HHsearch alignment for GI: 254780822 and conserved domain: cd02983

>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. The C-terminal domain is likely involved in substrate binding, similar to the b and b' domains of PDI.
Probab=97.72  E-value=0.00018  Score=46.83  Aligned_cols=103  Identities=15%  Similarity=0.237  Sum_probs=79.5

Q ss_pred             EEEEC-HHHHHHHHHHCCCCEEEEEEC---CCCHHHH-HHHHHHHHHHHHCCCC-CCCCCCCCCCCHHHHHHHCC--CCC
Q ss_conf             17757-677999998489949999876---9970222-1346666542100012-33322672326577776231--568
Q gi|254780822|r    3 ALKVD-TKSFDSEVLECSNPVVVDFWA---SWCRPCV-KLSPIIDDIADELADK-VKITKLDIEESSEISTRYQI--SSI   74 (107)
Q Consensus         3 ~i~i~-~~~f~~~v~~~~~~vlv~f~a---~wC~~C~-~~~p~~~~l~~~~~~~-i~~~~vd~d~~~~l~~~~~v--~~~   74 (107)
T Consensus         4 v~el~s~~~~~~~-C~~~~lCviafLP~ilD~~a~~Rn~yl~~l~~~a~k~k~~p~~~~W~eag~Q~~lE~~l~vg~~Gy   82 (130)
T cd02983           4 IIELTSEDVFEET-CEEKQLCIIAFLPHILDCQASCRNKYLEILKSVAEKFKKKPWGWLWTEAGAQLDLEEALNIGGFGY   82 (130)
T ss_pred             CEEECCHHHHHHH-CCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHCCCCCCC
T ss_conf             3565499999865-578985999972831137788999999999999999617974699954765887998618677898


Q ss_pred             CEEEEEECCEEEEEEECCCCCHHHHHHHHHHC
Q ss_conf             87999979989858874899989999999841
Q gi|254780822|r   75 PTLILFKDGKVIDRMMPGASSQSDIIEWILSR  106 (107)
Q Consensus        75 Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~  106 (107)
T Consensus        83 Pa~valn~~K~~ya~~rGsFs~~~i~eFl~~v  114 (130)
T cd02983          83 PAMVAINFRKMKFATLKGSFSEDGINEFLREL  114 (130)
T ss_pred             CEEEEEECCCCHHHHHHCCCCHHHHHHHHHHH
T ss_conf             36899712333446763666787899999998