Query gi|254780822|ref|YP_003065235.1| thioredoxin [Candidatus Liberibacter asiaticus str. psy62] Match_columns 107 No_of_seqs 127 out of 9085 Neff 8.5 Searched_HMMs 39220 Date Sun May 29 17:59:28 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780822.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR01068 thioredoxin thioredo 100.0 4.8E-36 1.2E-40 228.7 9.0 101 6-107 1-101 (101) 2 TIGR01126 pdi_dom protein disu 100.0 2.5E-33 6.4E-38 213.1 5.5 102 6-107 1-107 (107) 3 TIGR01130 ER_PDI_fam protein d 100.0 1.4E-32 3.5E-37 208.8 6.1 105 2-107 2-110 (522) 4 PRK09381 trxA thioredoxin; Pro 100.0 2.2E-31 5.5E-36 201.9 11.4 106 1-107 1-108 (109) 5 PRK10996 thioredoxin 2; Provis 100.0 2.5E-30 6.3E-35 195.8 10.9 103 3-107 37-139 (139) 6 cd03001 PDI_a_P5 PDIa family, 100.0 8.8E-29 2.2E-33 186.9 8.7 102 3-104 2-103 (103) 7 PTZ00102 disulphide isomerase; 100.0 2.6E-28 6.6E-33 184.2 9.1 101 3-106 35-138 (479) 8 cd02996 PDI_a_ERp44 PDIa famil 100.0 2.6E-28 6.7E-33 184.2 9.1 101 2-103 2-108 (108) 9 cd03004 PDI_a_ERdj5_C PDIa fam 100.0 2E-28 5E-33 184.9 7.8 102 2-103 2-104 (104) 10 TIGR01130 ER_PDI_fam protein d 99.9 5.1E-29 1.3E-33 188.2 4.1 103 3-106 368-475 (522) 11 cd02949 TRX_NTR TRX domain, no 99.9 9.3E-28 2.4E-32 181.0 10.1 95 9-104 3-97 (97) 12 pfam00085 Thioredoxin Thioredo 99.9 1.5E-27 3.9E-32 179.8 10.6 103 3-106 2-104 (104) 13 cd03002 PDI_a_MPD1_like PDI fa 99.9 1.7E-27 4.5E-32 179.4 9.3 103 2-104 1-109 (109) 14 cd02963 TRX_DnaJ TRX domain, D 99.9 5.8E-27 1.5E-31 176.4 11.2 102 3-105 6-110 (111) 15 cd03005 PDI_a_ERp46 PDIa famil 99.9 4.7E-27 1.2E-31 177.0 9.9 98 3-103 2-102 (102) 16 cd03003 PDI_a_ERdj5_N PDIa fam 99.9 3E-27 7.8E-32 178.0 8.8 99 2-102 2-100 (101) 17 COG3118 Thioredoxin domain-con 99.9 6.7E-27 1.7E-31 176.1 9.1 104 3-107 25-130 (304) 18 cd02994 PDI_a_TMX PDIa family, 99.9 8.5E-27 2.2E-31 175.5 9.6 99 2-105 2-101 (101) 19 cd02998 PDI_a_ERp38 PDIa famil 99.9 1.2E-26 3E-31 174.7 9.4 101 3-103 2-105 (105) 20 cd02956 ybbN ybbN protein fami 99.9 1.4E-26 3.5E-31 174.3 9.5 95 9-104 1-96 (96) 21 KOG0910 consensus 99.9 1.5E-26 3.7E-31 174.1 9.4 102 5-107 47-148 (150) 22 cd02997 PDI_a_PDIR PDIa family 99.9 1.7E-26 4.3E-31 173.7 9.4 99 3-103 2-104 (104) 23 PTZ00102 disulphide isomerase; 99.9 8.1E-27 2.1E-31 175.6 7.4 105 2-106 360-466 (479) 24 cd02995 PDI_a_PDI_a'_C PDIa fa 99.9 7E-26 1.8E-30 170.2 7.2 101 2-103 1-104 (104) 25 cd02993 PDI_a_APS_reductase PD 99.9 1.9E-25 4.8E-30 167.7 7.7 102 2-103 2-109 (109) 26 cd02992 PDI_a_QSOX PDIa family 99.9 2.5E-25 6.3E-30 167.0 7.4 103 2-104 2-113 (114) 27 cd03000 PDI_a_TMX3 PDIa family 99.9 7E-25 1.8E-29 164.5 9.2 99 3-106 2-103 (104) 28 cd02999 PDI_a_ERp44_like PDIa 99.9 6.3E-25 1.6E-29 164.7 8.3 99 3-103 2-100 (100) 29 cd02950 TxlA TRX-like protein 99.9 3E-24 7.6E-29 160.8 8.9 93 13-106 14-109 (142) 30 cd02984 TRX_PICOT TRX domain, 99.9 7.4E-24 1.9E-28 158.6 10.4 96 7-104 1-97 (97) 31 KOG0190 consensus 99.9 5.9E-24 1.5E-28 159.1 8.0 102 3-106 27-131 (493) 32 cd02961 PDI_a_family Protein D 99.9 8E-24 2E-28 158.4 7.7 99 4-103 1-101 (101) 33 cd02985 TRX_CDSP32 TRX family, 99.9 6.5E-23 1.6E-27 153.1 10.8 97 7-106 2-102 (103) 34 cd02948 TRX_NDPK TRX domain, T 99.9 1.5E-22 3.8E-27 151.0 10.7 99 4-106 2-102 (102) 35 cd02989 Phd_like_TxnDC9 Phosdu 99.9 5.4E-23 1.4E-27 153.6 7.0 88 3-93 6-94 (113) 36 PTZ00051 thioredoxin; Provisio 99.9 1.6E-22 4E-27 150.9 9.0 94 4-101 3-97 (98) 37 cd02947 TRX_family TRX family; 99.8 2.4E-21 6.1E-26 144.1 8.1 93 9-104 1-93 (93) 38 KOG0908 consensus 99.8 3.4E-21 8.7E-26 143.2 8.8 103 1-106 1-105 (288) 39 KOG0190 consensus 99.8 1.3E-21 3.4E-26 145.5 6.2 102 3-106 368-472 (493) 40 KOG0907 consensus 99.8 1.7E-20 4.4E-25 139.1 10.0 88 16-106 18-105 (106) 41 cd02957 Phd_like Phosducin (Ph 99.8 1.1E-19 2.9E-24 134.5 11.3 100 2-103 5-112 (113) 42 cd02962 TMX2 TMX2 family; comp 99.8 4.6E-19 1.2E-23 130.9 8.1 88 3-90 30-125 (152) 43 pfam01216 Calsequestrin Calseq 99.8 9.1E-19 2.3E-23 129.2 9.2 101 3-107 13-121 (350) 44 cd03006 PDI_a_EFP1_N PDIa fami 99.8 3.9E-19 1E-23 131.3 6.4 101 2-103 10-113 (113) 45 KOG0912 consensus 99.8 3E-19 7.7E-24 132.0 5.7 101 6-107 1-106 (375) 46 KOG4277 consensus 99.8 2.3E-18 6E-23 126.9 7.2 86 18-105 42-130 (468) 47 KOG0191 consensus 99.7 6E-18 1.5E-22 124.5 8.0 104 3-107 31-134 (383) 48 cd02953 DsbDgamma DsbD gamma f 99.7 6E-18 1.5E-22 124.5 7.8 94 10-104 3-104 (104) 49 KOG0191 consensus 99.7 8.2E-17 2.1E-21 118.0 6.8 104 3-106 146-251 (383) 50 PHA02125 thioredoxin-like prot 99.7 7.7E-17 2E-21 118.1 6.0 73 22-103 1-73 (75) 51 KOG1731 consensus 99.7 1.8E-17 4.7E-22 121.7 1.5 105 2-106 40-152 (606) 52 PRK03147 thiol-disulfide oxido 99.6 9.4E-15 2.4E-19 106.1 8.8 87 18-105 61-171 (176) 53 PRK00293 dipZ thiol:disulfide 99.6 8.2E-15 2.1E-19 106.5 7.8 97 8-105 466-574 (577) 54 cd02951 SoxW SoxW family; SoxW 99.6 3.1E-14 7.9E-19 103.1 9.7 95 9-104 4-116 (125) 55 cd03010 TlpA_like_DsbE TlpA-li 99.5 7.7E-14 2E-18 100.9 6.6 80 18-100 24-127 (127) 56 cd03011 TlpA_like_ScsD_MtbDsbE 99.5 1.3E-13 3.4E-18 99.5 7.7 82 18-102 19-121 (123) 57 cd03009 TryX_like_TryX_NRX Try 99.5 8.8E-14 2.2E-18 100.5 5.5 72 18-89 17-116 (131) 58 cd03012 TlpA_like_DipZ_like Tl 99.4 4.1E-13 1E-17 96.7 7.0 75 18-93 22-125 (126) 59 cd02964 TryX_like_family Trypa 99.4 1.4E-13 3.7E-18 99.3 4.2 75 18-92 16-119 (132) 60 cd02967 mauD Methylamine utili 99.3 1.8E-12 4.5E-17 93.0 5.8 71 18-88 20-111 (114) 61 COG4232 Thiol:disulfide interc 99.3 5.9E-12 1.5E-16 90.0 6.8 95 10-106 464-567 (569) 62 cd02987 Phd_like_Phd Phosducin 99.2 8.6E-11 2.2E-15 83.3 9.8 102 3-106 64-174 (175) 63 TIGR00385 dsbE periplasmic pro 99.2 1.2E-11 3.1E-16 88.2 5.0 90 11-103 56-169 (175) 64 cd02966 TlpA_like_family TlpA- 99.2 1.8E-11 4.7E-16 87.2 5.2 73 18-90 18-115 (116) 65 KOG0913 consensus 99.2 3.9E-12 9.9E-17 91.0 1.3 99 3-106 26-125 (248) 66 TIGR00411 redox_disulf_1 redox 99.1 9.8E-11 2.5E-15 83.0 6.3 79 24-107 4-82 (82) 67 cd03008 TryX_like_RdCVF Trypar 99.1 2.3E-10 5.9E-15 80.8 5.9 71 18-88 24-128 (146) 68 cd02969 PRX_like1 Peroxiredoxi 99.1 2.8E-10 7.2E-15 80.3 6.4 73 16-88 22-125 (171) 69 KOG0914 consensus 99.1 1.1E-10 2.8E-15 82.6 3.8 83 7-89 131-221 (265) 70 cd02959 ERp19 Endoplasmic reti 98.9 1E-09 2.6E-14 77.1 4.1 79 9-89 10-93 (117) 71 TIGR00424 APS_reduc 5'-adenyly 98.9 6.1E-09 1.5E-13 72.6 7.4 103 3-105 359-467 (469) 72 KOG1672 consensus 98.9 3E-09 7.6E-14 74.4 5.8 88 3-93 68-156 (211) 73 cd02988 Phd_like_VIAF Phosduci 98.9 9.9E-09 2.5E-13 71.4 8.4 100 2-105 83-190 (192) 74 pfam00578 AhpC-TSA AhpC/TSA fa 98.9 4E-09 1E-13 73.7 6.2 69 18-86 24-122 (124) 75 cd03065 PDI_b_Calsequestrin_N 98.9 1.7E-08 4.4E-13 70.1 9.1 101 3-106 11-118 (120) 76 COG0526 TrxA Thiol-disulfide i 98.9 1.2E-08 2.9E-13 71.0 8.2 85 19-104 32-121 (127) 77 COG2143 Thioredoxin-related pr 98.8 1.7E-08 4.2E-13 70.1 7.8 91 13-104 36-146 (182) 78 pfam08534 Redoxin Redoxin. Thi 98.8 1.8E-08 4.6E-13 69.9 7.1 77 18-95 26-132 (142) 79 KOG0911 consensus 98.8 2.5E-09 6.5E-14 74.8 2.6 94 1-99 1-95 (227) 80 cd02958 UAS UAS family; UAS is 98.8 5.1E-08 1.3E-12 67.3 8.9 90 15-105 13-109 (114) 81 KOG2501 consensus 98.6 2.6E-08 6.5E-13 69.1 4.0 71 18-88 32-131 (157) 82 PRK13703 conjugal pilus assemb 98.6 1.5E-07 3.9E-12 64.6 7.6 86 18-104 141-237 (247) 83 cd03023 DsbA_Com1_like DsbA fa 98.6 2.3E-07 5.7E-12 63.6 7.4 80 18-104 4-154 (154) 84 cd03019 DsbA_DsbA DsbA family, 98.6 2.3E-07 5.9E-12 63.5 7.5 85 17-105 13-171 (178) 85 cd03017 PRX_BCP Peroxiredoxin 98.5 4.7E-07 1.2E-11 61.8 7.5 85 18-103 22-139 (140) 86 pfam02114 Phosducin Phosducin. 98.5 1.4E-06 3.6E-11 59.0 9.8 102 3-106 127-237 (265) 87 cd02955 SSP411 TRX domain, SSP 98.4 9E-07 2.3E-11 60.1 7.3 80 7-87 4-95 (124) 88 TIGR02740 TraF-like TraF-like 98.4 2.1E-06 5.5E-11 58.0 8.7 87 18-104 193-295 (306) 89 cd03018 PRX_AhpE_like Peroxire 98.4 1.7E-06 4.2E-11 58.6 7.6 87 18-104 27-148 (149) 90 PRK10877 thiol:disulfide inter 98.3 1.8E-06 4.5E-11 58.4 7.1 84 18-106 106-230 (232) 91 cd02954 DIM1 Dim1 family; Dim1 98.3 2.7E-06 6.9E-11 57.4 7.9 91 14-104 9-108 (114) 92 pfam06110 DUF953 Eukaryotic pr 98.3 2.5E-06 6.3E-11 57.6 6.2 93 8-103 5-116 (119) 93 cd03020 DsbA_DsbC_DsbG DsbA fa 98.2 2.8E-06 7.2E-11 57.3 5.7 81 18-103 76-197 (197) 94 KOG2603 consensus 98.2 3.8E-06 9.7E-11 56.5 6.3 104 2-106 41-165 (331) 95 pfam03190 DUF255 Protein of un 98.2 6.6E-06 1.7E-10 55.1 7.1 80 7-87 26-117 (163) 96 cd02975 PfPDO_like_N Pyrococcu 98.2 8.5E-06 2.2E-10 54.5 7.6 86 19-105 20-108 (113) 97 TIGR02187 GlrX_arch Glutaredox 98.2 1.6E-05 4.1E-10 52.9 9.0 76 30-105 39-122 (237) 98 PRK09437 bcp thioredoxin-depen 98.2 1.6E-05 4.2E-10 52.9 8.6 88 18-106 29-155 (156) 99 cd02971 PRX_family Peroxiredox 98.1 9.2E-06 2.4E-10 54.3 6.9 74 18-91 21-128 (140) 100 TIGR02187 GlrX_arch Glutaredox 98.1 2E-05 5.1E-10 52.4 7.9 98 6-105 133-236 (237) 101 TIGR02738 TrbB type-F conjugat 98.1 4.3E-06 1.1E-10 56.2 4.2 88 18-105 70-174 (176) 102 TIGR02196 GlrX_YruB Glutaredox 98.1 9.2E-06 2.4E-10 54.3 5.9 67 25-104 4-79 (79) 103 cd01659 TRX_superfamily Thiore 98.1 5.3E-06 1.4E-10 55.7 4.4 60 23-83 1-63 (69) 104 cd02973 TRX_GRX_like Thioredox 98.0 1.1E-05 2.7E-10 53.9 4.9 60 24-86 4-63 (67) 105 PRK10954 periplasmic protein d 98.0 1.7E-05 4.4E-10 52.7 6.0 40 18-57 36-78 (207) 106 pfam11009 DUF2847 Protein of u 98.0 6.6E-05 1.7E-09 49.4 8.6 93 7-99 5-103 (104) 107 cd03007 PDI_a_ERp29_N PDIa fam 98.0 3E-05 7.7E-10 51.4 6.8 101 3-106 3-115 (116) 108 KOG3425 consensus 98.0 1.7E-05 4.3E-10 52.8 5.5 75 8-82 12-104 (128) 109 cd02965 HyaE HyaE family; HyaE 97.9 3.9E-05 1E-09 50.7 7.0 89 6-99 15-108 (111) 110 cd02952 TRP14_like Human TRX-r 97.9 2E-05 5E-10 52.5 5.3 91 9-102 10-116 (119) 111 pfam07912 ERp29_N ERp29, N-ter 97.9 7.6E-05 1.9E-09 49.0 8.0 101 3-106 6-118 (126) 112 cd02982 PDI_b'_family Protein 97.9 7.7E-05 2E-09 49.0 7.9 97 9-106 3-102 (103) 113 cd02960 AGR Anterior Gradient 97.9 1.3E-05 3.4E-10 53.4 4.0 69 15-85 19-92 (130) 114 KOG3414 consensus 97.9 0.00012 3E-09 48.0 8.6 96 9-104 12-117 (142) 115 cd03026 AhpF_NTD_C TRX-GRX-lik 97.9 9.8E-05 2.5E-09 48.4 7.9 81 15-101 7-88 (89) 116 cd02986 DLP Dim1 family, Dim1- 97.8 0.00011 2.8E-09 48.1 7.9 96 9-104 3-108 (114) 117 pfam02966 DIM1 Mitosis protein 97.8 1E-04 2.5E-09 48.4 7.4 93 12-104 12-114 (133) 118 cd02983 P5_C P5 family, C-term 97.7 0.00018 4.7E-09 46.8 7.6 103 3-106 4-114 (130) 119 PRK11200 grxA glutaredoxin 1; 97.7 0.00015 3.8E-09 47.3 7.0 75 23-107 3-83 (87) 120 cd02976 NrdH NrdH-redoxin (Nrd 97.7 0.00015 3.8E-09 47.4 6.5 68 23-103 2-73 (73) 121 cd02981 PDI_b_family Protein D 97.7 0.00035 8.9E-09 45.2 8.3 96 4-106 2-97 (97) 122 PRK11657 dsbG disulfide isomer 97.7 0.00019 4.9E-09 46.7 6.9 81 21-103 121-250 (253) 123 smart00594 UAS UAS domain. 97.6 0.0004 1E-08 44.9 8.4 97 8-104 13-122 (122) 124 PRK13728 conjugal transfer pro 97.6 0.00019 4.9E-09 46.7 6.3 87 19-105 69-169 (181) 125 TIGR03140 AhpF alkyl hydropero 97.6 0.00061 1.6E-08 43.8 8.7 94 5-105 103-197 (515) 126 cd03069 PDI_b_ERp57 PDIb famil 97.6 0.0007 1.8E-08 43.5 8.8 97 2-107 1-104 (104) 127 KOG3171 consensus 97.4 0.0005 1.3E-08 44.3 5.8 101 3-105 140-249 (273) 128 TIGR03143 AhpF_homolog putativ 97.3 0.0018 4.5E-08 41.2 8.1 92 5-103 462-554 (555) 129 TIGR02661 MauD methylamine deh 97.3 0.00065 1.7E-08 43.7 5.8 85 17-105 72-177 (189) 130 KOG3170 consensus 97.3 0.00063 1.6E-08 43.8 5.6 99 2-104 92-198 (240) 131 cd03015 PRX_Typ2cys Peroxiredo 97.2 0.0038 9.7E-08 39.3 8.7 88 18-105 28-155 (173) 132 TIGR02200 GlrX_actino Glutared 97.1 0.00026 6.7E-09 46.0 1.7 68 25-104 4-77 (78) 133 PRK11509 hydrogenase-1 operon 97.0 0.0057 1.5E-07 38.2 8.5 97 6-104 22-121 (132) 134 cd03418 GRX_GRXb_1_3_like Glut 97.0 0.0017 4.2E-08 41.3 5.6 56 23-86 2-62 (75) 135 cd03419 GRX_GRXh_1_2_like Glut 97.0 0.002 5.1E-08 40.9 5.8 59 21-86 1-64 (82) 136 cd02970 PRX_like2 Peroxiredoxi 96.9 0.00052 1.3E-08 44.2 2.4 44 17-60 21-66 (149) 137 COG1331 Highly conserved prote 96.8 0.0041 1.1E-07 39.1 6.0 80 7-87 32-123 (667) 138 COG0695 GrxC Glutaredoxin and 96.7 0.0056 1.4E-07 38.3 6.5 67 23-101 3-75 (80) 139 cd02066 GRX_family Glutaredoxi 96.7 0.004 1E-07 39.1 5.7 55 23-85 2-60 (72) 140 PRK10638 glutaredoxin 3; Provi 96.7 0.0029 7.4E-08 39.9 5.0 57 23-87 4-64 (83) 141 pfam05768 DUF836 Glutaredoxin- 96.7 0.0066 1.7E-07 37.9 6.6 74 23-104 2-76 (76) 142 TIGR02180 GRX_euk Glutaredoxin 96.7 0.0035 8.9E-08 39.5 5.1 70 23-99 1-75 (85) 143 COG1651 DsbG Protein-disulfide 96.6 0.0086 2.2E-07 37.2 6.6 39 62-106 204-242 (244) 144 pfam00462 Glutaredoxin Glutare 96.5 0.004 1E-07 39.1 4.2 55 23-85 1-59 (60) 145 TIGR01295 PedC_BrcD bacterioci 96.4 0.025 6.4E-07 34.5 8.0 89 15-103 19-120 (122) 146 PHA02278 thioredoxin-like prot 96.4 0.0054 1.4E-07 38.4 4.3 84 16-101 14-102 (106) 147 KOG2640 consensus 96.3 0.0016 4.1E-08 41.4 1.6 87 17-105 74-160 (319) 148 KOG1752 consensus 96.3 0.027 6.9E-07 34.3 7.8 66 13-86 8-78 (104) 149 cd02972 DsbA_family DsbA famil 96.3 0.0062 1.6E-07 38.0 4.2 58 23-80 1-90 (98) 150 cd03027 GRX_DEP Glutaredoxin ( 96.2 0.01 2.6E-07 36.8 5.2 56 23-86 3-62 (73) 151 cd02991 UAS_ETEA UAS family, E 96.2 0.05 1.3E-06 32.8 8.8 89 16-105 14-111 (116) 152 TIGR02739 TraF type-F conjugat 96.2 0.026 6.5E-07 34.5 7.0 84 21-105 162-260 (270) 153 cd03029 GRX_hybridPRX5 Glutare 96.1 0.012 3E-07 36.5 5.0 56 23-86 3-61 (72) 154 pfam07449 HyaE Hydrogenase-1 e 96.0 0.03 7.7E-07 34.1 6.7 88 6-95 14-103 (107) 155 pfam01216 Calsequestrin Calseq 96.0 0.041 1E-06 33.3 7.2 101 3-105 228-343 (350) 156 cd03028 GRX_PICOT_like Glutare 95.9 0.03 7.6E-07 34.1 6.3 63 15-86 4-74 (90) 157 TIGR00412 redox_disulf_2 redox 95.2 0.086 2.2E-06 31.5 6.7 76 22-105 2-78 (78) 158 cd03067 PDI_b_PDIR_N PDIb fami 95.1 0.096 2.4E-06 31.2 6.7 96 7-105 8-110 (112) 159 PRK10824 hypothetical protein; 95.0 0.07 1.8E-06 32.0 5.6 65 15-87 11-82 (115) 160 PRK10329 glutaredoxin-like pro 94.5 0.062 1.6E-06 32.3 4.3 66 23-101 3-71 (81) 161 PTZ00062 glutaredoxin; Provisi 94.4 0.21 5.5E-06 29.2 6.8 36 29-70 140-175 (219) 162 TIGR02183 GRXA Glutaredoxin, G 93.8 0.065 1.7E-06 32.2 3.2 60 23-85 2-67 (86) 163 PTZ00056 glutathione peroxidas 93.2 0.46 1.2E-05 27.3 6.8 89 18-107 38-178 (180) 164 COG3019 Predicted metal-bindin 93.2 0.46 1.2E-05 27.2 6.8 75 20-106 25-103 (149) 165 cd02974 AhpF_NTD_N Alkyl hydro 93.2 0.78 2E-05 26.0 7.9 76 19-106 18-93 (94) 166 TIGR02181 GRX_bact glutaredoxi 92.7 0.14 3.5E-06 30.3 3.5 65 23-99 1-72 (82) 167 COG1225 Bcp Peroxiredoxin [Pos 92.5 0.82 2.1E-05 25.8 7.4 87 18-105 29-154 (157) 168 cd03024 DsbA_FrnE DsbA family, 92.1 0.22 5.5E-06 29.2 3.9 38 62-104 164-201 (201) 169 COG3634 AhpF Alkyl hydroperoxi 91.8 0.6 1.5E-05 26.6 5.9 82 18-105 115-196 (520) 170 pfam07689 KaiB KaiB domain. Th 91.6 0.21 5.4E-06 29.2 3.4 76 26-103 3-79 (82) 171 PRK09301 circadian clock prote 91.1 0.55 1.4E-05 26.8 5.2 80 20-101 6-87 (103) 172 COG2761 FrnE Predicted dithiol 90.8 0.43 1.1E-05 27.4 4.4 38 64-106 175-212 (225) 173 cd02978 KaiB_like KaiB-like fa 90.5 0.27 7E-06 28.6 3.1 60 22-81 3-63 (72) 174 PTZ00256 glutathione peroxidas 90.5 1.2 3.1E-05 24.8 6.5 89 18-107 39-181 (183) 175 cd02968 SCO SCO (an acronym fo 90.4 0.48 1.2E-05 27.1 4.4 42 18-59 21-69 (142) 176 cd03068 PDI_b_ERp72 PDIb famil 90.3 1.7 4.3E-05 24.0 8.4 95 5-106 4-107 (107) 177 cd03025 DsbA_FrnE_like DsbA fa 90.1 0.24 6E-06 28.9 2.5 34 62-96 158-191 (193) 178 KOG2507 consensus 89.4 1.9 4.8E-05 23.7 6.7 87 18-105 17-109 (506) 179 pfam01323 DSBA DSBA-like thior 89.2 0.56 1.4E-05 26.8 3.9 35 63-103 156-190 (191) 180 pfam09673 TrbC_Ftype Type-F co 89.0 2.1 5.4E-05 23.5 8.1 87 7-101 9-110 (113) 181 COG3531 Predicted protein-disu 88.3 0.9 2.3E-05 25.6 4.5 44 63-107 164-209 (212) 182 cd03014 PRX_Atyp2cys Peroxired 87.6 0.91 2.3E-05 25.6 4.1 71 18-89 25-126 (143) 183 pfam00837 T4_deiodinase Iodoth 86.7 0.61 1.6E-05 26.6 2.8 100 2-106 83-236 (237) 184 TIGR02742 TrbC_Ftype type-F co 86.4 0.41 1.1E-05 27.5 1.8 74 7-84 10-86 (139) 185 cd00340 GSH_Peroxidase Glutath 85.5 0.96 2.5E-05 25.4 3.4 43 18-61 21-64 (152) 186 TIGR02194 GlrX_NrdH Glutaredox 85.4 1.3 3.3E-05 24.7 3.9 64 25-100 3-69 (72) 187 TIGR01355 cyt_deam_dimer cytid 85.3 0.34 8.8E-06 28.0 1.0 20 24-44 103-122 (311) 188 TIGR02190 GlrX-dom Glutaredoxi 85.2 1.2 2.9E-05 25.0 3.6 60 20-87 7-69 (79) 189 cd03041 GST_N_2GST_N GST_N fam 84.8 3.4 8.7E-05 22.3 5.9 73 25-106 4-76 (77) 190 TIGR00612 ispG_gcpE 4-hydroxy- 83.8 1.3 3.2E-05 24.8 3.3 74 30-103 533-632 (633) 191 pfam08806 Sep15_SelM Sep15/Sel 82.6 1.3 3.4E-05 24.6 3.0 68 31-107 7-75 (77) 192 cd03073 PDI_b'_ERp72_ERp57 PDI 79.6 5.8 0.00015 20.9 6.2 95 7-105 5-109 (111) 193 COG4545 Glutaredoxin-related p 79.3 3.2 8.3E-05 22.4 4.1 59 19-86 2-76 (85) 194 PRK13730 conjugal transfer pil 77.9 3.8 9.6E-05 22.0 4.1 43 59-103 145-187 (209) 195 cd03072 PDI_b'_ERp44 PDIb' fam 71.8 9.4 0.00024 19.7 7.2 99 5-105 3-106 (111) 196 pfam06053 DUF929 Domain of unk 70.2 9.3 0.00024 19.7 4.5 61 15-82 54-114 (249) 197 cd03061 GST_N_CLIC GST_N famil 69.8 10 0.00027 19.4 6.0 66 29-107 20-86 (91) 198 pfam04134 DUF393 Protein of un 68.1 10 0.00026 19.5 4.4 58 26-85 2-61 (113) 199 COG0278 Glutaredoxin-related p 66.3 8 0.0002 20.1 3.5 64 19-87 14-83 (105) 200 cd03066 PDI_b_Calsequestrin_mi 66.2 10 0.00027 19.5 4.1 77 20-106 20-100 (102) 201 cd03022 DsbA_HCCA_Iso DsbA fam 65.4 7.4 0.00019 20.3 3.2 36 62-103 156-191 (192) 202 PRK09027 cytidine deaminase; P 63.9 4.1 0.0001 21.8 1.7 23 20-43 118-141 (295) 203 pfam02630 SCO1-SenC SCO1/SenC. 63.4 7.4 0.00019 20.3 2.9 61 8-69 27-94 (159) 204 pfam00255 GSHPx Glutathione pe 60.9 16 0.0004 18.4 4.4 79 18-103 20-107 (108) 205 TIGR00365 TIGR00365 glutaredox 57.6 13 0.00034 18.8 3.4 69 11-86 5-81 (103) 206 PTZ00137 2-Cys peroxiredoxin; 56.1 19 0.00049 18.0 8.1 88 18-105 32-158 (194) 207 pfam04551 GcpE GcpE protein. I 54.0 21 0.00053 17.8 3.9 76 30-106 258-344 (345) 208 PRK13189 peroxiredoxin; Provis 53.5 21 0.00054 17.7 7.8 88 18-105 27-154 (215) 209 TIGR03137 AhpC peroxiredoxin. 