HHsearch alignment for GI: 254780822 and conserved domain: cd02954

>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein. It is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 interacts with multiple splicing-associated proteins, suggesting that it functions at multiple control points in the splicing of pre-mRNA as part of a large spliceosomal complex involving many protein-protein interactions. U5 snRNP contains seven core proteins (common to all snRNPs) and nine U5-specific proteins, one of which is Dim1. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif. It is essential for G2/M phase transition, as a consequence to its role in pre-mRNA splicing.
Probab=98.34  E-value=2.7e-06  Score=57.40  Aligned_cols=91  Identities=22%  Similarity=0.431  Sum_probs=73.9

Q ss_pred             HHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEEC-C
Q ss_conf             998489949999876997022213466665421000123332267232657777623156887999979989858874-8
Q gi|254780822|r   14 EVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMP-G   92 (107)
Q Consensus        14 ~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~-g   92 (107)
T Consensus         9 I~~e~drvvViRFGr~~d~~Cm~mDeiL~k~a~~v~nfa~iylvDideVpdfn~myeL~dp~t~mFFfrnkHm~vD~GTg   88 (114)
T cd02954           9 ILSEEEKVVVIRFGRDWDPVCMQMDEVLAKIAEDVSNFAVIYLVDIDEVPDFNKMYELYDPPTVMFFFRNKHMKIDLGTG   88 (114)
T ss_pred             HHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHCCCCCCCEEEEEECCCEEEEEECCC
T ss_conf             74667269999805999927988989999999997546089999876463133210036785689998385689973699


Q ss_pred             --------CCCHHHHHHHHH
Q ss_conf             --------999899999998
Q gi|254780822|r   93 --------ASSQSDIIEWIL  104 (107)
Q Consensus        93 --------~~~~~~l~~~i~  104 (107)
T Consensus        89 nnnK~n~~~~~kqe~IDiie  108 (114)
T cd02954          89 NNNKINWVFEDKQEFIDIIE  108 (114)
T ss_pred             CCCEEEEECCCHHHHHHHHH
T ss_conf             87568886283888999999