HHsearch alignment for GI: 254780822 and conserved domain: PTZ00051

>PTZ00051 thioredoxin; Provisional.
Probab=99.88  E-value=1.6e-22  Score=150.93  Aligned_cols=94  Identities=32%  Similarity=0.760  Sum_probs=83.4

Q ss_pred             EEE-CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC
Q ss_conf             775-7677999998489949999876997022213466665421000123332267232657777623156887999979
Q gi|254780822|r    4 LKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD   82 (107)
Q Consensus         4 i~i-~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~   82 (107)
T Consensus         3 ~eI~s~e~f~~-~i~~~~~vvV~F~a~wC~pCk~~~p~~~~l~~~~~-~~~f~~vd~d~~~~l~~~~~I~~~PT~~~~k~   80 (98)
T PTZ00051          3 HEVTSKEEFEK-TLSGDSVVVVDFYAEWCGPCMRFAPQFEELAKEHP-KLVFVKVNVDELQELAQKYNVTSLPTFKVFKS   80 (98)
T ss_pred             EECCCHHHHHH-HHCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHCC-CEEEEEEECCCCHHHHHHCCCEEEEEEEEEEC
T ss_conf             89789999999-97589919999979998751126348999987678-53799998858999999879879768999999


Q ss_pred             CEEEEEEECCCCCHHHHHH
Q ss_conf             9898588748999899999
Q gi|254780822|r   83 GKVIDRMMPGASSQSDIIE  101 (107)
Q Consensus        83 g~~~~~~~~g~~~~~~l~~  101 (107)
T Consensus        81 G~~v~~~-~Ga-~~~~L~~   97 (98)
T PTZ00051         81 GQVVGEF-LGA-NKEGLKQ   97 (98)
T ss_pred             CEEEEEE-ECC-CHHHHHC
T ss_conf             9999999-687-9899630