53.0 21 0.00055 17.7 8.2 87 19-105 31-154 (187) 210 PRK00522 tpx thiol peroxidase; 50.1 24 0.00061 17.4 7.7 86 18-104 44-167 (168) 211 PRK10382 alkyl hydroperoxide r 49.8 24 0.00062 17.4 9.4 88 18-105 30-154 (187) 212 KOG2792 consensus 49.4 25 0.00063 17.3 5.9 88 19-107 139-275 (280) 213 TIGR01186 proV glycine betaine 48.8 11 0.00027 19.4 1.8 45 35-87 167-211 (372) 214 pfam06953 ArsD Arsenical resis 48.7 25 0.00064 17.3 6.5 68 30-104 17-99 (119) 215 cd03016 PRX_1cys Peroxiredoxin 47.3 26 0.00068 17.1 8.0 88 18-105 24-152 (203) 216 pfam06491 DUF1094 Protein of u 46.2 28 0.0007 17.0 4.0 53 52-105 34-92 (96) 217 PTZ00253 tryparedoxin peroxida 44.4 29 0.00075 16.9 8.0 88 18-105 35-162 (199) 218 PRK13599 putative peroxiredoxi 43.5 30 0.00078 16.8 8.0 88 18-105 27-154 (215) 219 PRK09303 adaptive-response sen 42.4 32 0.00081 16.7 3.7 80 19-103 13-96 (378) 220 KOG2244 consensus 42.1 26 0.00066 17.2 2.9 72 8-80 102-184 (786) 221 KOG1364 consensus 42.1 18 0.00045 18.1 2.0 53 52-105 133-187 (356) 222 cd03033 ArsC_15kD Arsenate Red 41.8 23 0.00058 17.5 2.5 27 23-49 2-28 (113) 223 PRK00366 ispG 4-hydroxy-3-meth 40.0 35 0.00088 16.5 5.0 54 49-103 295-352 (367) 224 COG0821 gcpE 1-hydroxy-2-methy 37.9 31 0.00079 16.7 2.7 76 30-106 263-350 (361) 225 pfam11539 DUF3228 Protein of u 37.7 20 0.0005 17.9 1.7 32 3-34 22-56 (196) 226 COG4752 Uncharacterized protei 37.1 37 0.00095 16.3 3.0 31 8-38 122-152 (190) 227 PRK13191 putative peroxiredoxi 37.1 39 0.00098 16.2 7.9 88 18-105 33-160 (230) 228 PRK13190 putative peroxiredoxi 36.8 39 0.00099 16.2 7.8 88 18-105 26-152 (202) 229 PRK12759 bifunctional gluaredo 36.7 39 0.001 16.1 5.3 55 26-88 7-73 (410) 230 pfam11287 DUF3088 Protein of u 35.8 41 0.001 16.1 3.2 74 30-105 22-104 (111) 231 cd03036 ArsC_like Arsenate Red 35.6 22 0.00056 17.6 1.7 76 25-106 3-87 (111) 232 KOG0868 consensus 35.5 30 0.00077 16.8 2.3 67 18-87 3-69 (217) 233 COG1393 ArsC Arsenate reductas 35.4 17 0.00042 18.3 1.0 26 23-48 3-28 (117) 234 TIGR02654 circ_KaiB circadian 33.9 35 0.00089 16.4 2.5 62 21-82 4-66 (87) 235 PRK01655 spxA transcriptional 33.8 20 0.00051 17.8 1.2 22 24-45 3-24 (131) 236 cd02977 ArsC_family Arsenate R 33.7 13 0.00033 18.9 0.2 79 24-106 2-86 (105) 237 KOG1422 consensus 33.2 45 0.0011 15.8 4.8 67 29-107 19-85 (221) 238 cd03034 ArsC_ArsC Arsenate Red 32.9 20 0.00052 17.8 1.1 25 24-48 2-26 (112) 239 cd03040 GST_N_mPGES2 GST_N fam 32.7 46 0.0012 15.8 6.0 72 26-107 5-76 (77) 240 COG0386 BtuE Glutathione perox 32.0 47 0.0012 15.7 6.2 88 18-107 24-160 (162) 241 PRK10606 btuE putative glutath 31.1 49 0.0012 15.6 4.0 42 18-60 24-66 (183) 242 TIGR01689 EcbF-BcbF capsule bi 31.0 20 0.00052 17.8 0.9 20 56-75 60-79 (126) 243 TIGR02959 SigZ RNA polymerase 29.4 24 0.00061 17.4 1.0 36 37-72 94-129 (170) 244 cd03021 DsbA_GSTK DsbA family, 28.2 55 0.0014 15.3 3.4 38 64-103 170-208 (209) 245 cd03055 GST_N_Omega GST_N fami 28.2 55 0.0014 15.3 5.5 61 22-87 18-79 (89) 246 PRK13344 spxA transcriptional 27.8 55 0.0014 15.3 2.6 22 24-45 3-24 (132) 247 PRK10026 arsenate reductase; P 27.5 30 0.00077 16.8 1.3 80 23-106 4-88 (141) 248 cd00570 GST_N_family Glutathio 27.0 57 0.0015 15.2 5.4 57 25-87 3-61 (71) 249 pfam09822 ABC_transp_aux ABC-t 26.7 58 0.0015 15.2 10.4 100 5-105 11-137 (266) 250 COG3411 Ferredoxin [Energy pro 26.5 59 0.0015 15.1 3.4 29 74-107 17-45 (64) 251 cd03074 PDI_b'_Calsequestrin_C 26.4 59 0.0015 15.1 8.1 103 5-107 5-120 (120) 252 cd03035 ArsC_Yffb Arsenate Red 25.3 47 0.0012 15.7 1.9 76 24-106 2-84 (105) 253 KOG0833 consensus 25.2 31 0.00078 16.8 0.9 18 26-44 101-118 (173) 254 TIGR02743 TraW type-F conjugat 24.8 30 0.00076 16.8 0.8 28 59-86 184-212 (217) 255 pfam07511 DUF1525 Protein of u 24.7 64 0.0016 14.9 4.5 34 66-104 76-109 (114) 256 cd05750 Ig_Pro_neuregulin Immu 24.5 51 0.0013 15.5 2.0 14 74-87 13-26 (75) 257 cd04971 Ig_TrKABC_d5 Fifth dom 24.4 42 0.0011 16.0 1.5 22 66-87 2-25 (81) 258 PRK13738 conjugal transfer pil 24.2 39 0.00099 16.2 1.3 29 59-87 170-199 (210) 259 pfam00352 TBP Transcription fa 23.6 67 0.0017 14.8 4.1 57 40-105 20-77 (86) 260 PRK00394 transcription factor; 23.0 69 0.0017 14.7 4.1 27 76-105 143-169 (178) 261 cd05864 Ig2_VEGFR-2 Second imm 21.9 57 0.0014 15.2 1.8 20 70-89 6-27 (70) 262 cd03049 GST_N_3 GST_N family, 21.9 72 0.0018 14.6 4.5 59 25-86 3-62 (73) 263 pfam07315 DUF1462 Protein of u 21.8 73 0.0019 14.6 3.9 71 29-104 7-93 (93) 264 cd01283 cytidine_deaminase Cyt 21.4 39 0.00098 16.2 0.8 16 27-43 77-92 (112) 265 TIGR02652 TIGR02652 conserved 21.3 30 0.00077 16.8 0.3 14 29-42 11-24 (172) 266 cd04518 TBP_archaea archaeal T 21.2 75 0.0019 14.5 4.1 27 76-105 140-166 (174) 267 KOG4014 consensus 21.2 39 0.001 16.2 0.8 43 31-73 34-78 (248) 268 COG3011 Predicted thiol-disulf 20.4 78 0.002 14.4 5.1 66 19-86 6-73 (137) No 1 >TIGR01068 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxins , , , are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms. Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of 2 cysteine thiol groups to a disulphide, accompanied by the transfer of 2 electrons and 2 protons. The net result is the covalent interconversion of a disulphide and a dithiol.TR-S_2 + NADPH + H^+ -> TR-(SH)_2 + NADP^+ (1) trx-S_2 + TR-(SH)_2 -> trx-(SH)_2 + TR-S_2 (2) Protein-S_2 + trx-(SH)_2 -> Protein-(SH)_2 + trx-S_2 (3) In the NADPH-dependent protein disulphide reduction, thioredoxin reductase (TR) catalyses reduction of oxidised thioredoxin (trx) by NADPH using FAD and its redox-active disulphide (steps 1 and 2). Reduced thioredoxin then directly reduces the disulphide in the substrate protein (step 3) . Protein disulphide isomerase (PDI), a resident foldase of the endoplasmic recticulum, is a multi-functional protein that catalyses the formation and isomerisation of disulphide bonds during protein folding , . PDI contains 2 redox active domains, near the N- and C-termini, that are similar to thioredoxin: both contribute to disulphide isomerase activity, but are functionally non-equivalent . Interestingly, a mutant PDI, with all 4 of the active cysteines replaced by serine, displays a low but detectable level of disulphide isomerase activity . Moreover, PDI exhibits chaperone-like activity towards proteins that contain no disulphide bonds, i.e. behaving independently of its disulphide isomerase activity . A number of endoplasmic reticulum proteins that differ from the PDI major isozyme contain 2 (ERp60, ERp5) or 3 (ERp72 ) thioredoxin domains; all of them seem to be PDIs. 3D-structures have been determined for a number of thioredoxins . The molecule has a doubly-wound alternating alpha/beta fold, consisting of a 5-stranded parallel beta-sheet core, enclosed by 4 alpha-helices. The active site disulphide is located at the N-terminus of helix 2 in a short segment that is separated from the rest of the helix by a kink caused by a conserved proline. The 4-membered disulphide ring is located on the surface of the protein. A flat hydrophobic surface lies adjacent to the disulphide, which presumably facilitates interaction with other proteins. One invariant feature of all thioredoxins is a cis-proline located in a loop preceding beta-strand 4. This residue is positioned in van der Waals contact with the active site cysteines and is important both for stability and function . Thioredoxin belongs to a structural family that includes glutaredoxin, glutathione peroxidase, bacterial protein disulphide isomerase DsbA, and the N-terminal domain of glutathione transferase . Thioredoxins have a beta-alpha unit preceding the motif common to all these proteins.; GO: 0009055 electron carrier activity, 0015035 protein disulfide oxidoreductase activity, 0006662 glycerol ether metabolic process, 0045454 cell redox homeostasis. Probab=100.00 E-value=4.8e-36 Score=228.74 Aligned_cols=101 Identities=42% Similarity=0.887 Sum_probs=97.6 Q ss_pred ECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEE Q ss_conf 57677999998489949999876997022213466665421000123332267232657777623156887999979989 Q gi|254780822|r 6 VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKV 85 (107) Q Consensus 6 i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~ 85 (107) +|+++|++.+.+++++|||+|||+||||||+++|++++++.+|.+++.|+|+|+|+|+++|.+|||+++||+++||+|++ T Consensus 1 ~~~~~F~~~~~~~d~~VlVDFWA~WCGPCKm~aP~lee~a~e~~~~v~~~KlnvD~~~~~A~~ygi~SIPTl~lFK~G~~ 80 (101) T TIGR01068 1 LTDANFDETIASSDKPVLVDFWAPWCGPCKMIAPILEELAKEYEGKVKFVKLNVDENPDIAAKYGIRSIPTLLLFKNGKV 80 (101) T ss_pred CCHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHCCCCCCCEEEEECCCEE T ss_conf 97556788987189737887435999873442468888875416974688853478834144528540563777519825 Q ss_pred EEEEECCCCCHHHHHHHHHHCC Q ss_conf 8588748999899999998419 Q gi|254780822|r 86 IDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 86 ~~~~~~g~~~~~~l~~~i~~~l 107 (107) +.|.+ |.+++++|.++|++++ T Consensus 81 V~~~v-Ga~pK~~l~~~~~~~~ 101 (101) T TIGR01068 81 VDRSV-GALPKAALKQLINKNL 101 (101) T ss_pred EEEEE-CCCCHHHHHHHHHHHC T ss_conf 20061-3569799999998719 No 2 >TIGR01126 pdi_dom protein disulfide-isomerase domain; InterPro: IPR005788 This is a domain of eukaryotic protein disulphide isomerases, generally found in two copies. The domain is similar to thioredoxin but the redox-active disulphide region motif is APWCGHCK. ; GO: 0016853 isomerase activity. Probab=99.98 E-value=2.5e-33 Score=213.07 Aligned_cols=102 Identities=28% Similarity=0.622 Sum_probs=97.1 Q ss_pred ECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCC-HHHHHHHCCCCCCEEEEEE Q ss_conf 576779999984899499998769970222134666654210001---233322672326-5777762315688799997 Q gi|254780822|r 6 VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLDIEES-SEISTRYQISSIPTLILFK 81 (107) Q Consensus 6 i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~---~i~~~~vd~d~~-~~l~~~~~v~~~Pt~~~~~ 81 (107) ||++||++.|+++++.|||.||||||||||.++|+|+++|++|.+ .|.+++||+|.+ ++++++|+|+|+|||.+|+ T Consensus 1 L~~~NFd~~v~~~~~~vLVeFYAPWCGHCK~LAP~YEk~A~~l~~~~~~i~~AKvDAt~~G~~l~~~y~V~GfPTikff~ 80 (107) T TIGR01126 1 LTASNFDEIVLDSNKDVLVEFYAPWCGHCKNLAPEYEKLAKELKKQKSKIVLAKVDATAEGKDLASRYGVSGFPTIKFFP 80 (107) T ss_pred CCHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCEECCCCCCCEEEEC T ss_conf 97221123321799807998618876766886743789888874278995478753684352010100220255057862 Q ss_pred CCEEE-EEEECCCCCHHHHHHHHHHCC Q ss_conf 99898-588748999899999998419 Q gi|254780822|r 82 DGKVI-DRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 82 ~g~~~-~~~~~g~~~~~~l~~~i~~~l 107 (107) +|+.. +..|.|.|+.+.|.+||+++. T Consensus 81 ~G~~~NP~~Y~G~R~~~~~~~F~~e~~ 107 (107) T TIGR01126 81 KGSKENPVDYEGGRDLEAIVEFVNEKS 107 (107) T ss_pred CCCCCCCCCCCCCCCHHHHHHHHHHCC T ss_conf 878148921589868788999986049 No 3 >TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms. Some members have been assigned alternative or additional functions such as prolyl 4-hydroxylase and dolichyl-diphosphooligosaccharide-protein glycotransferase. Members of this family have at least two protein-disulphide domains, each similar to thioredoxin but with the redox-active disulphide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs). ; GO: 0016853 isomerase activity, 0005783 endoplasmic reticulum. Probab=99.97 E-value=1.4e-32 Score=208.81 Aligned_cols=105 Identities=28% Similarity=0.613 Sum_probs=96.0 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCHHHHHHHCCCCCCEEE Q ss_conf 5177576779999984899499998769970222134666654210001---2333226723265777762315688799 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLDIEESSEISTRYQISSIPTLI 78 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~---~i~~~~vd~d~~~~l~~~~~v~~~Pt~~ 78 (107) .++.|+++||.. .+++++.+||.||||||||||.++|.+++.|..+.. .|.+++|||+++.+||++|||+|||||. T Consensus 2 ~V~~L~~~nF~d-~i~~~~~vLVeFYAPWCGHCK~LAPEY~~AA~~L~~~~p~i~LAKVDaT~e~~La~kygV~GYPTLK 80 (522) T TIGR01130 2 DVLVLTKDNFDD-FIKSNEFVLVEFYAPWCGHCKSLAPEYEKAATELKKKGPPIKLAKVDATEEKDLAQKYGVSGYPTLK 80 (522) T ss_pred CCEEEECCCHHH-HHHCCCEEEEEECCCCCCHHCCCCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHCCCCCCCCCC T ss_conf 601572466687-7641985899952883441105343689999999855898048884076103225025766454301 Q ss_pred EEECCEE-EEEEECCCCCHHHHHHHHHHCC Q ss_conf 9979989-8588748999899999998419 Q gi|254780822|r 79 LFKDGKV-IDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 79 ~~~~g~~-~~~~~~g~~~~~~l~~~i~~~l 107 (107) +|++|+. ...-|.|+|+.++|++||.++. T Consensus 81 iFr~G~~~~~~~Y~GPR~a~gIv~ym~kq~ 110 (522) T TIGR01130 81 IFRNGKKDSPSDYNGPRDADGIVKYMKKQS 110 (522) T ss_pred EEECCCCCCCCCCCCCCCHHHHHHHHHHHC T ss_conf 586587678668888988799999998513 No 4 >PRK09381 trxA thioredoxin; Provisional Probab=99.97 E-value=2.2e-31 Score=201.93 Aligned_cols=106 Identities=40% Similarity=0.832 Sum_probs=102.0 Q ss_pred CC--EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE Q ss_conf 95--1775767799999848994999987699702221346666542100012333226723265777762315688799 Q gi|254780822|r 1 MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLI 78 (107) Q Consensus 1 M~--~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~ 78 (107) |+ +|+||++||++.+++++++++|+|||+||+||+++.|.+++++++|++++.|+++|+|++++++++|+|+++||++ T Consensus 1 ms~~vi~lt~~nF~~~v~~s~~~vlV~F~A~wC~pCk~l~P~l~~l~~e~~~~v~~~~vdvd~~~~la~~~~V~~vPT~~ 80 (109) T PRK09381 1 MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL 80 (109) T ss_pred CCCCEEECCHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCCCCCCEEE T ss_conf 99853783777777998638983999998899975885118999864423787589996320187778752757688499 Q ss_pred EEECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 99799898588748999899999998419 Q gi|254780822|r 79 LFKDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 79 ~~~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) +|++|+.