HHsearch alignment for GI: 254780822 and conserved domain: PRK03147

>PRK03147 thiol-disulfide oxidoreductase; Provisional.
Probab=99.58  E-value=9.4e-15  Score=106.11  Aligned_cols=87  Identities=26%  Similarity=0.693  Sum_probs=74.8

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCC----------------------CHHHHHHHCCCCC
Q ss_conf             8994999987699702221346666542100012-3332267232----------------------6577776231568
Q gi|254780822|r   18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEE----------------------SSEISTRYQISSI   74 (107)
Q Consensus        18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d~----------------------~~~l~~~~~v~~~   74 (107)
T Consensus        61 kGK~vll~FWAtWC~pC~~E~P~L~~l~~~~~~~~v~vi~i~~d~~~~~v~~f~~~~~~~~pv~~D~~~~~~~~~~v~~~  140 (176)
T PRK03147         61 KGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIAVNVDETDIAVKNFVNQYGLKFPVAIDKGRQVIDAYGVGPL  140 (176)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHCCCCCEEEECCCCHHHHHCCCCCC
T ss_conf             99979999978979275467155999999853064478522078878889888987099622898797358987699988


Q ss_pred             CEEEEEE-CCEEEEEEECCCCCHHHHHHHHHH
Q ss_conf             8799997-998985887489998999999984
Q gi|254780822|r   75 PTLILFK-DGKVIDRMMPGASSQSDIIEWILS  105 (107)
Q Consensus        75 Pt~~~~~-~g~~~~~~~~g~~~~~~l~~~i~~  105 (107)
T Consensus       141 P~t~lId~~G~I~~~-~~G~i~~~~l~~~i~~  171 (176)
T PRK03147        141 PTTFLIDKDGKVVKV-ITGEMTEEMLEEYLNK  171 (176)
T ss_pred             CEEEEECCCCEEEEE-EECCCCHHHHHHHHHH
T ss_conf             869999799979999-9789999999999998