HHsearch alignment for GI: 254780822 and conserved domain: cd03003

>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation.
Probab=99.94  E-value=3e-27  Score=178.04  Aligned_cols=99  Identities=20%  Similarity=0.458  Sum_probs=92.2

Q ss_pred             CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE
Q ss_conf             51775767799999848994999987699702221346666542100012333226723265777762315688799997
Q gi|254780822|r    2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK   81 (107)
Q Consensus         2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~   81 (107)
T Consensus         2 ~Vv~L~~~nF~~~v-~~~~~~~V~FyApWC~hCk~l~P~~~~~a~~~~~~v~ia~vdc~~~~~lc~~~~V~~yPTl~~f~   80 (101)
T cd03003           2 EIVTLDRGDFDAAV-NSGEIWFVNFYSPRCSHCHDLAPTWREFAKEMDGVIRIGAVNCGDDRMLCRSQGVNSYPSLYVFP   80 (101)
T ss_pred             CEEECCHHHHHHHH-HCCCEEEEEEECCCCHHHHHHCHHHHHHHHHHCCCEEEEEEECCCCHHHHCCCEEEECCEEEEEC
T ss_conf             74991788789998-36982999996885888886468999999983696699998525693340134567624899980


Q ss_pred             CCEEEEEEECCCCCHHHHHHH
Q ss_conf             998985887489998999999
Q gi|254780822|r   82 DGKVIDRMMPGASSQSDIIEW  102 (107)
Q Consensus        82 ~g~~~~~~~~g~~~~~~l~~~  102 (107)
T Consensus        81 ~G~~~~-~Y~G~Rt~~~l~~F  100 (101)
T cd03003          81 SGMNPE-KYYGDRSKESLVKF  100 (101)
T ss_pred             CCCEEE-EEECCCCHHHHHHH
T ss_conf             997014-55088999999955