+.+. .|.+++++|++||++|| T Consensus 81 ~fk~G~~v~~~-~G~~~~~~l~~~i~~~L 108 (109) T PRK09381 81 LFKNGEVAATK-VGALSKGQLKEFLDANL 108 (109) T ss_pred EEECCEEEEEE-ECCCCHHHHHHHHHHHH T ss_conf 99999897887-27999999999999860 No 5 >PRK10996 thioredoxin 2; Provisional Probab=99.97 E-value=2.5e-30 Score=195.85 Aligned_cols=103 Identities=37% Similarity=0.810 Sum_probs=98.0 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 17757677999998489949999876997022213466665421000123332267232657777623156887999979 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) .+++|+++|++. ++++.|++|+|||+||+||++|+|.|++++++|.+++.|++||+|++++++++|+|+++||+++|++ T Consensus 37 p~~~~~~~f~~~-i~s~~PVlVdFwA~WCgPCk~m~P~~e~lA~~~~~kv~f~kVd~d~~~~la~~~~I~siPTlilfk~ 115 (139) T PRK10996 37 VINATGETLDKL-LKDDLPVVIDFWAPWCGPCRNFAPIFEDVAAERSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKN 115 (139) T ss_pred CEECCHHHHHHH-HCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHCCCCCCCEEEEEEC T ss_conf 887767899998-5689988999989988706742899999988628947999995257778888707671885999989 Q ss_pred CEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 9898588748999899999998419 Q gi|254780822|r 83 GKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 83 g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) |+++.+. .|.+++++|.+|++++| T Consensus 116 G~~v~r~-~Ga~p~~~l~~wl~q~L 139 (139) T PRK10996 116 GQVVDML-NGAVPKAPFDSWLNEAL 139 (139) T ss_pred CEEEEEE-ECCCCHHHHHHHHHHHC T ss_conf 9897777-68999999999999649 No 6 >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. Some members of this subfamily are P5-like proteins containing only one redox active TRX domain. Probab=99.96 E-value=8.8e-29 Score=186.90 Aligned_cols=102 Identities=25% Similarity=0.531 Sum_probs=97.9 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 17757677999998489949999876997022213466665421000123332267232657777623156887999979 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) +++||++||++.+++++++++|+||||||+||++|+|.|+++++++++.+.++++|++++++++++|+|+++||+++|++ T Consensus 2 Vv~l~~~nF~~~v~~~~~~vlV~Fya~wC~~C~~~~P~~~~~a~~~~~~~~~a~vd~~~~~~l~~~~~I~~~PTi~~f~~ 81 (103) T cd03001 2 VVELTDSNFDKKVLNSDDVWLVEFYAPWCGHCKNLAPEWKKAAKALKGIVKVGAVDADVHQSLAQQYGVRGFPTIKVFGA 81 (103) T ss_pred EEEECHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEEEECCHHHHHHHHCCCCEECEEEEEEC T ss_conf 16926562899985499849999978988773544848999999806862899998824431144269737498999969 Q ss_pred CEEEEEEECCCCCHHHHHHHHH Q ss_conf 9898588748999899999998 Q gi|254780822|r 83 GKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 83 g~~~~~~~~g~~~~~~l~~~i~ 104 (107) |+..+..|.|.|+.++|.+|.. T Consensus 82 G~~~~~~Y~G~R~~e~l~~F~~ 103 (103) T cd03001 82 GKNSPQDYQGGRTAKAIVSAAL 103 (103) T ss_pred CCCCEEEECCCCCHHHHHHHHC T ss_conf 9556157678899999999669 No 7 >PTZ00102 disulphide isomerase; Provisional Probab=99.95 E-value=2.6e-28 Score=184.20 Aligned_cols=101 Identities=26% Similarity=0.601 Sum_probs=92.7 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 177576779999984899499998769970222134666654210001---23332267232657777623156887999 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~---~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) ++.||++||++. +++++.+||.|||||||||++++|.|+++|+.+++ .+.+++|||++++++|++|+|+|+||+.+ T Consensus 35 Vl~Lt~~nF~~~-i~~~~~vLV~FYAPWCGHCK~LaPey~~AA~~Lk~~~~~V~lakVDct~~~~L~~~~~I~gYPTLkl 113 (479) T PTZ00102 35 VTVLTDGTFDKF-ITKNDLVLVKFYAPWCGHCKRLAPEYNKAAKMLSEEKSEVKLASVDATEENALAQEYGVTGYPTLKF 113 (479) T ss_pred CEEECHHHHHHH-HHHCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCCCCCCEEEE T ss_conf 189164408999-9639828999989865877746599999999988428953899974765687898639887875799 Q ss_pred EECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 979989858874899989999999841 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) |++|+++ .|.|.++.+.|.+||.++ T Consensus 114 F~~G~~~--~Y~G~R~a~~Iv~~m~~~ 138 (479) T PTZ00102 114 FNKGNEV--NYSGGRTADGIVSWLKQL 138 (479) T ss_pred EECCCCC--CCCCCCCHHHHHHHHHHH T ss_conf 7089641--799978999999999974 No 8 >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain, similar to that of PDIa, with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. The CXFS motif in the N-terminal domain allows ERp44 to form stable reversible mixed disulfides with its substrates. Through this activity, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. It also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol. Probab=99.95 E-value=2.6e-28 Score=184.18 Aligned_cols=101 Identities=32% Similarity=0.647 Sum_probs=93.6 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC------CCCCCCCCCCCCCHHHHHHHCCCCCC Q ss_conf 517757677999998489949999876997022213466665421000------12333226723265777762315688 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA------DKVKITKLDIEESSEISTRYQISSIP 75 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~------~~i~~~~vd~d~~~~l~~~~~v~~~P 75 (107) .+++||++||++ +++++++++|.||||||+||++++|.|+++++.+. +++.+++|||++++++|.+|+|+++| T Consensus 2 ~Vv~L~~~nf~~-~l~~~~~~lV~FyA~WC~~Ck~~~P~~~~~a~~~~~~~~~~~~v~~~~vd~~~~~~l~~~~~I~~yP 80 (108) T cd02996 2 EIVSLTSGNIDD-ILQSAELVLVNFYADWCRFSQMLHPIFEEAAAKIKEEFPDAGKVVWGKVDCDKESDIADRYRINKYP 80 (108) T ss_pred CEEECCHHHHHH-HHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHCCCCCCC T ss_conf 807957876999-9966994999999999988998645999999998864577871899992276376679972987577 Q ss_pred EEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 7999979989858874899989999999 Q gi|254780822|r 76 TLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 76 t~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) |+++|++|+.+.+.|.|.++.+.|.+|| T Consensus 81 Ti~lf~~G~~~~~~Y~G~Rs~e~l~~Fi 108 (108) T cd02996 81 TLKLFRNGMMMKREYRGQRSVEALAEFV 108 (108) T ss_pred EEEEEECCCCCCEEECCCCCHHHHHHHC T ss_conf 7999969949613117989999999659 No 9 >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus. Probab=99.95 E-value=2e-28 Score=184.91 Aligned_cols=102 Identities=28% Similarity=0.547 Sum_probs=95.0 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 51775767799999848994999987699702221346666542100012333226723265777762315688799997 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) ++++||++||++.+++++++++|.||||||+||++|+|.|+++++++.+.+.+++|||++++++|++|+|+++||+++|+ T Consensus 2 ~Vv~Lt~~nF~~~v~~~~~~~lV~FyapwC~~Ck~~~P~~~~~a~~~~~~v~~~~vd~~~~~~~~~~~~V~~~PTi~lf~ 81 (104) T cd03004 2 SVITLTPEDFPELVLNRKEPWLVDFYAPWCGPCQALLPELRKAARALKGKVKVGSVDCQKYESLCQQANIRAYPTIRLYP 81 (104) T ss_pred CEEEECHHHHHHHHHCCCCEEEEEEECCCCHHHHHCCHHHHHHHHHHCCCEEEEEEECCCCHHHHHCCCCEECCEEEEEC T ss_conf 55992545148998479980999998999844665475799999996796289998884697477367818837899991 Q ss_pred CCEEEEEEECC-CCCHHHHHHHH Q ss_conf 99898588748-99989999999 Q gi|254780822|r 82 DGKVIDRMMPG-ASSQSDIIEWI 103 (107) Q Consensus 82 ~g~~~~~~~~g-~~~~~~l~~~i 103 (107) +|......|.| .|+.+.|.+|| T Consensus 82 ~~~~~~~~y~G~~R~~e~l~~fi 104 (104) T cd03004 82 GNASKYHSYNGWHRDADSILEFI 104 (104) T ss_pred CCCCCEEECCCCCCCHHHHHHHC T ss_conf 98988545789998999999659 No 10 >TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms. Some members have been assigned alternative or additional functions such as prolyl 4-hydroxylase and dolichyl-diphosphooligosaccharide-protein glycotransferase. Members of this family have at least two protein-disulphide domains, each similar to thioredoxin but with the redox-active disulphide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs). ; GO: 0016853 isomerase activity, 0005783 endoplasmic reticulum. Probab=99.95 E-value=5.1e-29 Score=188.25 Aligned_cols=103 Identities=30% Similarity=0.613 Sum_probs=93.3 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--C--CCCCCCCCCCCHHHHHHHCCCCCCEEE Q ss_conf 177576779999984899499998769970222134666654210001--2--333226723265777762315688799 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--K--VKITKLDIEESSEISTRYQISSIPTLI 78 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~--i~~~~vd~d~~~~l~~~~~v~~~Pt~~ 78 (107) +.-|=.+||+++|++.+|.|||.||||||||||+++|.|++||++|++ . |.++++|.+.| ++..++.|+|+|||+ T Consensus 368 Vkv~VgkNF~eiV~D~~KDVL~EFYAPWCGHCK~L~P~Y~eLA~~y~~~~~~~VVIAKmDAT~N-Dvp~~~~V~GFPTi~ 446 (522) T TIGR01130 368 VKVVVGKNFDEIVLDETKDVLVEFYAPWCGHCKKLAPIYEELAEKYKDSAEDDVVIAKMDATAN-DVPPEFEVEGFPTIK 446 (522) T ss_pred CEEEECCCEEEEEECCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCC-CCCCCCEEEECCCEE T ss_conf 3899815412345779998899996686761002130889999998754798708996477758-888873054235067 Q ss_pred EEECCEE-EEEEECCCCCHHHHHHHHHHC Q ss_conf 9979989-858874899989999999841 Q gi|254780822|r 79 LFKDGKV-IDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 79 ~~~~g~~-~~~~~~g~~~~~~l~~~i~~~ 106 (107) |+..|.. -+-.|.|.|+.+.|.+||.+| T Consensus 447 f~PaG~k~~pv~Y~G~R~le~l~kFi~~~ 475 (522) T TIGR01130 447 FVPAGKKSEPVKYEGDRTLEDLIKFIAKH 475 (522) T ss_pred EECCCCCCCEEECCCCCCHHHHHHHHHHC T ss_conf 74168897504526897589999999743 No 11 >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains. The TRX domain functions as a protein disulfide reductase via the reversible oxidation of an active center dithiol present in a CXXC motif, while the NTR domain functions as a reductant to oxidized TRX. The fusion protein is bifunctional, showing both TRX and NTR activities, but it is not an independent NTR/TRX system. In plants, the protein is found exclusively in shoots and mature leaves and is localized in the chloroplast. It is involved in plant protection against oxidative stress. Probab=99.95 E-value=9.3e-28 Score=181.01 Aligned_cols=95 Identities=27% Similarity=0.516 Sum_probs=90.9 Q ss_pred HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEE Q ss_conf 77999998489949999876997022213466665421000123332267232657777623156887999979989858 Q gi|254780822|r 9 KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDR 88 (107) Q Consensus 9 ~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~ 88 (107) -.|++++.++++|++|+||||||+||+.+.|.+++++++|.+++.|++||+|++++++++|+|+++||+++|++|+.+.+ T Consensus 3 ~~~~~l~~~s~k~VlV~F~A~wCgpCk~l~P~l~~la~ey~~~v~f~kvDvd~~~~la~~~~I~~~PT~~~fk~g~~v~~ 82 (97) T cd02949 3 YALRKLYHESDRLILVLYTSPTCGPCRTLKPILNKVIDEFDGAVHFVEIDIDEDQEIAEAAGIMGTPTVQFFKDKELVKE 82 (97) T ss_pred HHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCCCCCCEEEEEECCEEEEE T ss_conf 14899998579949999989998565642699999999837971999996887988999819931778999999999688 Q ss_pred EECCCCCHHHHHHHHH Q ss_conf 8748999899999998 Q gi|254780822|r 89 MMPGASSQSDIIEWIL 104 (107) Q Consensus 89 ~~~g~~~~~~l~~~i~ 104 (107) . .|.++++++.+||+ T Consensus 83 ~-~G~~~~~~l~~~ie 97 (97) T cd02949 83 I-SGVKMKSEYREFIE 97 (97) T ss_pred E-ECCCCHHHHHHHHC T ss_conf 8-88888999999759 No 12 >pfam00085 Thioredoxin Thioredoxin. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. Some members with only the active site are not separated from the noise. Probab=99.95 E-value=1.5e-27 Score=179.79 Aligned_cols=103 Identities=34% Similarity=0.751 Sum_probs=98.5 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 17757677999998489949999876997022213466665421000123332267232657777623156887999979 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) +-+||++||++.|++++++++|+||||||+||+++.|.|+++++++.+++.++++|+|++++++++|+|+++||+++|++ T Consensus 2 v~~l~~~~F~~~v~~~~k~vlv~F~a~wC~~C~~~~~~~~~~a~~~~~~~~~~~vd~d~~~~~~~~~~i~~~Pti~~~~~ 81 (104) T pfam00085 2 VKVLTDENFDEEVAKSDKPVLVDFYAPWCGPCKALAPEYEKLAQEYKDDVKFAKVDADENPDLASEYGVRGFPTIKFFKN 81 (104) T ss_pred EEECCHHHHHHHHHHCCCCEEEEEECCCCHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEEC T ss_conf 79856676899986089949999989998504510704444222221101220014654853532479625090899989 Q ss_pred CEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 989858874899989999999841 Q gi|254780822|r 83 GKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 83 g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) |+++.+ +.|.++.++|.+||++| T Consensus 82 G~~v~~-~~G~~~~e~l~~~i~~~ 104 (104) T pfam00085 82 GKKVSD-YVGARTKDDLVAFIKKH 104 (104) T ss_pred CEEEEE-EECCCCHHHHHHHHHHC T ss_conf 959888-87899999999999739 No 13 >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein. MPD1 has been shown to suppress the maturation defect of carboxypeptidase Y caused by deletion of the yeast PDI1 gene. Other characterized members of this subfamily include the Aspergillus niger prpA protein and Giardia PDI-1. PrpA is non-essential to strain viability, however, its transcript level is induced by heterologous protein expression suggesting a possible role in oxidative protein folding during high protein production. Giardia PDI-1 has the ability to refold scrambled RNase and exhibits transglutaminase activity. Probab=99.95 E-value=1.7e-27 Score=179.43 Aligned_cols=103 Identities=27% Similarity=0.566 Sum_probs=94.9 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC--CHHHHHHHCCCCCCEEEE Q ss_conf 517757677999998489949999876997022213466665421000123332267232--657777623156887999 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE--SSEISTRYQISSIPTLIL 79 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~--~~~l~~~~~v~~~Pt~~~ 79 (107) |+++||++||++.|.+++++++|+||||||+||++|+|.|+++++++.+.+.++.+|||+ ++++|++|+|+++||+++ T Consensus 1 pV~el~~~nFd~~V~~~~~~~lV~FyApWC~~Ck~~~P~~~~~a~~~~~~~~~~~vd~d~~~~~~i~~~~~I~~~PTi~~ 80 (109) T cd03002 1 PVYELTPKNFDKVVHNTNYTTLVEFYAPWCGHCKNLKPEYAKAAKELDGLVQVAAVDCDEDKNKPLCGKYGVQGFPTLKV 80 (109) T ss_pred CEEEECHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHCCCCCCCEEEE T ss_conf 96997626089998559983999998886811677679999999980887228999656342465798769844887999 Q ss_pred EECCEEEE----EEECCCCCHHHHHHHHH Q ss_conf 97998985----88748999899999998 Q gi|254780822|r 80 FKDGKVID----RMMPGASSQSDIIEWIL 104 (107) Q Consensus 80 ~~~g~~~~----~~~~g~~~~~~l~~~i~ 104 (107) |++|+... ..|.|.|+.+.|.+||. T Consensus 81 f~~G~~~~k~~~~~y~G~Rt~~~i~~Fil 109 (109) T cd03002 81 FRPPKKASKHAVEDYNGERSAKAIVDFVL 109 (109) T ss_pred EECCCCCCCCCCCCCCCCCCHHHHHHHHC T ss_conf 95964047778625578889999999659 No 14 >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain. DnaJ is a member of the 40 kDa heat-shock protein (Hsp40) family of molecular chaperones, which regulate the activity of Hsp70s. TRX is involved in the redox regulation of many protein substrates through the reduction of disulfide bonds. TRX has been implicated to catalyse the reduction of Hsp33, a chaperone holdase that binds to unfolded protein intermediates. The presence of DnaJ and TRX domains in members of this family suggests that they could be involved in a redox-regulated chaperone network. Probab=99.94 E-value=5.8e-27 Score=176.42 Aligned_cols=102 Identities=14% Similarity=0.454 Sum_probs=95.3 Q ss_pred EEEECHHHHHHHHHH--CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 177576779999984--899499998769970222134666654210001-23332267232657777623156887999 Q gi|254780822|r 3 ALKVDTKSFDSEVLE--CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~~~~f~~~v~~--~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) ...||.++|+..+++ +.+|++|+|||+||+||+++.|.|++++.++.+ .+.+++||+|++++++.+|||+++||+++ T Consensus 6 k~~It~~~f~~~Vl~~S~~kPvlV~F~A~WC~pC~~l~P~~~~~a~ele~~~v~~~~Vn~d~~~~la~~~gV~siPtl~~ 85 (111) T cd02963 6 KYSLTFSQYENEIVPKSFKKPYLIKITSDWCFSCIHIEPVWKEVIQELEPLGVGIATVNAGHERRLARKLGAHSVPAIVG 85 (111) T ss_pred EEEEEHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCCCCCCEEEE T ss_conf 89855999889998604897399999997478788650799999998345755999994886989999819986898999 Q ss_pred EECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 97998985887489998999999984 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) |++|+.