HHsearch alignment for GI: 254780822 and conserved domain: KOG2501

>KOG2501 consensus.
Probab=98.64  E-value=2.6e-08  Score=69.06  Aligned_cols=71  Identities=35%  Similarity=0.737  Sum_probs=55.4

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-----CCCCCCCCCC-----------------------CHHHHHHH
Q ss_conf             8994999987699702221346666542100012-----3332267232-----------------------65777762
Q gi|254780822|r   18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-----VKITKLDIEE-----------------------SSEISTRY   69 (107)
Q Consensus        18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-----i~~~~vd~d~-----------------------~~~l~~~~   69 (107)
T Consensus        32 ~gKvV~lyFsA~wC~pCR~FTP~Lk~fYe~l~~~~~~fEVvfVS~D~~~~~~~~y~~~~~~~W~~iPf~d~~~~~l~~ky  111 (157)
T KOG2501          32 QGKVVGLYFSAHWCPPCRDFTPILKDFYEELKDNAAPFEVVFVSSDRDEESLDEYMLEHHGDWLAIPFGDDLIQKLSEKY  111 (157)
T ss_pred             CCCEEEEEEEEEECCCHHHCCCHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHC
T ss_conf             78689999887877835648866899999997368966999995688778999999963998688428987999878761


Q ss_pred             CCCCCCEEEEEE-CCEEEEE
Q ss_conf             315688799997-9989858
Q gi|254780822|r   70 QISSIPTLILFK-DGKVIDR   88 (107)
Q Consensus        70 ~v~~~Pt~~~~~-~g~~~~~   88 (107)
T Consensus       112 ~v~~iP~l~i~~~dG~~v~~  131 (157)
T KOG2501         112 EVKGIPALVILKPDGTVVTE  131 (157)
T ss_pred             CCCCCCEEEEECCCCCEEHH
T ss_conf             66767536786599878657