HHsearch alignment for GI: 254780822 and conserved domain: cd03018

>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE. AhpE is described as a 1-cys PRX because of the absence of a resolving cysteine. The structure and sequence of AhpE, however, show greater similarity to 2-cys PRXs than 1-cys PRXs. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. The first step of catalysis is the nucleophilic attack by the peroxidatic cysteine on the peroxide leading to the formation of a cysteine sulfenic acid intermediate. The absence of a resolving cysteine suggests that functional AhpE is regenerated by an external reductant. The solution behavior and crystal structure of AhpE show that it forms dimers and octamers.
Probab=98.38  E-value=1.7e-06  Score=58.61  Aligned_cols=87  Identities=15%  Similarity=0.274  Sum_probs=62.1

Q ss_pred             CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCC-----------------------CCHHHHHHHCCC
Q ss_conf             8994999987-69970222134666654210001-2333226723-----------------------265777762315
Q gi|254780822|r   18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDIE-----------------------ESSEISTRYQIS   72 (107)
Q Consensus        18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d-----------------------~~~~l~~~~~v~   72 (107)
T Consensus        27 g~~~vvl~F~p~~~cp~C~~e~~~~~~~~~~~~~~~v~Vv~IS~D~~~~~~~f~~~~~l~fpllsD~~~~~~va~~ygv~  106 (149)
T cd03018          27 GRKPVVLVFFPLAFTPVCTKELCALRDSLELFEAAGAEVLGISVDSPFSLRAWAEENGLTFPLLSDFWPHGEVAKAYGVF  106 (149)
T ss_pred             CCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCHHHHCCCC
T ss_conf             99809999988889997587898888888876347839996369999999999998799961999689870249886995


Q ss_pred             ------CCCEEEEE-ECCEEEEEEECC---CCCHHHHHHHHH
Q ss_conf             ------68879999-799898588748---999899999998
Q gi|254780822|r   73 ------SIPTLILF-KDGKVIDRMMPG---ASSQSDIIEWIL  104 (107)
Q Consensus        73 ------~~Pt~~~~-~~g~~~~~~~~g---~~~~~~l~~~i~  104 (107)
T Consensus       107 ~~~~g~~~r~tfiID~~G~V~~~~v~~~~~~r~~~~~~~~l~  148 (149)
T cd03018         107 DEDLGVAERAVFVIDRDGIIRYAWVSDDGEPRDLPDYDEALD  148 (149)
T ss_pred             CCCCCCCCCEEEEECCCCEEEEEEEECCCCCCCHHHHHHHHC
T ss_conf             067798448899997999899999907996788579999965