+.+. .|.+++++|++|+++ T Consensus 86 ~~~G~~v~~~-~G~~s~~~i~~Fi~k 110 (111) T cd02963 86 IINGQVTFYH-DSSFTKQHVVDFVRK 110 (111) T ss_pred EECCEEEEEE-CCCCCHHHHHHHHHH T ss_conf 9999998866-376798999999973 No 15 >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains. Yeast complementation studies show that ERp46 can substitute for protein disulfide isomerase (PDI) function in vivo. It has been detected in many tissues, however, transcript and protein levels do not correlate in all tissues, suggesting regulation at a posttranscriptional level. An identical protein, named endoPDI, has been identified as an endothelial PDI that is highly expressed in the endothelium of tumors and hypoxic lesions. It has a protective effect on cells exposed to hypoxia. Probab=99.94 E-value=4.7e-27 Score=176.97 Aligned_cols=98 Identities=31% Similarity=0.702 Sum_probs=90.4 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC---CCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 17757677999998489949999876997022213466665421000---123332267232657777623156887999 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA---DKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~---~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) +++||++||++.+ ++++++|.||||||+||++|.|.|+++++++. +.+.+++||++++++++.+|+|+++||+++ T Consensus 2 vv~Lt~~nF~~~v--~~~~~lV~FyapWC~~C~~~~P~~~~la~~~~~~~~~v~i~~vd~~~~~~l~~~~~I~~~PTl~~ 79 (102) T cd03005 2 VLELTEDNFDHHI--AEGNHFVKFFAPWCGHCKRLAPTWEQLAKKFNNENPSVKIAKVDCTQHRELCSEFQVRGYPTLLL 79 (102) T ss_pred EEEECHHHHHHHH--HCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHCCCCCCCCEEEE T ss_conf 6992788899998--08999999989999778714336999999988418988999960545625553112566887999 Q ss_pred EECCEEEEEEECCCCCHHHHHHHH Q ss_conf 979989858874899989999999 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) |++|+.+.+ |.|.++.++|.+|| T Consensus 80 f~~G~~~~~-y~G~r~~~~l~~fi 102 (102) T cd03005 80 FKDGEKVDK-YKGTRDLDSLKEFV 102 (102) T ss_pred EECCEEEEE-EECCCCHHHHHHHC T ss_conf 989949688-86799989999659 No 16 >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Probab=99.94 E-value=3e-27 Score=178.04 Aligned_cols=99 Identities=20% Similarity=0.458 Sum_probs=92.2 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 51775767799999848994999987699702221346666542100012333226723265777762315688799997 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) .+++||++||++.+ ++++.++|+||||||+||++++|.|+++++++.+.+.+++|||++++++|++|+|+++||+++|+ T Consensus 2 ~Vv~L~~~nF~~~v-~~~~~~~V~FyApWC~hCk~l~P~~~~~a~~~~~~v~ia~vdc~~~~~lc~~~~V~~yPTl~~f~ 80 (101) T cd03003 2 EIVTLDRGDFDAAV-NSGEIWFVNFYSPRCSHCHDLAPTWREFAKEMDGVIRIGAVNCGDDRMLCRSQGVNSYPSLYVFP 80 (101) T ss_pred CEEECCHHHHHHHH-HCCCEEEEEEECCCCHHHHHHCHHHHHHHHHHCCCEEEEEEECCCCHHHHCCCEEEECCEEEEEC T ss_conf 74991788789998-36982999996885888886468999999983696699998525693340134567624899980 Q ss_pred CCEEEEEEECCCCCHHHHHHH Q ss_conf 998985887489998999999 Q gi|254780822|r 82 DGKVIDRMMPGASSQSDIIEW 102 (107) Q Consensus 82 ~g~~~~~~~~g~~~~~~l~~~ 102 (107) +|+... .|.|.++.+.|.+| T Consensus 81 ~G~~~~-~Y~G~Rt~~~l~~F 100 (101) T cd03003 81 SGMNPE-KYYGDRSKESLVKF 100 (101) T ss_pred CCCEEE-EEECCCCHHHHHHH T ss_conf 997014-55088999999955 No 17 >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Probab=99.94 E-value=6.7e-27 Score=176.09 Aligned_cols=104 Identities=33% Similarity=0.742 Sum_probs=98.1 Q ss_pred EEEECHHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEE Q ss_conf 1775767799999848--99499998769970222134666654210001233322672326577776231568879999 Q gi|254780822|r 3 ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~--~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~ 80 (107) ++++|+.||++.|+.+ .+||+|+||||||++|+.+.|.+++++.+|+|++++++||||++++++.+|||+++||++.| T Consensus 25 I~dvT~anfe~~V~~~S~~~PVlV~fWap~~~~c~qL~p~Lekla~~~~G~f~LakvN~D~~p~vAaqfgiqsIPtV~af 104 (304) T COG3118 25 IKDVTEANFEQEVIQSSREVPVLVDFWAPWCGPCKQLTPTLEKLAAEYKGKFKLAKVNCDAEPMVAAQFGVQSIPTVYAF 104 (304) T ss_pred CEECHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHCCCCCCEEEEE T ss_conf 32232666899999974678769985188770689998999999998589259998468736508988286767757885 Q ss_pred ECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 799898588748999899999998419 Q gi|254780822|r 81 KDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 81 ~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) ++|+++.. +.|..+++++++|+.+++ T Consensus 105 ~dGqpVdg-F~G~qPesqlr~~ld~~~ 130 (304) T COG3118 105 KDGQPVDG-FQGAQPESQLRQFLDKVL 130 (304) T ss_pred ECCCCCCC-CCCCCCHHHHHHHHHHHC T ss_conf 37867101-378895899999999835 No 18 >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX. TMX is a type I integral membrane protein; the N-terminal redox active TRX domain is present in the endoplasmic reticulum (ER) lumen while the C-terminus is oriented towards the cytoplasm. It is expressed in many cell types and its active site motif (CPAC) is unique. In vitro, TMX reduces interchain disulfides of insulin and renatures inactive RNase containing incorrect disulfide bonds. The C. elegans homolog, DPY-11, is expressed only in the hypodermis and resides in the cytoplasm. It is required for body and sensory organ morphogeneis. Another uncharacterized TRX-related transmembrane protein, human TMX4, is included in the alignment. The active site sequence of TMX4 is CPSC. Probab=99.94 E-value=8.5e-27 Score=175.47 Aligned_cols=99 Identities=27% Similarity=0.616 Sum_probs=89.8 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCCCEEEEE Q ss_conf 5177576779999984899499998769970222134666654210001-233322672326577776231568879999 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISSIPTLILF 80 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~ 80 (107) .+++||++||++ +++ +.+||.||||||+||++++|.|+++++++.+ ++.+++||+++++.++++|+|+++||+++| T Consensus 2 ~Vv~Lt~~nf~~-~~~--g~~lV~FyApWC~~Ck~l~P~~e~la~~~~~~~v~i~~vD~~~~~~l~~~~~I~~~PTi~~~ 78 (101) T cd02994 2 NVVELTDSNWTL-VLE--GEWMIEFYAPWCPACQQLQPEWEEFADWSDDLGINVAKVDVTQEPGLSGRFFVTALPTIYHA 78 (101) T ss_pred CEEEECHHHHHH-HHC--CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHCCEEEEEEEEEE T ss_conf 749956551898-838--98899998998735777748999999864678779999017559657854780784189998 Q ss_pred ECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 7998985887489998999999984 Q gi|254780822|r 81 KDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 81 ~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) ++|+. +.|.|.++.++|.+||++ T Consensus 79 ~~G~~--~~y~G~rt~~~l~~fi~e 101 (101) T cd02994 79 KDGVF--RRYQGPRDKEDLISFIEE 101 (101) T ss_pred ECCCE--EEEECCCCHHHHHHHHHC T ss_conf 19938--661479999999999709 No 19 >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5. The cDNA clone of this protein (named G1) was isolated from an alfalfa cDNA library by screening with human protein disulfide isomerase (PDI) cDNA. The G1 protein is constitutively expressed in all major organs of the plant and its expression is induced by treatment with tunicamycin, indicating that it may be a glucose-regulated protein. The G1 homolog in the eukaryotic social amoeba Dictyostelium discoideum is also described as a P5-like protein, which is located in the endoplasmic reticulum (ER) despite the absence of an ER-retrieval signal. G1 homologs from Aspergillus niger and Neurospora crassa have also been characterized, and are named TIGA and ER Probab=99.94 E-value=1.2e-26 Score=174.66 Aligned_cols=101 Identities=28% Similarity=0.616 Sum_probs=93.2 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCC-CHHHHHHHCCCCCCEEEE Q ss_conf 177576779999984899499998769970222134666654210001--23332267232-657777623156887999 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--KVKITKLDIEE-SSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~i~~~~vd~d~-~~~l~~~~~v~~~Pt~~~ 79 (107) +++||++||++.+.++++++||+||||||+||++|.|.|+++++.+++ .+.+++||||+ +++++++|+|+++||+++ T Consensus 2 V~~l~~~nF~~~v~~~~~~vlV~Fya~wC~~Ck~~~p~~~~la~~~~~~~~v~i~~vd~d~~~~~l~~~~~I~~~Pti~~ 81 (105) T cd02998 2 VVELTDSNFDKVVGDDKKDVLVEFYAPWCGHCKNLAPEYEKLAAVFANEDDVVIAKVDADEANKDLAKKYGVSGFPTLKF 81 (105) T ss_pred EEEECHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHCCCCCCCEEEE T ss_conf 59947677899986089819999958988887554508999999985687613761366743334553157777888999 Q ss_pred EECCEEEEEEECCCCCHHHHHHHH Q ss_conf 979989858874899989999999 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) |++|+..+..|.|.++.++|.+|| T Consensus 82 f~~~~~~~~~y~G~r~~~~l~~Fi 105 (105) T cd02998 82 FPKGSTEPVKYEGGRDLEDLVKFV 105 (105) T ss_pred EECCCCCEEEECCCCCHHHHHHHC T ss_conf 989973278964889999999659 No 20 >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria. Probab=99.94 E-value=1.4e-26 Score=174.27 Aligned_cols=95 Identities=26% Similarity=0.602 Sum_probs=89.0 Q ss_pred HHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEE Q ss_conf 7799999848-994999987699702221346666542100012333226723265777762315688799997998985 Q gi|254780822|r 9 KSFDSEVLEC-SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVID 87 (107) Q Consensus 9 ~~f~~~v~~~-~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~ 87 (107) +||++.+..+ .+||+|+||||||+||++|.|.+++++++|++++.|++||+|++++++++|+|+++||+++|++|+++. T Consensus 1 enF~~~v~~s~~~PVlv~F~A~wC~~C~~~~p~l~~~a~~~~~~~~~~~vd~d~~~~la~~~~V~~~Pt~~~f~~G~~v~ 80 (96) T cd02956 1 QNFQQVLQESTQVPVVVDFWAPRSPPSKELLPLLERLAEEYQGQFVLAKVNCDAQPQIAQQFGVQALPTVYLFAAGQPVD 80 (96) T ss_pred CCHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCHHHHHHCCCCCCCEEEEEECCEEEE T ss_conf 98689999759980999998899976899899999999855652999998033465468767876168388899999945 Q ss_pred EEECCCCCHHHHHHHHH Q ss_conf 88748999899999998 Q gi|254780822|r 88 RMMPGASSQSDIIEWIL 104 (107) Q Consensus 88 ~~~~g~~~~~~l~~~i~ 104 (107) +. .|.+++++|++||+ T Consensus 81 ~~-~G~~~~~~l~~~le 96 (96) T cd02956 81 GF-QGAQPEEQLRQMLD 96 (96) T ss_pred EE-ECCCCHHHHHHHHC T ss_conf 77-18999999999769 No 21 >KOG0910 consensus Probab=99.94 E-value=1.5e-26 Score=174.13 Aligned_cols=102 Identities=36% Similarity=0.750 Sum_probs=96.6 Q ss_pred EECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCE Q ss_conf 75767799999848994999987699702221346666542100012333226723265777762315688799997998 Q gi|254780822|r 5 KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGK 84 (107) Q Consensus 5 ~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~ 84 (107) .++.++|++.|++++.||+|+|||+||+||+.+.|.+++++.+|.|+++|++||.|++.+++.+|+|.++||+++|++|+ T Consensus 47 ~~s~~~~~~~Vi~S~~PVlVdF~A~WCgPCk~l~P~l~~~~~~~~g~~k~~kvdtD~~~ela~~Y~I~avPtvlvfknGe 126 (150) T KOG0910 47 VQSDSEFDDKVINSDVPVLVDFHAEWCGPCKMLGPILEELVSEYAGKFKLYKVDTDEHPELAEDYEISAVPTVLVFKNGE 126 (150) T ss_pred CCCHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCHHHHCCEEEEEEEEEEECCE T ss_conf 56788999998746998899986575743767469999987753371789997265660137646316502899987998 Q ss_pred EEEEEECCCCCHHHHHHHHHHCC Q ss_conf 98588748999899999998419 Q gi|254780822|r 85 VIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 85 ~~~~~~~g~~~~~~l~~~i~~~l 107 (107) ++.+. .|..+.+.+.++|++-| T Consensus 127 ~~d~~-vG~~~~~~l~~~i~k~l 148 (150) T KOG0910 127 KVDRF-VGAVPKEQLRSLIKKFL 148 (150) T ss_pred EEEEE-CCCCCHHHHHHHHHHHH T ss_conf 86622-04579899999999975 No 22 >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity. Probab=99.94 E-value=1.7e-26 Score=173.74 Aligned_cols=99 Identities=28% Similarity=0.616 Sum_probs=90.2 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--CCCCCCCCC--CCCHHHHHHHCCCCCCEEE Q ss_conf 177576779999984899499998769970222134666654210001--233322672--3265777762315688799 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--KVKITKLDI--EESSEISTRYQISSIPTLI 78 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~i~~~~vd~--d~~~~l~~~~~v~~~Pt~~ 78 (107) +++||++||++. ++++++++|+|||||||||+++.|.|++++..+++ ++.++++|| ++++.++++|+|+++||++ T Consensus 2 Vv~l~~~nF~~~-i~~~~~vlV~FyA~WC~~Ck~~~P~~~~~a~~~~~~~~~~~~~vd~~~~~~~~l~~~~~V~~~PTi~ 80 (104) T cd02997 2 VVHLTDEDFRKF-LKKEKHVLVMFYAPWCGHCKKMKPEFTKAATELKEDGKGVLAAVDCTKPEHDALKEEYNVKGFPTFK 80 (104) T ss_pred EEECCHHHHHHH-HHCCCCEEEEEECCCCHHHCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHCCCCCCCEEE T ss_conf 469788879999-8469989999988998111156764999999975558879999975630078788654645587899 Q ss_pred EEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 9979989858874899989999999 Q gi|254780822|r 79 LFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 79 ~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) +|++|+.+.+ |.|.++.+.|.+|| T Consensus 81 ~f~~G~~~~~-y~G~r~~e~l~~Fi 104 (104) T cd02997 81 YFENGKFVEK-YEGERTAEDIIEFM 104 (104) T ss_pred EEECCEEEEE-EECCCCHHHHHHHC T ss_conf 9989949677-77788989999659 No 23 >PTZ00102 disulphide isomerase; Provisional Probab=99.94 E-value=8.1e-27 Score=175.59 Aligned_cols=105 Identities=22% Similarity=0.507 Sum_probs=97.4 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 5177576779999984899499998769970222134666654210001--23332267232657777623156887999 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--KVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) ++..|..+||++.|+++++.|||.|||||||||+.++|.|+++++.+++ ++.++++|++.|...+..++|+|+||+++ T Consensus 360 ~Vk~lVg~nf~~~v~~~~kdvlv~fyAPWCghCk~l~P~~~~la~~~~~~~~v~iak~D~t~n~~~~~~~~v~gyPti~~ 439 (479) T PTZ00102 360 PVKVVVGNTFEDVVFKSGKDVLLEIYAPWCGHCKNLEPVYTDLGEKLKDNDSVIVAKMNGDANESPIEDFEWSAFPTILF 439 (479) T ss_pred CEEEEECCCHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCEEEE T ss_conf 74998245558774158988899998987756776448999999984579975999987887767522377687887999 Q ss_pred EECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 979989858874899989999999841 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) |++|+..+..|.|.|+.+.|.+||++| T Consensus 440 ~~~g~k~~i~y~g~r~~~~~~~Fv~~~ 466 (479) T PTZ00102 440 VKAGSRIPLPYEGERTLEGFVEFVNKH 466 (479) T ss_pred EECCCCCCCCCCCCCCHHHHHHHHHHC T ss_conf 768999702138988889999999975 No 24 >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1. PDI, ERp72 and ERp57 are endoplasmic reticulum (ER)-resident eukaryotic proteins involved in oxidative protein folding. They are oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. PDI and ERp57 have the abb'a' domain structure (where a and a' are redox active TRX domains while b and b' are redox inactive TRX-like domains). PDI also contains an acidic region (c domain) after the a' domain that is absent in ERp57. ERp72 has an additional a domain at the N-terminus (a"abb'a' domain structure). ERp57 interacts with the lectin chaperones, calnexin and calreticu Probab=99.93 E-value=7e-26 Score=170.22 Aligned_cols=101 Identities=30% Similarity=0.649 Sum_probs=92.7 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 5177576779999984899499998769970222134666654210001--23332267232657777623156887999 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--KVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) |+++||++||++.|+++++++||.||||||+||++++|.|+++++.+++ ++.++++|++++ +++.+|+|+++||+++ T Consensus 1 pV~~lt~~nF~~~V~~~~k~vlV~Fya~wC~~C~~~~p~~~~la~~~~~~~~v~~~~vD~~~n-~l~~~~~i~~~Pti~l 79 (104) T cd02995 1 PVKVVVGKNFDEVVLDSDKDVLVEFYAPWCGHCKALAPIYEELAEKLKGDDNVVIAKMDATAN-DVPSEFVVDGFPTILF 79 (104) T ss_pred CEEEECCCCHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCC-CCHHHCCCCCCCEEEE T ss_conf 959935769889983799859999979977564212744999999952799718999717877-4564548540778999 Q ss_pred EECCEEE-EEEECCCCCHHHHHHHH Q ss_conf 9799898-58874899989999999 Q gi|254780822|r 80 FKDGKVI-DRMMPGASSQSDIIEWI 103 (107) Q Consensus 80 ~~~g~~~-~~~~~g~~~~~~l~~~i 103 (107) |++|+.. +..