>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain. DnaJ is a member of the 40 kDa heat-shock protein (Hsp40) family of molecular chaperones, which regulate the activity of Hsp70s. TRX is involved in the redox regulation of many protein substrates through the reduction of disulfide bonds. TRX has been implicated to catalyse the reduction of Hsp33, a chaperone holdase that binds to unfolded protein intermediates. The presence of DnaJ and TRX domains in members of this family suggests that they could be involved in a redox-regulated chaperone network.

Probab=99.94 E-value=5.8e-27 Score=176.42 Aligned_cols=102 Identities=14% Similarity=0.454 Sum_probs=95.3 Q ss_pred EEEECHHHHHHHHHH--CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 177576779999984--899499998769970222134666654210001-23332267232657777623156887999 Q gi|254780822|r 3 ALKVDTKSFDSEVLE--CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~~~~f~~~v~~--~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) T Consensus 6 k~~It~~~f~~~Vl~~S~~kPvlV~F~A~WC~pC~~l~P~~~~~a~ele~~~v~~~~Vn~d~~~~la~~~gV~siPtl~~ 85 (111) T cd02963 6 KYSLTFSQYENEIVPKSFKKPYLIKITSDWCFSCIHIEPVWKEVIQELEPLGVGIATVNAGHERRLARKLGAHSVPAIVG 85 (111) T ss_pred EEEEEHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCCCCCCEEEE T ss_conf 89855999889998604897399999997478788650799999998345755999994886989999819986898999 Q ss_pred EECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 97998985887489998999999984 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) T Consensus 86 ~~~G~~v~~~-~G~~s~~~i~~Fi~k 110 (111) T cd02963 86 IINGQVTFYH-DSSFTKQHVVDFVRK 110 (111) T ss_pred EECCEEEEEE-CCCCCHHHHHHHHHH T ss_conf 9999998866-376798999999973

HHsearch alignment for GI: 254780822 and conserved domain: cd02963