>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions. It specifically binds G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane. This impedes the formation of a functional G protein trimer (G protein alphabetagamma), thereby inhibiting G protein-mediated signal transduction. Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain.

Probab=99.23 E-value=8.6e-11 Score=83.29 Aligned_cols=102 Identities=20% Similarity=0.393 Sum_probs=85.0 Q ss_pred EEEEC-HHHHHHHHHHCC--CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 17757-677999998489--949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 3 ALKVD-TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~-~~~f~~~v~~~~--~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) T Consensus 64 v~ei~s~~~fl~~V~~~~~~~~VVVhiY~~~~~~C~~l~~~L~~LA~k~~~-vKF~ki~a~~~~-~~~~~~~~~lPtllv 141 (175) T cd02987 64 VYELDSGEQFLDAIDKEGKDTTVVVHIYEPGIPGCAALNSSLLCLAAEYPA-VKFCKIRASATG-ASDEFDTDALPALLV 141 (175) T ss_pred EEECCCHHHHHHHHHCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHCCC-EEEEEEECCCCC-CCCCCCCCCCCEEEE T ss_conf 897378889999985659983899999609996589999999999986893-289998616677-665577689998999 Q ss_pred EECCEEEEEEEC-----C-CCCHHHHHHHHHHC Q ss_conf 979989858874-----8-99989999999841 Q gi|254780822|r 80 FKDGKVIDRMMP-----G-ASSQSDIIEWILSR 106 (107) Q Consensus 80 ~~~g~~~~~~~~-----g-~~~~~~l~~~i~~~ 106 (107) T Consensus 142 Yk~G~l~~~~v~~~~~~g~~f~~~dlE~~L~~~ 174 (175) T cd02987 142 YKGGELIGNFVRVTEDLGEDFDAEDLESFLVEY 174 (175) T ss_pred EECCEEEEEEEEHHHHCCCCCCHHHHHHHHHHC T ss_conf 989977886861777479979899999999964

HHsearch alignment for GI: 254780822 and conserved domain: cd02987