|.|.++.+.|.+|| T Consensus 80 f~~g~~~~~~~y~G~r~~~~l~~Fi 104 (104) T cd02995 80 FPAGDKSNPIKYEGDRTLEDLIKFI 104 (104) T ss_pred EECCCCCCCEECCCCCCHHHHHHHC T ss_conf 9896777756747888999999659 No 25 >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases. APS reductase catalyzes the reduction of activated sulfate to sulfite, a key step in the biosynthesis of sulfur-containing metabolites. Sulfate is first activated by ATP sulfurylase, forming APS, which can be phosphorylated to 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Depending on the organism, either APS or PAPS can be used for sulfate reduction. Prokaryotes and fungi use PAPS, whereas plants use both APS and PAPS. Since plant-type APS reductase uses glutathione (GSH) as its electron donor, the C-terminal domain may function like glutaredoxin, a GSH-dependent member of the TRX superfamily. The flow of reducing equivalents goes from GSH - C-terminal TRX domain - N-terminal reductase domain - APS. Plant-type APS red Probab=99.92 E-value=1.9e-25 Score=167.71 Aligned_cols=102 Identities=17% Similarity=0.415 Sum_probs=86.8 Q ss_pred CEEEECHHHHHHHHHH--CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCC--HHHHHHHCCCCCCE Q ss_conf 5177576779999984--899499998769970222134666654210001-233322672326--57777623156887 Q gi|254780822|r 2 SALKVDTKSFDSEVLE--CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEES--SEISTRYQISSIPT 76 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~--~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~--~~l~~~~~v~~~Pt 76 (107) ++|+||++||++.+.. ++++|||.|||||||||++|+|.|+++++++.+ ++.++++|+|.+ +..+++|+|+|+|| T Consensus 2 ~Vv~L~~~~f~~~v~~~~~~k~~lV~FYAPWCghCk~l~P~~~~lA~~l~~~~v~v~~vd~d~~~~~~~~~~~~V~gyPT 81 (109) T cd02993 2 AVVTLSRAEIEALAKGERRNQSTLVVLYAPWCPFCQAMEASYEELAEKLAGSNVKVAKFNADGEQREFAKEELQLKSFPT 81 (109) T ss_pred CEEECCHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHCCCCCCCCE T ss_conf 64888777399997043569988999999988888867789999999865589789999778776643420269777788 Q ss_pred EEEEECCEEEEEEECC-CCCHHHHHHHH Q ss_conf 9999799898588748-99989999999 Q gi|254780822|r 77 LILFKDGKVIDRMMPG-ASSQSDIIEWI 103 (107) Q Consensus 77 ~~~~~~g~~~~~~~~g-~~~~~~l~~~i 103 (107) +++|.+|...+..|.| .|+.+.|.+|| T Consensus 82 i~~f~~~~~~~~~y~g~~Rt~e~l~~Fi 109 (109) T cd02993 82 ILFFPKNSRQPIKYPSEQRDVDSLLMFV 109 (109) T ss_pred EEEEECCCCCCCCCCCCCCCHHHHHHHC T ss_conf 9998398998026889994989999659 No 26 >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein. QSOX oxidizes thiol groups to disulfides like PDI, however, unlike PDI, this oxidation is accompanied by the reduction of oxygen to hydrogen peroxide. QSOX is localized in high concentrations in cells with heavy secretory load and prefers peptides and proteins as substrates, not monothiols like glutathione. Inside the cell, QSOX is found in the endoplasmic reticulum and Golgi. The flow of reducing equivalents in a QSOX-catalyzed reaction goes from the dithiol substrate - dithiol of the QSOX TRX domain - dithiols of the QSOX ERV1p domain - FAD - oxygen. Probab=99.92 E-value=2.5e-25 Score=167.04 Aligned_cols=103 Identities=23% Similarity=0.482 Sum_probs=89.8 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC---CCCCCCCCCCC--CCHHHHHHHCCCCCCE Q ss_conf 517757677999998489949999876997022213466665421000---12333226723--2657777623156887 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA---DKVKITKLDIE--ESSEISTRYQISSIPT 76 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~---~~i~~~~vd~d--~~~~l~~~~~v~~~Pt 76 (107) ++++||++||++.++++++++||+||||||+||++++|.|+++++.+. +.+.+++|||+ +++++|++|+|+++|| T Consensus 2 ~V~~L~~~nF~~~v~~~~~~~lV~FYApWC~hCk~l~P~~~~~A~~~~~~~~~v~~~~VdC~~~~n~~lc~~~~I~~yPT 81 (114) T cd02992 2 PVIVLDAASFNSALLGSPSAWLVEFYASWCGHCRAFAPTWKKLARDLRKWRPVVRVAAVDCADEENVALCRDFGVTGYPT 81 (114) T ss_pred CCEECCHHHHHHHHHCCCCCEEEEEECCCCHHHHHCCHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHCCCCEEEE T ss_conf 81898534279997459970999998997831543486999999986343885699998536524665786669827017 Q ss_pred EEEEECCEEEEE---EECC-CCCHHHHHHHHH Q ss_conf 999979989858---8748-999899999998 Q gi|254780822|r 77 LILFKDGKVIDR---MMPG-ASSQSDIIEWIL 104 (107) Q Consensus 77 ~~~~~~g~~~~~---~~~g-~~~~~~l~~~i~ 104 (107) +++|++|..... .+.| .++.++|++++. T Consensus 82 l~~f~~g~k~~~~~~~~~g~~r~~~~l~~~~i 113 (114) T cd02992 82 LRYFPPFSKEATDGLKQEGPERDVNELREALI 113 (114) T ss_pred EEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH T ss_conf 99964989789986445389989999998860 No 27 >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus. The TMX3 transcript is found in a variety of tissues with the highest levels detected in skeletal muscle and the heart. In vitro, TMX3 showed oxidase activity albeit slightly lower than that of protein disulfide isomerase. Probab=99.92 E-value=7e-25 Score=164.46 Aligned_cols=99 Identities=29% Similarity=0.571 Sum_probs=86.9 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 177576779999984899499998769970222134666654210001---23332267232657777623156887999 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~---~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) +|++ +++|.+. .+++.++|.|||||||||+++.|.|++++.++.+ .+.+++|||+++++++++|+|+++||+++ T Consensus 2 v~~~-d~~F~~~--~~~~~~lV~FyapWC~~Ck~~~P~w~~~a~~~~~~~~~v~v~~vd~~~~~~~~~~~~I~~~PTi~~ 78 (104) T cd03000 2 VLDL-DDSFKDV--RKEDIWLVDFYAPWCGHCKKLEPVWNEVGAELKSSGSPVRVGKLDATAYSSIASEFGVRGYPTIKL 78 (104) T ss_pred CCCC-CCCHHHH--HCCCEEEEEEECCCCHHHHHCCHHHHHHHHHHHHHCCCEEEECCCCHHCHHHHHHCCCCCCCEEEE T ss_conf 0024-2588788--469929999989989879823189999999987518864562046203566797769844688999 Q ss_pred EECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 979989858874899989999999841 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) |++|+.. .|.|.++.++|.+|+++. T Consensus 79 f~~~~~~--~Y~G~rt~~~l~~Fi~k~ 103 (104) T cd03000 79 LKGDLAY--NYRGPRTKDDIVEFANRV 103 (104) T ss_pred EECCEEE--EECCCCCHHHHHHHHHHH T ss_conf 9799577--503899999999999963 No 28 >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44. CXXS is still a redox active motif; however, the mixed disulfide formed with the substrate is more stable than those formed by CXXC motif proteins. PDI-related proteins are usually involved in the oxidative protein folding in the ER by acting as catalysts and folding assistants. ERp44 is involved in thiol-mediated retention in the ER. Probab=99.92 E-value=6.3e-25 Score=164.71 Aligned_cols=99 Identities=16% Similarity=0.342 Sum_probs=88.0 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 17757677999998489949999876997022213466665421000123332267232657777623156887999979 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) +.++=..+|++.++++++.+||.||||||+||++++|+|+++++.+++...++.+|++.+++++++|+|+|+||+++|++ T Consensus 2 ~~~~v~~~~d~~v~n~~~~vlV~FYApWC~hCk~l~P~~~~la~~~~~~~~~a~~~~~~~~~l~~~ygV~g~PTi~lf~~ 81 (100) T cd02999 2 PEEVLNIALDLMAFNREDYTAVLFYASWCPFSASFRPHFNALSSMFPQIRHLAIEESSIKPSLLSRYGVVGFPTILLFNS 81 (100) T ss_pred EEEHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHCCCCCCCEEEEECC T ss_conf 06548765889966689529999997888888987189999998789984899995457866787467543657999679 Q ss_pred CEEEEEEECCCCCHHHHHHHH Q ss_conf 989858874899989999999 Q gi|254780822|r 83 GKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 83 g~~~~~~~~g~~~~~~l~~~i 103 (107) |+.+ .|.|.|+.+.|.+|. T Consensus 82 g~~~--~Y~G~Rt~~~l~~F~ 100 (100) T cd02999 82 TPRV--RYNGTRTLDSLAAFY 100 (100) T ss_pred CCEE--CCCCCCCHHHHHHHC T ss_conf 9660--478998989998549 No 29 >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus. It is found only in oxygenic photosynthetic organisms. TRX is a small enzyme that participate in redox reactions, via the reversible oxidation of an active site dithiol present in a CXXC motif. Disruption of the txlA gene suggests that the protein is involved in the redox regulation of the structure and function of photosynthetic apparatus. The plant homolog (designated as HCF164) is localized in the chloroplast and is involved in the assembly of the cytochrome b6f complex, which takes a central position in photosynthetic electron transport. Probab=99.91 E-value=3e-24 Score=160.82 Aligned_cols=93 Identities=19% Similarity=0.530 Sum_probs=84.5 Q ss_pred HHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH--HHHHHHCCCCCCEEEEE-ECCEEEEEE Q ss_conf 999848994999987699702221346666542100012333226723265--77776231568879999-799898588 Q gi|254780822|r 13 SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS--EISTRYQISSIPTLILF-KDGKVIDRM 89 (107) Q Consensus 13 ~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~--~l~~~~~v~~~Pt~~~~-~~g~~~~~~ 89 (107) +..+.++||++|+|||+||++|++|+|.+++++++|++++.|+++|+|.++ .++.+|+|+|+||+++| ++|+++... T Consensus 14 eval~ngKPvlVdFyA~WC~~Ck~maP~le~l~~~Y~dkv~fv~vNVDn~~w~~~~~~y~V~giPt~~~fd~~G~~~~~~ 93 (142) T cd02950 14 EVALSNGKPTLVEFYADWCTVCQEMAPDVAKLKQKYGDQVNFVMLNVDNPKWLPEIDRYRVDGIPHFVFLDREGNEEGQS 93 (142) T ss_pred HHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHCCCCCCEEEEECCCCCEEEEE T ss_conf 99971799789999899897788773899999999589214999978887056799981978887699986899691035 Q ss_pred ECCCCCHHHHHHHHHHC Q ss_conf 74899989999999841 Q gi|254780822|r 90 MPGASSQSDIIEWILSR 106 (107) Q Consensus 90 ~~g~~~~~~l~~~i~~~ 106 (107) .|.+++.+|++.+++. T Consensus 94 -iG~~pe~~l~~~l~aL 109 (142) T cd02950 94 -IGLQPKQVLAQNLDAL 109 (142) T ss_pred -CCCCCHHHHHHHHHHH T ss_conf -3769889999999999 No 30 >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT contains an N-terminal TRX-like domain, which does not contain the catalytic CXXC motif, followed by one to three glutaredoxin domains. The TRX-like domain is required for interaction with PKC theta. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Probab=99.91 E-value=7.4e-24 Score=158.56 Aligned_cols=96 Identities=27% Similarity=0.692 Sum_probs=85.8 Q ss_pred CHHHHHHHHHH-CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEE Q ss_conf 76779999984-89949999876997022213466665421000123332267232657777623156887999979989 Q gi|254780822|r 7 DTKSFDSEVLE-CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKV 85 (107) Q Consensus 7 ~~~~f~~~v~~-~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~ 85 (107) |+++|++.+.+ ++++++|+|||+||+||+.+.|.++++++++.+++.|++||+|++++++++|+|+++||+++|++|++ T Consensus 1 S~~~f~~~i~~~~~k~vvv~F~a~wC~pCk~~~p~l~~la~~~~~~v~f~kvd~d~~~~l~~~~~I~~~Pt~~~~k~G~~ 80 (97) T cd02984 1 SEEEFEELLKSDASKLLVLHFWAPWAEPCKQMNQVFEELAKEAFPSVLFLSIEAEELPEISEKFEITAVPTFVFFRNGTI 80 (97) T ss_pred CHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHCCCCCCCEEEEEECCEE T ss_conf 97899999985799869999989989748999799999988828977999973400889998739872147999999999 Q ss_pred EEEEECCCCCHHHHHHHHH Q ss_conf 8588748999899999998 Q gi|254780822|r 86 IDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 86 ~~~~~~g~~~~~~l~~~i~ 104 (107) +.+. .|. ++++|++.|+ T Consensus 81 v~~~-~G~-~~~~l~~~i~ 97 (97) T cd02984 81 VDRV-SGA-DPKELAKKVE 97 (97) T ss_pred EEEE-ECC-CHHHHHHHHC T ss_conf 9999-797-9899998529 No 31 >KOG0190 consensus Probab=99.90 E-value=5.9e-24 Score=159.10 Aligned_cols=102 Identities=28% Similarity=0.672 Sum_probs=94.3 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 177576779999984899499998769970222134666654210001---23332267232657777623156887999 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~---~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) +++||.+||.. .+.++..++|.||||||+||++++|.+++.+..+.. .+.+++|||+++.++|.+|+|+|+||+.+ T Consensus 27 Vl~Lt~dnf~~-~i~~~~~vlVeFYAPWCghck~LaPey~kAA~~Lke~~s~i~LakVDat~~~~~~~~y~v~gyPTlki 105 (493) T KOG0190 27 VLVLTKDNFKE-TINGHEFVLVEFYAPWCGHCKALAPEYEKAATELKEEGSPVKLAKVDATEESDLASKYEVRGYPTLKI 105 (493) T ss_pred EEEECCCCHHH-HHCCCCEEEEEEECHHHHHHHHHCCHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCCCCCEEEE T ss_conf 79971755887-75168448999872223444530827899998753048975368740643354676605788873799 Q ss_pred EECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 979989858874899989999999841 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) |++|+. +..|.|.+..+.|+.|+.++ T Consensus 106 FrnG~~-~~~Y~G~r~adgIV~wl~kq 131 (493) T KOG0190 106 FRNGRS-AQDYNGPREADGIVKWLKKQ 131 (493) T ss_pred EECCCC-CEECCCCCCHHHHHHHHHHC T ss_conf 865975-43126821178999999862 No 32 >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI and PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5, PDIR, ERp46 and the transmembrane PDIs. PDI, ERp57, ERp72, P5, PDIR and ERp46 are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins usually contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and may also contain one or more redox inactive TRX-like (b) domains. Only one a domain is required for the oxidase function but multiple copies Probab=99.90 E-value=8e-24 Score=158.36 Aligned_cols=99 Identities=29% Similarity=0.619 Sum_probs=89.7 Q ss_pred EEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 7757677999998489949999876997022213466665421000--12333226723265777762315688799997 Q gi|254780822|r 4 LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 4 i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~--~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) ++||+++|++.+ .++++++|+||||||++|+++.|.|+++++.+. +++.+++|||+++++++++|+|+++||+++|+ T Consensus 1 ~~l~~~~f~~~v-~~~~~~lV~Fya~wC~~C~~~~p~~~~~a~~~~~~~~~~~~~vd~~~~~~~~~~~~i~~~Pti~~f~ 79 (101) T cd02961 1 VELTDDNFDELV-KDSKDVLVEFYAPWCGHCKALAPEYEKLAKELKGDGKVVVAKVDCTANNDLCSEYGVRGYPTIKLFP 79 (101) T ss_pred CCCCHHHHHHHH-HCCCCEEEEEECCCCCCCHHHCHHHHHHHHHHCCCCCEEEEEEECCCCHHHCCCCCEEEECEEEEEE T ss_conf 987789999999-5399899999889980403326778999998514897899999875534222267736828799998 Q ss_pred CCEEEEEEECCCCCHHHHHHHH Q ss_conf 9989858874899989999999 Q gi|254780822|r 82 DGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 82 ~g~~~~~~~~g~~~~~~l~~~i 103 (107) +|+.....|.|.++.++|.+|| T Consensus 80 ~~~~~~~~y~G~~~~~~l~~fi 101 (101) T cd02961 80 NGSKEPVKYEGPRTLESLVEFI 101 (101) T ss_pred CCCEEEEEECCCCCHHHHHHHC T ss_conf 9954355746989999999659 No 33 >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif. CDSP32 is a stress-inducible TRX, i.e., it acts as a TRX by reducing protein disulfides and is induced by environmental and oxidative stress conditions. It plays a critical role in plastid defense against oxidative damage, a role related to its function as a physiological electron donor to BAS1, a plastidic 2-cys peroxiredoxin. Plants lacking CDSP32 exhibit decreased photosystem II photochemical efficiencies and chlorophyll retention compared to WT controls, as well as an increased proportion of BAS1 in its overoxidized monomeric form. Probab=99.89 E-value=6.5e-23 Score=153.12 Aligned_cols=97 Identities=23% Similarity=0.407 Sum_probs=84.2 Q ss_pred CHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC---HHHHHHHCCCCCCEEEEEEC Q ss_conf 767799999848-99499998769970222134666654210001233322672326---57777623156887999979 Q gi|254780822|r 7 DTKSFDSEVLEC-SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES---SEISTRYQISSIPTLILFKD 82 (107) Q Consensus 7 ~~~~f~~~v~~~-~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~---~~l~~~~~v~~~Pt~~~~~~ 82 (107) |.++|++.+.++ +++++|+|||+|||||+++.|.++++++++++ +.|++||+|++ ++++++|+|+++|||++|++ T Consensus 2 s~eef~~~l~~a~~kLVVvdF~A~WCgPCk~i~P~~e~La~~~~~-v~F~kV~~De~~~~~ela~~~~I~s~PTF~f~k~ 80 (103) T cd02985 2 SVEELDEALKKAKGRLVVLEFALKHSGPSVKIYPTMVKLSRTCND-VVFLLVNGDENDSTMELCRREKIIEVPHFLFYKD 80 (103) T ss_pred CHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CEEEEEECCCCHHHHHHHHHCCCCCCCEEEEEEC T ss_conf 889999999977998899999899897777630899999977799-7899997767655799999779806337999999 Q ss_pred CEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 989858874899989999999841 Q gi|254780822|r 83 GKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 83 g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) |+.