HHsearch alignment for GI: 254780822 and conserved domain: cd02995

>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1. PDI, ERp72 and ERp57 are endoplasmic reticulum (ER)-resident eukaryotic proteins involved in oxidative protein folding. They are oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. PDI and ERp57 have the abb'a' domain structure (where a and a' are redox active TRX domains while b and b' are redox inactive TRX-like domains). PDI also contains an acidic region (c domain) after the a' domain that is absent in ERp57. ERp72 has an additional a domain at the N-terminus (a"abb'a' domain structure). ERp57 interacts with the lectin chaperones, calnexin and calreticu
Probab=99.93  E-value=7e-26  Score=170.22  Aligned_cols=101  Identities=30%  Similarity=0.649  Sum_probs=92.7

Q ss_pred             CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHHHHHCCCCCCEEEE
Q ss_conf             5177576779999984899499998769970222134666654210001--23332267232657777623156887999
Q gi|254780822|r    2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--KVKITKLDIEESSEISTRYQISSIPTLIL   79 (107)
Q Consensus         2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~   79 (107)
T Consensus         1 pV~~lt~~nF~~~V~~~~k~vlV~Fya~wC~~C~~~~p~~~~la~~~~~~~~v~~~~vD~~~n-~l~~~~~i~~~Pti~l   79 (104)
T cd02995           1 PVKVVVGKNFDEVVLDSDKDVLVEFYAPWCGHCKALAPIYEELAEKLKGDDNVVIAKMDATAN-DVPSEFVVDGFPTILF   79 (104)
T ss_pred             CEEEECCCCHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCC-CCHHHCCCCCCCEEEE
T ss_conf             959935769889983799859999979977564212744999999952799718999717877-4564548540778999


Q ss_pred             EECCEEE-EEEECCCCCHHHHHHHH
Q ss_conf             9799898-58874899989999999
Q gi|254780822|r   80 FKDGKVI-DRMMPGASSQSDIIEWI  103 (107)
Q Consensus        80 ~~~g~~~-~~~~~g~~~~~~l~~~i  103 (107)
T Consensus        80 f~~g~~~~~~~y~G~r~~~~l~~Fi  104 (104)
T cd02995          80 FPAGDKSNPIKYEGDRTLEDLIKFI  104 (104)
T ss_pred             EECCCCCCCEECCCCCCHHHHHHHC
T ss_conf             9896777756747888999999659