HHsearch alignment for GI: 254780822 and conserved domain: cd02991

>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals. ETEA shows homology to Fas-associated factor 1 (FAF1); both containing UAS and UBX (ubiquitin-associated) domains. Compared to FAF1, however, ETEA lacks the ubiquitin-associated UBA domain and a nuclear targeting domain. The function of ETEA is still unknown. A yeast two-hybrid assay showed that it can interact with Fas. Because of its homology to FAF1, it is postulated that ETEA could be involved in modulating Fas-mediated apoptosis of T-cells and eosinophils of atopic dermatitis patients, making them more resistant to apoptosis.
Probab=96.24  E-value=0.05  Score=32.82  Aligned_cols=89  Identities=11%  Similarity=0.178  Sum_probs=62.5

Q ss_pred             HHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCC--CHHHHHHHCCCCCCEEEEE--ECC--EEE
Q ss_conf             84899499998769970222134666---65421000123332267232--6577776231568879999--799--898
Q gi|254780822|r   16 LECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEE--SSEISTRYQISSIPTLILF--KDG--KVI   86 (107)
Q Consensus        16 ~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~--~~~l~~~~~v~~~Pt~~~~--~~g--~~~   86 (107)
T Consensus        14 k~e~KfLlVYLhs~~h~dt~~F~r~~L~~~~vv~~in~n~v~Wggdv~~~Eg~~va~~l~~~~fPfla~i~l~~~~m~vv   93 (116)
T cd02991          14 KQELRFLLVYLHGDDHQDTDEFCRNTLCAPEVIEYINTRMLFWACSVAKPEGYRVSQALRERTYPFLAMIMLKDNRMTIV   93 (116)
T ss_pred             HHHCCEEEEEECCCCCCCHHHHHHHHCCCHHHHHHHHHCEEEEEEECCCHHHHHHHHHCCCCCCCEEEEEEEECCCEEEE
T ss_conf             98385899998179998888999986388999999750869999755975899999976888799589999708834899


Q ss_pred             EEEECCCCCHHHHHHHHHH
Q ss_conf             5887489998999999984
Q gi|254780822|r   87 DRMMPGASSQSDIIEWILS  105 (107)
Q Consensus        87 ~~~~~g~~~~~~l~~~i~~  105 (107)
T Consensus        94 ~r-~eG~~~p~el~~~L~~  111 (116)
T cd02991          94 GR-LEGLIQPEDLINRLTF  111 (116)
T ss_pred             EE-EECCCCHHHHHHHHHH
T ss_conf             99-5268998999999999