+.+. .|+ +++.|++-|.++ T Consensus 81 G~~v~~~-~GA-~~~~L~~~Vl~~ 102 (103) T cd02985 81 GEKIHEE-EGI-GPDELIGDVLYY 102 (103) T ss_pred CEEEEEE-ECC-CHHHHHHHHHHC T ss_conf 9899999-688-989999988733 No 34 >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein. Dyneins are molecular motors that generate force against microtubules to produce cellular movement, and are divided into two classes: axonemal and cytoplasmic. They are supramolecular complexes consisting of three protein groups classified according to size: dynein heavy, intermediate and light chains. Axonemal dyneins form two structures, the inner and outer arms, which are attached to doublet microtubules throughout the cilia and flagella. The human homolog is the sperm-specific Sptrx-2, presumed to be a component of the human sperm axoneme architecture. Included in this group is another human protein, TRX-like protein 2, a smaller fusion protein containing one TRX and one NDPK domain, which Probab=99.89 E-value=1.5e-22 Score=151.01 Aligned_cols=99 Identities=21% Similarity=0.532 Sum_probs=86.2 Q ss_pred EEE-CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 775-767799999848994999987699702221346666542100012-333226723265777762315688799997 Q gi|254780822|r 4 LKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 4 i~i-~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) |+| |.++|++ +++++++++|+|||+|||||++|.|.+++++.++.++ +.|+++|.|.. +.+.+|+|+++||+++|+ T Consensus 2 i~I~s~e~f~~-~i~~~~lvvVdf~A~WCGPCk~i~P~~~~l~~e~~~~~~~~~~~~~d~~-~~~~~~~i~s~PTf~~fk 79 (102) T cd02948 2 VEINNQEEWEE-LLSNKGLTVVDVYQEWCGPCKAVVSLFKKIKNELGDDLLHFATAEADTI-DTLKRYRGKCEPTFLFYK 79 (102) T ss_pred EEECCHHHHHH-HHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCH-HHHHHHCCEEEEEEEEEE T ss_conf 36459999999-8747994999998997745788789999999874787089999779986-799984988630899999 Q ss_pred CCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 9989858874899989999999841 Q gi|254780822|r 82 DGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 82 ~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) +|+.+.+. .|+ ++.+|.+.|++. T Consensus 80 nG~~v~~~-~GA-~~~~L~~~I~~l 102 (102) T cd02948 80 NGELVAVI-RGA-NAPLLNKTITEL 102 (102) T ss_pred CCEEEEEE-ECC-CHHHHHHHHHHC T ss_conf 99999999-798-989999999749 No 35 >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif. The gene name for the human protein is TxnDC9. The two characterized members are described as Phd-like proteins, PLP1 of Saccharomyces cerevisiae and PhLP3 of Dictyostelium discoideum. Gene disruption experiments show that both PLP1 and PhLP3 are non-essential proteins. Unlike Phd and most Phd-like proteins, members of this group do not contain the Phd N-terminal helical domain which is implicated in binding to the G protein betagamma subunit. Probab=99.88 E-value=5.4e-23 Score=153.56 Aligned_cols=88 Identities=27% Similarity=0.481 Sum_probs=79.6 Q ss_pred EEEECH-HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 177576-7799999848994999987699702221346666542100012333226723265777762315688799997 Q gi|254780822|r 3 ALKVDT-KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 3 ~i~i~~-~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) +.+|++ ++|.+ ++.++++++|+|||+||++|+.|.|.+++++++|++ ++|++||+|++|+++++|+|+++||+++|+ T Consensus 6 v~eI~~e~ef~e-~i~~~~~VVV~Fya~wc~~Ck~l~p~l~~lA~~~~~-v~F~kvn~d~~p~i~~~~~I~~lPT~~~fk 83 (113) T cd02989 6 YREVSDEKEFFE-IVKSSERVVCHFYHPEFFRCKIMDKHLEILAKKHLE-TKFIKVNAEKAPFLVEKLNIKVLPTVILFK 83 (113) T ss_pred EEEECCHHHHHH-HHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCC-CEEEEEECCCCHHHHHHCCCCCCCEEEEEE T ss_conf 999899999999-864799799999899996678889999999997879-759999846797789986987588899999 Q ss_pred CCEEEEEEECCC Q ss_conf 998985887489 Q gi|254780822|r 82 DGKVIDRMMPGA 93 (107) Q Consensus 82 ~g~~~~~~~~g~ 93 (107) +|+.+.+.. |. T Consensus 84 ~G~~vd~iv-Gf 94 (113) T cd02989 84 NGKTVDRIV-GF 94 (113) T ss_pred CCEEEEEEE-CC T ss_conf 999989999-94 No 36 >PTZ00051 thioredoxin; Provisional Probab=99.88 E-value=1.6e-22 Score=150.93 Aligned_cols=94 Identities=32% Similarity=0.760 Sum_probs=83.4 Q ss_pred EEE-CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 775-7677999998489949999876997022213466665421000123332267232657777623156887999979 Q gi|254780822|r 4 LKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 4 i~i-~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) .+| |.++|++ +++++++++|+|||+||+||+.+.|.+++++++|+ ++.|++||+|++++++.+|+|+++||+++|++ T Consensus 3 ~eI~s~e~f~~-~i~~~~~vvV~F~a~wC~pCk~~~p~~~~l~~~~~-~~~f~~vd~d~~~~l~~~~~I~~~PT~~~~k~ 80 (98) T PTZ00051 3 HEVTSKEEFEK-TLSGDSVVVVDFYAEWCGPCMRFAPQFEELAKEHP-KLVFVKVNVDELQELAQKYNVTSLPTFKVFKS 80 (98) T ss_pred EECCCHHHHHH-HHCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHCC-CEEEEEEECCCCHHHHHHCCCEEEEEEEEEEC T ss_conf 89789999999-97589919999979998751126348999987678-53799998858999999879879768999999 Q ss_pred CEEEEEEECCCCCHHHHHH Q ss_conf 9898588748999899999 Q gi|254780822|r 83 GKVIDRMMPGASSQSDIIE 101 (107) Q Consensus 83 g~~~~~~~~g~~~~~~l~~ 101 (107) |+.+.+. .|. +.+.|.+ T Consensus 81 G~~v~~~-~Ga-~~~~L~~ 97 (98) T PTZ00051 81 GQVVGEF-LGA-NKEGLKQ 97 (98) T ss_pred CEEEEEE-ECC-CHHHHHC T ss_conf 9999999-687-9899630 No 37 >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functio Probab=99.85 E-value=2.4e-21 Score=144.08 Aligned_cols=93 Identities=40% Similarity=0.959 Sum_probs=84.2 Q ss_pred HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEE Q ss_conf 77999998489949999876997022213466665421000123332267232657777623156887999979989858 Q gi|254780822|r 9 KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDR 88 (107) Q Consensus 9 ~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~ 88 (107) ++|++ +++++++++|+|||+||++|+.+.|.++++++.++ .+.+++||++++++++++|+|.++||+++|++|+++.+ T Consensus 1 ~~~~~-~i~~~~~vlv~f~a~wC~~C~~~~p~l~~~~~~~~-~~~~~~vd~~~~~~l~~~~~i~~~Pt~~~~~~G~~~~~ 78 (93) T cd02947 1 EEFEE-LIKSAKPVVVDFWAPWCGPCKAIAPVLEELAEEYP-KVKFVKVDVDENPELAEEYGVRSIPTFLFFKNGKEVDR 78 (93) T ss_pred CCHHH-HHHCCCCEEEEEECCCCCCCCCCCHHHHHHCCCCC-CEEEEEECCCCCHHHHHCCCCCCCCCEEEEECCEEEEE T ss_conf 98789-96089959999978998262023601223224445-45999955765953530578673696899989989999 Q ss_pred EECCCCCHHHHHHHHH Q ss_conf 8748999899999998 Q gi|254780822|r 89 MMPGASSQSDIIEWIL 104 (107) Q Consensus 89 ~~~g~~~~~~l~~~i~ 104 (107) . .|..+.++|.+||+ T Consensus 79 ~-~G~~~~~~l~~~i~ 93 (93) T cd02947 79 V-VGADPKEELEEFLE 93 (93) T ss_pred E-ECCCCHHHHHHHHC T ss_conf 9-78999999999669 No 38 >KOG0908 consensus Probab=99.85 E-value=3.4e-21 Score=143.22 Aligned_cols=103 Identities=32% Similarity=0.651 Sum_probs=89.9 Q ss_pred CCEEEEC-HHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE Q ss_conf 9517757-67799999848-994999987699702221346666542100012333226723265777762315688799 Q gi|254780822|r 1 MSALKVD-TKSFDSEVLEC-SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLI 78 (107) Q Consensus 1 M~~i~i~-~~~f~~~v~~~-~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~ 78 (107) |++|.|+ +..|...+-.+ .+.++|+|+|.|||||++++|.|+.++++|++ ..|++||+|+.++.+.-+||++.||++ T Consensus 1 m~Vi~v~~d~df~~~ls~ag~k~v~Vdfta~wCGPCk~IaP~Fs~lankYp~-aVFlkVdVd~c~~taa~~gV~amPTFi 79 (288) T KOG0908 1 MPVIVVNSDSDFQRELSAAGGKLVVVDFTASWCGPCKRIAPIFSDLANKYPG-AVFLKVDVDECRGTAATNGVNAMPTFI 79 (288) T ss_pred CCEEEECCCHHHHHHHHCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHCCC-CEEEEEEHHHHHCHHHHCCCCCCCEEE T ss_conf 9747836807777764025861899998714553277660578876541766-389997478851513205845574599 Q ss_pred EEECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 9979989858874899989999999841 Q gi|254780822|r 79 LFKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 79 ~~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) +|++|..+.+ +.|+ ++..|++.+.++ T Consensus 80 ff~ng~kid~-~qGA-d~~gLe~kv~~~ 105 (288) T KOG0908 80 FFRNGVKIDQ-IQGA-DASGLEEKVAKY 105 (288) T ss_pred EEECCEEEEE-ECCC-CHHHHHHHHHHH T ss_conf 9964727653-2277-877899999997 No 39 >KOG0190 consensus Probab=99.85 E-value=1.3e-21 Score=145.52 Aligned_cols=102 Identities=28% Similarity=0.600 Sum_probs=89.4 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHHHHHCCCCCCEEEEE Q ss_conf 177576779999984899499998769970222134666654210001--233322672326577776231568879999 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--KVKITKLDIEESSEISTRYQISSIPTLILF 80 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~ 80 (107) +.-|-.+||+..+++.+|.+||.|||||||||++++|+|++|++.|++ ++.++++|.+.| ++ ....+.++||+++| T Consensus 368 VkvlVgknfd~iv~de~KdVLvEfYAPWCgHCk~laP~yeeLAe~~k~~~~vviAKmDaTaN-d~-~~~~~~~fPTI~~~ 445 (493) T KOG0190 368 VKVVVGKNFDDIVLDEGKDVLVEFYAPWCGHCKALAPIYEELAEKYKDDENVVIAKMDATAN-DV-PSLKVDGFPTILFF 445 (493) T ss_pred EEEEECCCHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCC-CC-CCCCCCCCCEEEEE T ss_conf 38985067888751578767999707543455655479999999965898708998016665-57-66643665468870 Q ss_pred ECCEE-EEEEECCCCCHHHHHHHHHHC Q ss_conf 79989-858874899989999999841 Q gi|254780822|r 81 KDGKV-IDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 81 ~~g~~-~~~~~~g~~~~~~l~~~i~~~ 106 (107) +.|.+ -+..|.|.++.+++..||.++ T Consensus 446 pag~k~~pv~y~g~R~le~~~~fi~~~ 472 (493) T KOG0190 446 PAGHKSNPVIYNGDRTLEDLKKFIKKS 472 (493) T ss_pred CCCCCCCCCCCCCCCCHHHHHHHHCCC T ss_conf 378988872247875467787542157 No 40 >KOG0907 consensus Probab=99.84 E-value=1.7e-20 Score=139.14 Aligned_cols=88 Identities=30% Similarity=0.729 Sum_probs=79.5 Q ss_pred HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCC Q ss_conf 84899499998769970222134666654210001233322672326577776231568879999799898588748999 Q gi|254780822|r 16 LECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASS 95 (107) Q Consensus 16 ~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~ 95 (107) ..++++++|+|||+|||||+.+.|.+++++.+|++ +.|++||+|+++++++.++|+++||+++|++|+.+.+.+ |. + T Consensus 18 ~~~~kliVvdF~a~wCgPCk~i~P~~~~La~~y~~-~~Flkvdvde~~~~~~~~~V~~~PTf~f~k~g~~~~~~v-Ga-~ 94 (106) T KOG0907 18 EAGDKLVVVDFYATWCGPCKAIAPKFEKLAEKYPD-VVFLKVDVDELEEVAKEFNVKAMPTFVFYKGGEEVDEVV-GA-N 94 (106) T ss_pred HCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHCCC-CEEEEEECCCHHHHHHHCCCEEEEEEEEEECCEEEEEEE-CC-C T ss_conf 18997699999889888876502179999977889-789998342208778760861646999998988889984-69-9 Q ss_pred HHHHHHHHHHC Q ss_conf 89999999841 Q gi|254780822|r 96 QSDIIEWILSR 106 (107) Q Consensus 96 ~~~l~~~i~~~ 106 (107) .+++.+.+.++ T Consensus 95 ~~~l~~~i~~~ 105 (106) T KOG0907 95 KAELEKKIAKH 105 (106) T ss_pred HHHHHHHHHHC T ss_conf 99999998631 No 41 >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions. Phd and PhLPs specifically bind G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane and impeding G protein-mediated signal transduction by inhibiting the formation of a functional G protein trimer (G protein alphabetagamma). Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-te Probab=99.82 E-value=1.1e-19 Score=134.47 Aligned_cols=100 Identities=23% Similarity=0.481 Sum_probs=86.6 Q ss_pred CEEEECHHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 51775767799999848--9949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 2 SALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~--~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) .+.+|++++|.+.|.++ +.+|+|+||++||++|+.|.|.++++|.+|++ ++|++||+++ ..++.+|+|+++||+++ T Consensus 5 ~v~eis~~~f~~~V~~~s~~~~VvV~f~~~~~~~C~~l~~~l~~lA~~~~~-vkF~ki~~~~-~~i~~~~~i~~lPt~l~ 82 (113) T cd02957 5 EVREISSKEFLEEVTKASKGTRVVVHFYEPGFPRCKILDSHLEELAAKYPE-TKFVKINAEK-AFLVNYLDIKVLPTLLV 82 (113) T ss_pred EEEEECHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCC-EEEEEEECCC-HHHHHHCCCCCCCEEEE T ss_conf 079806789999998368997799999789994478998999998632896-1999997572-88898769872668999 Q ss_pred EECCEEEEEEEC------CCCCHHHHHHHH Q ss_conf 979989858874------899989999999 Q gi|254780822|r 80 FKDGKVIDRMMP------GASSQSDIIEWI 103 (107) Q Consensus 80 ~~~g~~~~~~~~------g~~~~~~l~~~i 103 (107) |++|+.+.+..+ ...+.+.|+.++ T Consensus 83 yk~G~~v~~lvG~~~~~g~~~~~~~le~~L 112 (113) T cd02957 83 YKNGELIDNIVGFEELGGDDFTTEDLEKFL 112 (113) T ss_pred EECCEEEEEEECHHHHCCCCCCHHHHHHHH T ss_conf 999999899989577489879999999974 No 42 >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library. It contains a TRX domain but the redox active CXXC motif is replaced with SXXC. Sequence analysis predicts that TMX2 may be a Type I membrane protein, with its C-terminal half protruding on the luminal side of the endoplasmic reticulum (ER). In addition to the TRX domain, transmembrane region and ER-retention signal, TMX2 also contains a Myb DNA-binding domain repeat signature and a dileucine motif in the tail. Probab=99.78 E-value=4.6e-19 Score=130.95 Aligned_cols=88 Identities=24% Similarity=0.574 Sum_probs=77.7 Q ss_pred EEEECHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCC------C Q ss_conf 1775767799999848-99499998769970222134666654210001-23332267232657777623156------8 Q gi|254780822|r 3 ALKVDTKSFDSEVLEC-SNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISS------I 74 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~-~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~------~ 74 (107) +..++..++++++..+ ...|+|+|||+||++|+.++|+|++++.+|.. +++|++||+++.++++++|+|+. + T Consensus 30 i~~~~~~~le~~L~~~~~~~WLV~F~A~W~~~C~~~apifaelS~~y~~~~lkFgkvDv~r~p~vA~ky~I~~s~~s~ql 109 (152) T cd02962 30 IKYFTPKTLEEELERDKRVTWLVEFFTTWSPECVNFAPVFAELSLKYNNNNLKFGKIDIGRFPNVAEKFRVSTSPLSKQL 109 (152) T ss_pred EEEECCCCHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHCCCCCCCCCCCC T ss_conf 45637420898962499649999992588878887789999999996537866999876637406988286753233658 Q ss_pred CEEEEEECCEEEEEEE Q ss_conf 8799997998985887 Q gi|254780822|r 75 PTLILFKDGKVIDRMM 90 (107) Q Consensus 75 Pt~~~~~~g~~~~~~~ 90 (107) ||+++|++|+++.|+- T Consensus 110 PT~iLF~~G~Ev~R~P 125 (152) T cd02962 110 PTIILFQGGKEVARRP 125 (152) T ss_pred CEEEEEECCEEEEECC T ss_conf 7599974889945637 No 43 >pfam01216 Calsequestrin Calsequestrin. Probab=99.78 E-value=9.1e-19 Score=129.24 Aligned_cols=101 Identities=15% Similarity=0.267 Sum_probs=85.2 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHH-------HHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCC Q ss_conf 17757677999998489949999876997022213466665-------4210001-233322672326577776231568 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD-------IADELAD-KVKITKLDIEESSEISTRYQISSI 74 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~-------l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~ 74 (107) ++.||.+||++.+ +..+.++|.||+| |++|+.+.|.++. .+..+.+ .+.+++||+++..+||++|||+++ T Consensus 13 V~~Lt~~NF~~~~-k~~d~l~v~f~ap-~g~~k~~~~~y~~~e~~lelAAq~l~~k~I~l~kVDat~e~~La~k~gv~gy 90 (350) T pfam01216 13 VISLTEKNYKQVL-KKYEVLALLYHEP-VSDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLDEE 90 (350) T ss_pred EEECCCCCHHHHH-HHCCEEEEEEECC-CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHCCCCCC T ss_conf 2887612289998-6485899998789-8655555366766777999999874125886388515116889998298767 Q ss_pred CEEEEEECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 879999799898588748999899999998419 Q gi|254780822|r 75 PTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 75 Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) ||+.+|++|+.++ |.|.|+.+.|++||.