>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein. QSOX oxidizes thiol groups to disulfides like PDI, however, unlike PDI, this oxidation is accompanied by the reduction of oxygen to hydrogen peroxide. QSOX is localized in high concentrations in cells with heavy secretory load and prefers peptides and proteins as substrates, not monothiols like glutathione. Inside the cell, QSOX is found in the endoplasmic reticulum and Golgi. The flow of reducing equivalents in a QSOX-catalyzed reaction goes from the dithiol substrate - dithiol of the QSOX TRX domain - dithiols of the QSOX ERV1p domain - FAD - oxygen.

Probab=99.92 E-value=2.5e-25 Score=167.04 Aligned_cols=103 Identities=23% Similarity=0.482 Sum_probs=89.8 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC---CCCCCCCCCCC--CCHHHHHHHCCCCCCE Q ss_conf 517757677999998489949999876997022213466665421000---12333226723--2657777623156887 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA---DKVKITKLDIE--ESSEISTRYQISSIPT 76 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~---~~i~~~~vd~d--~~~~l~~~~~v~~~Pt 76 (107) T Consensus 2 ~V~~L~~~nF~~~v~~~~~~~lV~FYApWC~hCk~l~P~~~~~A~~~~~~~~~v~~~~VdC~~~~n~~lc~~~~I~~yPT 81 (114) T cd02992 2 PVIVLDAASFNSALLGSPSAWLVEFYASWCGHCRAFAPTWKKLARDLRKWRPVVRVAAVDCADEENVALCRDFGVTGYPT 81 (114) T ss_pred CCEECCHHHHHHHHHCCCCCEEEEEECCCCHHHHHCCHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHCCCCEEEE T ss_conf 81898534279997459970999998997831543486999999986343885699998536524665786669827017 Q ss_pred EEEEECCEEEEE---EECC-CCCHHHHHHHHH Q ss_conf 999979989858---8748-999899999998 Q gi|254780822|r 77 LILFKDGKVIDR---MMPG-ASSQSDIIEWIL 104 (107) Q Consensus 77 ~~~~~~g~~~~~---~~~g-~~~~~~l~~~i~ 104 (107) T Consensus 82 l~~f~~g~k~~~~~~~~~g~~r~~~~l~~~~i 113 (114) T cd02992 82 LRYFPPFSKEATDGLKQEGPERDVNELREALI 113 (114) T ss_pred EEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH T ss_conf 99964989789986445389989999998860

HHsearch alignment for GI: 254780822 and conserved domain: cd02992