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE
Q ss_conf             177576779999984899499998769970222134666654210001-2333226723265777762315688799997
Q gi|254780822|r    3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISSIPTLILFK   81 (107)
Q Consensus         3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~   81 (107)
T Consensus        26 ~~~~~eenw~~-~l--~gewmi~~~ap~~psc~~~~~~~~~~a~~s~dL~v~va~VDvt~npgLsGRF~vtaLptIYHvk  102 (248)
T KOG0913          26 LTRIDEENWKE-LL--TGEWMIEFGAPWCPSCSDLIPHLENFATVSLDLGVKVAKVDVTTNPGLSGRFLVTALPTIYHVK  102 (248)
T ss_pred             EEEECCCCHHH-HH--CHHHHHHHCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEECCEEEEEE
T ss_conf             57843544655-31--4188998557788530023899851577667875058888888456632246777423588850


Q ss_pred             CCEEEEEEECCCCCHHHHHHHHHHC
Q ss_conf             9989858874899989999999841
Q gi|254780822|r   82 DGKVIDRMMPGASSQSDIIEWILSR  106 (107)
Q Consensus        82 ~g~~~~~~~~g~~~~~~l~~~i~~~  106 (107)
T Consensus       103 DGeF--rrysgaRdk~dfisf~~~r  125 (248)
T KOG0913         103 DGEF--RRYSGARDKNDFISFEEHR  125 (248)
T ss_pred             CCCC--CCCCCCCCCHHHHHHHHHH
T ss_conf             4553--1224765520478899866