+++ T Consensus 91 pTlkvFr~g~~~e--Y~G~R~ad~IV~~l~k~~ 121 (350) T pfam01216 91 DSLYVFKGDETIE--YDGEFSADTLVEFLLDVL 121 (350) T ss_pred CEEEEEECCEEEC--CCCCCCHHHHHHHHHHHH T ss_conf 5289988992650--588766789999999702 No 44 >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox. ThOX proteins are responsible for the generation of hydrogen peroxide, a crucial substrate of thyroperoxidase, which functions to iodinate thyroglobulin and synthesize thyroid hormones. EFP1 was isolated through a yeast two-hybrid method using the EF-hand fragment of dog Duox1 as a bait. It could be one of the partners in the assembly of a multiprotein complex constituting the thyroid hydrogen peroxide generating system. EFP1 contains two TRX domains related to the redox active TRX domains of protein disulfide isomerase (PDI). This subfamily is composed of the N-terminal TRX domain of EFP1, which contains a CXXS sequence in place of the typical CXXC motif, similar to ERp44. The CXXS motif allows the formation of stable mixed disulfides, crucial for the ER-retention function of ERp44. Probab=99.77 E-value=3.9e-19 Score=131.32 Aligned_cols=101 Identities=12% Similarity=0.186 Sum_probs=87.1 Q ss_pred CEEEECHHHHHHH--HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHH-HHHCCCCCCEEE Q ss_conf 5177576779999--9848994999987699702221346666542100012333226723265777-762315688799 Q gi|254780822|r 2 SALKVDTKSFDSE--VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS-TRYQISSIPTLI 78 (107) Q Consensus 2 ~~i~i~~~~f~~~--v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~-~~~~v~~~Pt~~ 78 (107) +++++.+.++... +...+..++|+||||||++|+.++|+++++|+.+.+.+.|++|||+.+..+| ++|++.++|++. T Consensus 10 ~V~d~~~G~l~~~~~~~~~sei~lV~FYAPWC~hc~~~~pe~~~~A~~l~~~v~f~aVnC~~~~~~Cr~qy~v~~fP~i~ 89 (113) T cd03006 10 PVLDFYKGQLDYAEELRTDAEVSLVMYYAPWDAQSQAARQEFEQVAQKLSDQVLFVAINCWWPQGKCRKQKHFFYFPVIH 89 (113) T ss_pred CEEECCCCCHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHCCCCCCCCCEEE T ss_conf 46771478678889876407379999988867889998999999999854674899994788845211535756587899 Q ss_pred EEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 9979989858874899989999999 Q gi|254780822|r 79 LFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 79 ~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) +|..+.. +..|.|.++...|..|+ T Consensus 90 ~~~~~~~-pi~Y~Gp~~a~~i~kfv 113 (113) T cd03006 90 LYYRSRG-PIEYKGPMRAPYMEKFV 113 (113) T ss_pred EEECCCC-CCCCCCCCCHHHHHHCC T ss_conf 9856999-70106877788887209 No 45 >KOG0912 consensus Probab=99.77 E-value=3e-19 Score=132.00 Aligned_cols=101 Identities=32% Similarity=0.663 Sum_probs=91.9 Q ss_pred ECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHC----C-CCCCCCCCCCCCCHHHHHHHCCCCCCEEEEE Q ss_conf 5767799999848994999987699702221346666542100----0-1233322672326577776231568879999 Q gi|254780822|r 6 VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADEL----A-DKVKITKLDIEESSEISTRYQISSIPTLILF 80 (107) Q Consensus 6 i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~----~-~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~ 80 (107) ++.+|+.. +++++..++|.|||+||+.+++++|++++.|..+ + +++.+++||||++.+|+.+|.|.-+||+.+| T Consensus 1 lt~~N~~~-il~s~elvfv~FyAdWCrFSq~L~piF~EAa~~~~~e~P~~kvvwg~VDcd~e~~ia~ky~I~KyPTlKvf 79 (375) T KOG0912 1 LTSENIDS-ILDSNELVFVNFYADWCRFSQMLKPIFEEAAAKFKQEFPEGKVVWGKVDCDKEDDIADKYHINKYPTLKVF 79 (375) T ss_pred CCCCCHHH-HHCCCEEEEEEEEHHHCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCEEEEE T ss_conf 96313777-62514089666330113588887688999999999868886459987055315677654100348614665 Q ss_pred ECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 799898588748999899999998419 Q gi|254780822|r 81 KDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 81 ~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) ++|....|.|.|.++.+++.+||++++ T Consensus 80 rnG~~~~rEYRg~RsVeaL~efi~kq~ 106 (375) T KOG0912 80 RNGEMMKREYRGQRSVEALIEFIEKQL 106 (375) T ss_pred ECCCHHHHHHCCCHHHHHHHHHHHHHH T ss_conf 543013134313213999999999974 No 46 >KOG4277 consensus Probab=99.75 E-value=2.3e-18 Score=126.86 Aligned_cols=86 Identities=36% Similarity=0.675 Sum_probs=78.6 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCC Q ss_conf 899499998769970222134666654210001---23332267232657777623156887999979989858874899 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGAS 94 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~---~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~ 94 (107) .++.|+|+||||||+||+++.|+|+++..++++ -+++.++|++..+.++..|+|+|+||+.+|++|..+. |.|.+ T Consensus 42 dddiW~VdFYAPWC~HCKkLePiWdeVG~elkdig~PikVGKlDaT~f~aiAnefgiqGYPTIk~~kgd~a~d--YRG~R 119 (468) T KOG4277 42 DDDIWFVDFYAPWCAHCKKLEPIWDEVGHELKDIGLPIKVGKLDATRFPAIANEFGIQGYPTIKFFKGDHAID--YRGGR 119 (468) T ss_pred CCCEEEEEEECHHHHHCCCCCCHHHHHCCCHHHCCCCEEECCCCCCCCHHHHHHHCCCCCCEEEEECCCEEEE--CCCCC T ss_conf 6876899865455554033461367737332306984153223444356667551457784689841870465--37885 Q ss_pred CHHHHHHHHHH Q ss_conf 98999999984 Q gi|254780822|r 95 SQSDIIEWILS 105 (107) Q Consensus 95 ~~~~l~~~i~~ 105 (107) .++.|++|... T Consensus 120 ~Kd~iieFAhR 130 (468) T KOG4277 120 EKDAIIEFAHR 130 (468) T ss_pred CHHHHHHHHHH T ss_conf 27889999986 No 47 >KOG0191 consensus Probab=99.74 E-value=6e-18 Score=124.51 Aligned_cols=104 Identities=29% Similarity=0.582 Sum_probs=87.4 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 17757677999998489949999876997022213466665421000123332267232657777623156887999979 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) ..+++..+|...+...+.+++|.||+|||++|+.+.|.|.++++.+.+.+.++.|||+.++++|++|+|+++||+.+|.. T Consensus 31 ~~~~~~~~~~~~~~~~~~~~~v~fyapwc~~c~~l~~~~~~~~~~l~~~~~~~~vd~~~~~~~~~~y~i~gfPtl~~f~~ 110 (383) T KOG0191 31 VSELTLDSFFDFLLKDDSPWLVEFYAPWCGHCKKLAPTYKKLAKALKGKVKIGAVDCDEHKDLCEKYGIQGFPTLKVFRP 110 (383) T ss_pred CCEECCCCCHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCCCCEEEEECC T ss_conf 43001123177760268855999988877636776799999998653250378965744888998628787767999538 Q ss_pred CEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 9898588748999899999998419 Q gi|254780822|r 83 GKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 83 g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) | .....+.|..+.+.+.+|+.+.+ T Consensus 111 ~-~~~~~~~~~~~~~~~~~~~~~~~ 134 (383) T KOG0191 111 G-KKPIDYSGPRNAESLAEFLIKEL 134 (383) T ss_pred C-CCCCCCCCCCCHHHHHHHHHHHH T ss_conf 8-76303568755788888887650 No 48 >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD alpha). DsbD beta, a transmembrane domain comprising of eight helices, acquires its reducing potential from the cytoplasmic thioredoxin. DsbD alpha transfers the acquired reducing potential from DsbD gamma to target proteins such as the periplasmic protein disulphide isomerases, DsbC and DsbG. This flow of reducing potential from the cytoplasm through DsbD allows DsbC and DsbG to act as isomerases in the oxidizing environment of the bacterial periplasm. DsbD also transfers reducing potential from the cytoplasm to specific reductases in the periplasm which are involved in the maturation of cytochromes. Probab=99.74 E-value=6e-18 Score=124.53 Aligned_cols=94 Identities=21% Similarity=0.469 Sum_probs=77.7 Q ss_pred HHHHHHHHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCCC----HHHHHHHCCCCCCEEEEEEC Q ss_conf 79999984899499998769970222134666---654210001233322672326----57777623156887999979 Q gi|254780822|r 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEES----SEISTRYQISSIPTLILFKD 82 (107) Q Consensus 10 ~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~~----~~l~~~~~v~~~Pt~~~~~~ 82 (107) .+++ ..+.+||++|+|||+||++|+.|.+.. .++++.+.+++.++++|++++ .++.++|||.|+||+++|.. T Consensus 3 al~~-a~~~gKpVlvdf~A~WC~~Ck~m~~~~~~~~~v~~~~~~~~v~vkvD~t~~~~~~~~l~~~~~v~g~Pt~~f~~~ 81 (104) T cd02953 3 ALAQ-ALAQGKPVFVDFTADWCVTCKVNEKVVFSDPEVQAALKKDVVLLRADWTKNDPEITALLKRFGVFGPPTYLFYGP 81 (104) T ss_pred HHHH-HHHCCCCEEEEEECCCCHHHHHHHHHCCCCHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHCCCCCCCEEEEECC T ss_conf 8999-998299199999867588888511420488999999724773576367789989999999839955677999879 Q ss_pred -CEEEEEEECCCCCHHHHHHHHH Q ss_conf -9898588748999899999998 Q gi|254780822|r 83 -GKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 83 -g~~~~~~~~g~~~~~~l~~~i~ 104 (107) |+....+..|.++++++.++|+ T Consensus 82 ~g~~~~~~l~G~~~~~~fl~~Le 104 (104) T cd02953 82 GGEPEPLRLPGFLTADEFLEALE 104 (104) T ss_pred CCCCCCCEEECCCCHHHHHHHHC T ss_conf 99867626123048999999759 No 49 >KOG0191 consensus Probab=99.68 E-value=8.2e-17 Score=117.97 Aligned_cols=104 Identities=25% Similarity=0.536 Sum_probs=94.1 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHCCCCCCEEEEE Q ss_conf 17757677999998489949999876997022213466665421000--1233322672326577776231568879999 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIEESSEISTRYQISSIPTLILF 80 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~--~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~ 80 (107) +.+++..+|...+.+++..++|.||+|||++|+.++|.|++++..+. +.+.++.+|++.++.++.+++|+++||+++| T Consensus 146 v~~l~~~~~~~~~~~~~~~~lv~f~aPwc~~ck~l~~~~~~~a~~~~~~~~v~~~~~d~~~~~~~~~~~~v~~~Pt~~~f 225 (383) T KOG0191 146 VFELTKDNFDETVKDSDADWLVEFYAPWCGHCKKLAPEWEKLAKLLKSKENVELGKIDATVHKSLASRLEVRGYPTLKLF 225 (383) T ss_pred CHHCCCCCHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEE T ss_conf 10024421133322046653899966765688764078999899860456648996036511767777630459648995 Q ss_pred ECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 79989858874899989999999841 Q gi|254780822|r 81 KDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 81 ~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) .+|.+....+.|.++.+.+.+|+++. T Consensus 226 ~~~~~~~~~~~~~R~~~~i~~~v~~~ 251 (383) T KOG0191 226 PPGEEDIYYYSGLRDSDSIVSFVEKK 251 (383) T ss_pred CCCCCCCCCCCCCCCHHHHHHHHHHH T ss_conf 48986556573223568899999863 No 50 >PHA02125 thioredoxin-like protein Probab=99.67 E-value=7.7e-17 Score=118.12 Aligned_cols=73 Identities=23% Similarity=0.551 Sum_probs=62.6 Q ss_pred EEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHH Q ss_conf 99998769970222134666654210001233322672326577776231568879999799898588748999899999 Q gi|254780822|r 22 VVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101 (107) Q Consensus 22 vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~ 101 (107) ++.+|||+|||+|+.+.|.++++. ..|++||.|++.++|.+|+|+|+||++ ||+++.|+.+-.+...++.+ T Consensus 1 vi~~F~A~WCgpCk~l~P~l~~ie------~~~~~VD~D~~~~la~k~~Ir~IPT~i---nG~ev~RfvG~~rk~~e~ke 71 (75) T PHA02125 1 MIYLFGAEWCANCKMVKPMLANVE------YTYVDVDTDEGVELTAKHHIRSLPTLV---NTSTLDRFTGVPRNVAELKE 71 (75) T ss_pred CEEEEECCCCCCHHHCCCCCHHCC------CEEEEECCCCCHHHHHHCCCCCCCEEE---CCEEEEEEECCCCCHHHHHH T ss_conf 989984787753211366721116------357983455377689874961598178---99895206446423899999 Q ss_pred HH Q ss_conf 99 Q gi|254780822|r 102 WI 103 (107) Q Consensus 102 ~i 103 (107) ++ T Consensus 72 ~~ 73 (75) T PHA02125 72 KL 73 (75) T ss_pred HH T ss_conf 74 No 51 >KOG1731 consensus Probab=99.66 E-value=1.8e-17 Score=121.71 Aligned_cols=105 Identities=22% Similarity=0.512 Sum_probs=87.4 Q ss_pred CEEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC---CCCCCCCCCC--CCHHHHHHHCCCCCCE Q ss_conf 5177576779999984899499998769970222134666654210001---2333226723--2657777623156887 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLDIE--ESSEISTRYQISSIPT 76 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~---~i~~~~vd~d--~~~~l~~~~~v~~~Pt 76 (107) ++++|+.++|...+..+.+-.+|.||++|||+|++++|.|+++++.... -+.++.|||. +|..+|+.|+|+++|+ T Consensus 40 ~ii~Ld~~tf~~~v~~~~~~~lVEFy~swCGhCr~FAPtfk~~A~dl~~W~~vv~vaaVdCA~~~N~~lCRef~V~~~Pt 119 (606) T KOG1731 40 PIIELDVDTFNAAVFGSRKAKLVEFYNSWCGHCRAFAPTFKKFAKDLEKWRPVVRVAAVDCADEENVKLCREFSVSGYPT 119 (606) T ss_pred CEEEEEHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHCCCCCCCE T ss_conf 73784142267786166216899998765255553056899998887503340588886032032235676168877842 Q ss_pred EEEEECCEE---EEEEECCCCCHHHHHHHHHHC Q ss_conf 999979989---858874899989999999841 Q gi|254780822|r 77 LILFKDGKV---IDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 77 ~~~~~~g~~---~~~~~~g~~~~~~l~~~i~~~ 106 (107) +.+|..+-. .+..+.|.....++.+.+.+. T Consensus 120 lryf~~~~~~~~~G~~~~~~~~~~ei~~~l~~~ 152 (606) T KOG1731 120 LRYFPPDSQNKTDGSDVSGPVIPSEIRDQLIRT 152 (606) T ss_pred EEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHH T ss_conf 554177665576777355776616678899998 No 52 >PRK03147 thiol-disulfide oxidoreductase; Provisional Probab=99.58 E-value=9.4e-15 Score=106.11 Aligned_cols=87 Identities=26% Similarity=0.693 Sum_probs=74.8 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCC----------------------CHHHHHHHCCCCC Q ss_conf 8994999987699702221346666542100012-3332267232----------------------6577776231568 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEE----------------------SSEISTRYQISSI 74 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d~----------------------~~~l~~~~~v~~~ 74 (107) .+++++|+|||+||++|++..|.+.++.++|+++ +.++.||.++ +.+++.+|++.++ T Consensus 61 kGK~vll~FWAtWC~pC~~E~P~L~~l~~~~~~~~v~vi~i~~d~~~~~v~~f~~~~~~~~pv~~D~~~~~~~~~~v~~~ 140 (176) T PRK03147 61 KGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIAVNVDETDIAVKNFVNQYGLKFPVAIDKGRQVIDAYGVGPL 140 (176) T ss_pred CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHCCCCCEEEECCCCHHHHHCCCCCC T ss_conf 99979999978979275467155999999853064478522078878889888987099622898797358987699988 Q ss_pred CEEEEEE-CCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 8799997-998985887489998999999984 Q gi|254780822|r 75 PTLILFK-DGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 75 Pt~~~~~-~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) |+.+++. +|+.+.+ +.|..+++++.+.|++ T Consensus 141 P~t~lId~~G~I~~~-~~G~i~~~~l~~~i~~ 171 (176) T PRK03147 141 PTTFLIDKDGKVVKV-ITGEMTEEMLEEYLNK 171 (176) T ss_pred CEEEEECCCCEEEEE-EECCCCHHHHHHHHHH T ss_conf 869999799979999-9789999999999998 No 53 >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Probab=99.57 E-value=8.2e-15 Score=106.47 Aligned_cols=97 Identities=19% Similarity=0.496 Sum_probs=77.2 Q ss_pred HHHHHHHH---HHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCCC----HHHHHHHCCCCCCEE Q ss_conf 67799999---84899499998769970222134666---654210001233322672326----577776231568879 Q gi|254780822|r 8 TKSFDSEV---LECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEES----SEISTRYQISSIPTL 77 (107) Q Consensus 8 ~~~f~~~v---~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~~----~~l~~~~~v~~~Pt~ 77 (107) .+++++.+ .+++|||+|+|||+||..||.++... .++.+.++ ++...++|++++ +++.++|++.|.|++ T Consensus 466 ~~eL~~~La~A~~~gKPV~VDFtADWCvtCK~~E~~tf~d~~V~~al~-~~~llk~DvT~~~~~~~all~~~~~~GpP~~ 544 (577) T PRK00293 466 VAELDAALAEAKAAGKPVMLDLYADWCVACKEFEKYTFSDPQVQQALA-DTVLLQADVTANNAEDVALLKHYNVLGLPTI 544 (577) T ss_pred HHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHCCCHHHHHHHC-CCEEEEEECCCCCHHHHHHHHHCCCCCCCEE T ss_conf 999999999998779909999984687779999998579889999863-9818999779999999999997499889889 Q ss_pred EEE-ECCEEEE-EEECCCCCHHHHHHHHHH Q ss_conf 999-7998985-887489998999999984 Q gi|254780822|r 78 ILF-KDGKVID-RMMPGASSQSDIIEWILS 105 (107) Q Consensus 78 ~~~-~~g~~~~-~~~~g~~~~~~l~~~i~~ 105 (107) ++| ++|++.. .+..|..+.+++.+.+++ T Consensus 545 lf~~~~G~e~~~~r~~G~~~~~~f~~~l~~ 574 (577) T PRK00293 545 LFFDAQGQEIPDARVTGFMDAATFAAHLRD 574 (577) T ss_pred EEECCCCCCCCCCEEEEECCHHHHHHHHHH T ss_conf 999999978447615775069999999973 No 54 >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation. Sulfur bacteria oxidize sulfur compounds to provide reducing equivalents for carbon dioxide fixation during autotrophic growth and the respiratory electron transport chain. It is unclear what the role of SoxW is, since it has been found to be dispensable in the oxidation of thiosulfate to sulfate. SoxW is specifically kept in the reduced state by SoxV, which is essential in thiosulfate oxidation. Probab=99.56 E-value=3.1e-14 Score=103.11 Aligned_cols=95 Identities=19% Similarity=0.440 Sum_probs=76.0 Q ss_pred HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCC-------------CHHHHHHHCCC Q ss_conf 779999984899499998769970222134666---65421000123332267232-------------65777762315 Q gi|254780822|r 9 KSFDSEVLECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEE-------------SSEISTRYQIS 72 (107) Q Consensus 9 ~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~-------------~~~l~~~~~v~ 72 (107) +.