HHsearch alignment for GI: 254780822 and conserved domain: cd02994

>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX. TMX is a type I integral membrane protein; the N-terminal redox active TRX domain is present in the endoplasmic reticulum (ER) lumen while the C-terminus is oriented towards the cytoplasm. It is expressed in many cell types and its active site motif (CPAC) is unique. In vitro, TMX reduces interchain disulfides of insulin and renatures inactive RNase containing incorrect disulfide bonds. The C. elegans homolog, DPY-11, is expressed only in the hypodermis and resides in the cytoplasm. It is required for body and sensory organ morphogeneis. Another uncharacterized TRX-related transmembrane protein, human TMX4, is included in the alignment. The active site sequence of TMX4 is CPSC.
Probab=99.94  E-value=8.5e-27  Score=175.47  Aligned_cols=99  Identities=27%  Similarity=0.616  Sum_probs=89.8

Q ss_pred             CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCCCEEEEE
Q ss_conf             5177576779999984899499998769970222134666654210001-233322672326577776231568879999
Q gi|254780822|r    2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISSIPTLILF   80 (107)
Q Consensus         2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~   80 (107)
T Consensus         2 ~Vv~Lt~~nf~~-~~~--g~~lV~FyApWC~~Ck~l~P~~e~la~~~~~~~v~i~~vD~~~~~~l~~~~~I~~~PTi~~~   78 (101)
T cd02994           2 NVVELTDSNWTL-VLE--GEWMIEFYAPWCPACQQLQPEWEEFADWSDDLGINVAKVDVTQEPGLSGRFFVTALPTIYHA   78 (101)
T ss_pred             CEEEECHHHHHH-HHC--CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHCCEEEEEEEEEE
T ss_conf             749956551898-838--98899998998735777748999999864678779999017559657854780784189998


Q ss_pred             ECCEEEEEEECCCCCHHHHHHHHHH
Q ss_conf             7998985887489998999999984
Q gi|254780822|r   81 KDGKVIDRMMPGASSQSDIIEWILS  105 (107)
Q Consensus        81 ~~g~~~~~~~~g~~~~~~l~~~i~~  105 (107)
T Consensus        79 ~~G~~--~~y~G~rt~~~l~~fi~e  101 (101)
T cd02994          79 KDGVF--RRYQGPRDKEDLISFIEE  101 (101)
T ss_pred             ECCCE--EEEECCCCHHHHHHHHHC
T ss_conf             19938--661479999999999709