+.+...+++||++|+|+++||++|++|.... .++.+.+++++.+++||++. .++++++|+|. T Consensus 4 e~l~~A~~~~~Kpvlv~f~~~~C~~C~~m~~~~~~~~~v~~~l~~~f~~v~vd~~~~~~~~~f~g~~~~~~~la~~~~v~ 83 (125) T cd02951 4 EDLAEAAADGKKPLLLLFSQPGCPYCDKLKRDYLNDPAVQAYIRAHFVVVYINIDGDKEVTDFDGEALSEKELARKYRVR 83 (125) T ss_pred HHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHCCCHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHCCCC T ss_conf 99999986389849999978989708999998439999999996181478876156753003455644399999986987 Q ss_pred CCCEEEEEE-C-CEEEEEEECCCCCHHHHHHHHH Q ss_conf 688799997-9-9898588748999899999998 Q gi|254780822|r 73 SIPTLILFK-D-GKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 73 ~~Pt~~~~~-~-g~~~~~~~~g~~~~~~l~~~i~ 104 (107) ++||++++. + |+.+.+ +.|..+++.+...++ T Consensus 84 ~tPT~~fld~~gg~~i~~-~~Gy~~~~~f~~~L~ 116 (125) T cd02951 84 FTPTVIFLDPEGGKEIAR-LPGYLPPDEFLAYLE 116 (125) T ss_pred CCCEEEEECCCCCEEEEE-ECCCCCHHHHHHHHH T ss_conf 677799986999867777-259789999999999 No 55 >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif. Assembly of cytochrome c requires the ligation of heme to reduced thiols of the apocytochrome. In bacteria, this assembly occurs in the periplasm. The reductase activity of DsbE in the oxidizing environment of the periplasm is crucial in the maturation of cytochrome c. Probab=99.48 E-value=7.7e-14 Score=100.86 Aligned_cols=80 Identities=21% Similarity=0.507 Sum_probs=64.5 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-----------------------CHHHHHHHCCCCC Q ss_conf 89949999876997022213466665421000123332267232-----------------------6577776231568 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE-----------------------SSEISTRYQISSI 74 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~-----------------------~~~l~~~~~v~~~ 74 (107) .+++++|+|||+||++|++..|.+.+++++. .+.++.|+.++ ..++++.|+|+++ T Consensus 24 kGk~vvl~FWAtWC~pC~~e~P~l~~l~~~~--~~~vv~v~~~d~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~v~~~ 101 (127) T cd03010 24 KGKPYLLNVWASWCAPCREEHPVLMALARQG--RVPIYGINYKDNPENALAWLARHGNPYAAVGFDPDGRVGIDLGVYGV 101 (127) T ss_pred CCCEEEEEEECCCCHHHHHHCCHHHHHHHCC--CEEEEEEECCCCHHHHHHHHHHHCCCCCEEEECCCCCHHHHCCCCCC T ss_conf 9998999999895866888681078884258--35899863478999999999983998644775588632230785547 Q ss_pred CEEEEE-ECCEEEEEEECCCCCHHHHH Q ss_conf 879999-79989858874899989999 Q gi|254780822|r 75 PTLILF-KDGKVIDRMMPGASSQSDII 100 (107) Q Consensus 75 Pt~~~~-~~g~~~~~~~~g~~~~~~l~ 100 (107) ||.+++ ++|+.+.+. .|..+++.++ T Consensus 102 Ptt~liD~~G~I~~~~-~G~i~~e~le 127 (127) T cd03010 102 PETFLIDGDGIIRYKH-VGPLTPEVWE 127 (127) T ss_pred CCEEEEECCCEEEEEE-ECCCCHHHCC T ss_conf 8199991999799999-8489969939 No 56 >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif. The Salmonella typhimurium ScsD is a thioredoxin-like protein which confers copper tolerance to copper-sensitive mutants of E. coli. MtbDsbE has been characterized as an oxidase in vitro, catalyzing the disulfide bond formation of substrates like hirudin. The reduced form of MtbDsbE is more stable than its oxidized form, consistent with an oxidase function. This is in contrast to the function of DsbE from gram-negative bacteria which is a specific reductase of apocytochrome c. Probab=99.48 E-value=1.3e-13 Score=99.49 Aligned_cols=82 Identities=27% Similarity=0.559 Sum_probs=64.9 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCC---------------------CCCCHHHHHHHCCCCCCE Q ss_conf 89949999876997022213466665421000123332267---------------------232657777623156887 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD---------------------IEESSEISTRYQISSIPT 76 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd---------------------~d~~~~l~~~~~v~~~Pt 76 (107) .+|+++|+|||+||++|++..|.++++++++. +..+.++ .|.+.++++.|+|+++|| T Consensus 19 ~Gk~vvl~FWAtWC~pC~~e~P~l~~l~~~~~--~v~v~~~~~~~~~v~~f~~~~~~~fp~~~D~~~~~~~~y~v~~~Pt 96 (123) T cd03011 19 SGKPVLVYFWATWCPVCRFTSPTVNQLAADYP--VVSVALRSGDDGAVARFMQKKGYGFPVINDPDGVISARWGVSVTPA 96 (123) T ss_pred CCCEEEEEEECCCCCCHHHHCHHHHHHHHHCC--EEEEEEECCCHHHHHHHHHHCCCCCEEEECCCCCHHHHCCCCCCCE T ss_conf 99989999993878136563833888873387--8878860386888887765118873289889976265479771677 Q ss_pred EEEEECCEEEEEEECCCCCHHHHHHH Q ss_conf 99997998985887489998999999 Q gi|254780822|r 77 LILFKDGKVIDRMMPGASSQSDIIEW 102 (107) Q Consensus 77 ~~~~~~g~~~~~~~~g~~~~~~l~~~ 102 (107) .+++..+..+.+. .|..++.+++.- T Consensus 97 ~~liD~~GiV~~~-~G~~~~~~~~~r 121 (123) T cd03011 97 IVIVDPGGIVFVT-TGVTSEWGLRLR 121 (123) T ss_pred EEEEECCCEEEEE-ECCCCHHHHHHH T ss_conf 9999199989999-757997999984 No 57 >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif. TryX is involved in the regulation of oxidative stress in parasitic trypanosomatids by reducing TryX peroxidase, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides. TryX derives reducing equivalents from reduced trypanothione, a polyamine peptide conjugate unique to trypanosomatids, which is regenerated by the NADPH-dependent flavoprotein trypanothione reductase. Vertebrate NRX is a 400-amino acid nuclear protein with one redox active TRX domain containing a CPPC active site motif followed by one redox inactive TRX-like domain. Mouse NRX transcripts are expressed in all adult tissues but is restricted to the nervous system and limb buds in embryos. Plant NRX, longer than the Probab=99.46 E-value=8.8e-14 Score=100.52 Aligned_cols=72 Identities=29% Similarity=0.627 Sum_probs=59.0 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCC------------------------HHHHHHHC Q ss_conf 8994999987699702221346666542100012---33322672326------------------------57777623 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK---VKITKLDIEES------------------------SEISTRYQ 70 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~---i~~~~vd~d~~------------------------~~l~~~~~ 70 (107) .+|+++|+|||+||+||++..|.+.++.++|+++ +.++.|+.|++ ..+++.|+ T Consensus 17 kGK~vll~FWATWC~PC~~e~P~L~~ly~~~~~~~~~~~vi~Is~d~~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~y~ 96 (131) T cd03009 17 EGKTVGLYFSASWCPPCRAFTPKLVEFYEKLKESGKNFEIVFISWDRDEESFNDYFSKMPWLAVPFSDRERRSRLNRTFK 96 (131) T ss_pred CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHCCCEEEECCCCCHHHHHHHHCC T ss_conf 79889999987578666526589999999986138877999985587779999999857611011255106789999769 Q ss_pred CCCCCEEEEEE-CCEEEEEE Q ss_conf 15688799997-99898588 Q gi|254780822|r 71 ISSIPTLILFK-DGKVIDRM 89 (107) Q Consensus 71 v~~~Pt~~~~~-~g~~~~~~ 89 (107) |+++||.+++. +|+.+.+. T Consensus 97 v~giPt~~lId~~G~IV~~~ 116 (131) T cd03009 97 IEGIPTLIILDADGEVVTTD 116 (131) T ss_pred CCCCCEEEEECCCCCEEHHH T ss_conf 88778489999999798177 No 58 >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3. Probab=99.42 E-value=4.1e-13 Score=96.67 Aligned_cols=75 Identities=21% Similarity=0.451 Sum_probs=62.5 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCC---------------------------CCCHHHHHHH Q ss_conf 8994999987699702221346666542100012-33322672---------------------------3265777762 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDI---------------------------EESSEISTRY 69 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~---------------------------d~~~~l~~~~ 69 (107) .+|+++|+|||+||++|++..|.++++.++|+++ +.++.|+. |.+..+.++| T Consensus 22 kGK~Vll~FWatwC~pC~~e~P~l~~l~~~~~~~gv~vigV~~~~~~~e~~~~~~~~~~~~~~i~~pv~~D~~~~~~~~~ 101 (126) T cd03012 22 RGKVVLLDFWTYCCINCLHTLPYLTDLEQKYKDDGLVVIGVHSPEFAFERDLANVKSAVLRYGITYPVANDNDYATWRAY 101 (126) T ss_pred CCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEECCCHHHHHHC T ss_conf 99989998722419378877299999999706588179998445444302599999999985997428985817889857 Q ss_pred CCCCCCEEEEEE-CCEEEEEEECCC Q ss_conf 315688799997-998985887489 Q gi|254780822|r 70 QISSIPTLILFK-DGKVIDRMMPGA 93 (107) Q Consensus 70 ~v~~~Pt~~~~~-~g~~~~~~~~g~ 93 (107) +|+++||.+++. +|+.+.+.. |+ T Consensus 102 ~v~~~Pt~~lID~~G~i~~~~~-Ge 125 (126) T cd03012 102 GNQYWPALYLIDPTGNVRHVHF-GE 125 (126) T ss_pred CCCCCCEEEEECCCCCEEEEEE-CC T ss_conf 9982387999989982999995-78 No 59 >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX. Most members of this family, except RdCVF, are protein disulfide oxidoreductases containing an active site CXXC motif, similar to TRX. Probab=99.41 E-value=1.4e-13 Score=99.27 Aligned_cols=75 Identities=27% Similarity=0.581 Sum_probs=59.9 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCC-------------------------HHHHHHH Q ss_conf 899499998769970222134666654210001---233322672326-------------------------5777762 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLDIEES-------------------------SEISTRY 69 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~---~i~~~~vd~d~~-------------------------~~l~~~~ 69 (107) .+|+++|+|||+||+||++..|.+.++.++|.+ ++.++.|..|++ ..++++| T Consensus 16 kGK~vll~FWAsWC~pCr~e~P~L~~ly~~~~~~~~~~~vi~is~D~~~~~~~~~~~~~~~~~~lp~~~~~~~~~l~~~y 95 (132) T cd02964 16 EGKTVGLYFSASWCPPCRAFTPKLVEFYEKLKEEGKNFEIVFVSRDRSEESFNEYFSEMPPWLAVPFEDEELRELLEKQF 95 (132) T ss_pred CCCEEEEEEECCCCHHHHHHCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHC T ss_conf 89889999984568204310589999999987418868999976789999999999964985034136778889999973 Q ss_pred CCCCCCEEEEEE-CCEEEEEEECC Q ss_conf 315688799997-99898588748 Q gi|254780822|r 70 QISSIPTLILFK-DGKVIDRMMPG 92 (107) Q Consensus 70 ~v~~~Pt~~~~~-~g~~~~~~~~g 92 (107) +|+++||++++. +|+.+.+...| T Consensus 96 ~V~giPt~~lid~~Gkiv~~~~~~ 119 (132) T cd02964 96 KVEGIPTLVVLKPDGDVVTTNARD 119 (132) T ss_pred CCCCCCEEEEECCCCCEECHHHHH T ss_conf 888898789998999897032276 No 60 >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source. mauD is an essential accessory protein for the biosynthesis of methylamine dehydrogenase (MADH), the enzyme that catalyzes the oxidation of methylamine and other primary amines. MADH possesses an alpha2beta2 subunit structure; the alpha subunit is also referred to as the large subunit. Each beta (small) subunit contains a tryptophan tryptophylquinone (TTQ) prosthetic group. Accessory proteins are essential for the proper transport of MADH to the periplasm, TTQ synthesis and the formation of several structural disulfide bonds. Bacterial mutants containing an insertion on the mauD gene were unable to grow on methylamine as a sole carbon source, were found to lack the MADH small subunit and had decreased amounts of the MADH large subunit. Probab=99.34 E-value=1.8e-12 Score=93.02 Aligned_cols=71 Identities=30% Similarity=0.511 Sum_probs=55.7 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCC-CC-------------------CHHHHHHHCCCCCCEE Q ss_conf 899499998769970222134666654210001233322672-32-------------------6577776231568879 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI-EE-------------------SSEISTRYQISSIPTL 77 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~-d~-------------------~~~l~~~~~v~~~Pt~ 77 (107) .+|++++.|||+||++|++..|.++++++++++++.++-++. +. ..++...|+|+++|+. T Consensus 20 ~gk~vll~FwatwCP~Ck~emP~l~~~~~~~~~~~~vv~~sdg~~~~~~~f~~~~~l~~~p~~~~~e~~~ay~V~~lP~~ 99 (114) T cd02967 20 PGRPTLLFFLSPTCPVCKKLLPVIRSIARAEADWLDVVLASDGEKAEHQRFLKKHGLEAFPYVLSAELGMAYQVSKLPYA 99 (114) T ss_pred CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHCCCCCCCEEECHHHHHHCCCCCEEEE T ss_conf 99849999978988678777778999999717867999997899799999999759877879813778754445514359 Q ss_pred EEEE-CCEEEEE Q ss_conf 9997-9989858 Q gi|254780822|r 78 ILFK-DGKVIDR 88 (107) Q Consensus 78 ~~~~-~g~~~~~ 88 (107) +++. +|+...+ T Consensus 100 ~liD~~G~I~~k 111 (114) T cd02967 100 VLLDEAGVIAAK 111 (114) T ss_pred EEECCCCEEEEC T ss_conf 999899839955 No 61 >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Probab=99.30 E-value=5.9e-12 Score=90.01 Aligned_cols=95 Identities=21% Similarity=0.492 Sum_probs=73.6 Q ss_pred HHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHH---HHHHHCCCCCCCCCCCCCCC----HHHHHHHCCCCCCEEEEEE Q ss_conf 799999848-994999987699702221346666---54210001233322672326----5777762315688799997 Q gi|254780822|r 10 SFDSEVLEC-SNPVVVDFWASWCRPCVKLSPIID---DIADELADKVKITKLDIEES----SEISTRYQISSIPTLILFK 81 (107) Q Consensus 10 ~f~~~v~~~-~~~vlv~f~a~wC~~C~~~~p~~~---~l~~~~~~~i~~~~vd~d~~----~~l~~~~~v~~~Pt~~~~~ 81 (107) ..++.+-+. +|||+|+|||+||-.||.+++..- ++..+.. .++..+.|++++ .++-++||+-|+|++++|. T Consensus 464 ~L~~~la~~~~~pVmlDfyAdWCvtCK~~e~~tfsd~~v~~~~~-~~vlLqaDvT~~~p~~~~lLk~~~~~G~P~~~ff~ 542 (569) T COG4232 464 ELDQALAEAKAKPVMLDFYADWCVTCKENEKYTFSDPQVQQALQ-DVVLLQADVTANDPAITALLKRLGVFGVPTYLFFG 542 (569) T ss_pred HHHHHHHHCCCCCEEEEEEHHHHHHHHHHHHHCCCCHHHHHHCC-CEEEEEEEECCCCHHHHHHHHHCCCCCCCEEEEEC T ss_conf 99999985889967996224687876765563567599998537-86899853048998999999972887898799989 Q ss_pred -CCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf -9989858874899989999999841 Q gi|254780822|r 82 -DGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 82 -~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) +|++... ..|.++++.+.+++++. T Consensus 543 ~~g~e~~~-l~gf~~a~~~~~~l~~~ 567 (569) T COG4232 543 PQGSEPEI-LTGFLTADAFLEHLERA 567 (569) T ss_pred CCCCCCCC-CCCEECHHHHHHHHHHH T ss_conf 99987767-76600278999999873 No 62 >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions. It specifically binds G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane. This impedes the formation of a functional G protein trimer (G protein alphabetagamma), thereby inhibiting G protein-mediated signal transduction. Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain. Probab=99.23 E-value=8.6e-11 Score=83.29 Aligned_cols=102 Identities=20% Similarity=0.393 Sum_probs=85.0 Q ss_pred EEEEC-HHHHHHHHHHCC--CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 17757-677999998489--949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 3 ALKVD-TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~-~~~f~~~v~~~~--~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) +.+|+ .++|-..|-+.+ ..|+|.||.|.++.|+.|...|..||.+|+. ++|++|+.+... +...|.+.++||+++ T Consensus 64 v~ei~s~~~fl~~V~~~~~~~~VVVhiY~~~~~~C~~l~~~L~~LA~k~~~-vKF~ki~a~~~~-~~~~~~~~~lPtllv 141 (175) T cd02987 64 VYELDSGEQFLDAIDKEGKDTTVVVHIYEPGIPGCAALNSSLLCLAAEYPA-VKFCKIRASATG-ASDEFDTDALPALLV 141 (175) T ss_pred EEECCCHHHHHHHHHCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHCCC-EEEEEEECCCCC-CCCCCCCCCCCEEEE T ss_conf 897378889999985659983899999609996589999999999986893-289998616677-665577689998999 Q ss_pred EECCEEEEEEEC-----C-CCCHHHHHHHHHHC Q ss_conf 979989858874-----8-99989999999841 Q gi|254780822|r 80 FKDGKVIDRMMP-----G-ASSQSDIIEWILSR 106 (107) Q Consensus 80 ~~~g~~~~~~~~-----g-~~~~~~l~~~i~~~ 106 (107) |++|+.+..++. | ..+.+.|..|+.++ T Consensus 142 Yk~G~l~~~~v~~~~~~g~~f~~~dlE~~L~~~ 174 (175) T cd02987 142 YKGGELIGNFVRVTEDLGEDFDAEDLESFLVEY 174 (175) T ss_pred EECCEEEEEEEEHHHHCCCCCCHHHHHHHHHHC T ss_conf 989977886861777479979899999999964 No 63 >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily; InterPro: IPR004799 Periplasmic protein thiol:disulphide oxidoreductase is involved in the biogenesis of c-type cytochromes as well as in disulphide bond formation in some periplasmic proteins. This group defines the DsbE subfamily.; GO: 0015036 disulfide oxidoreductase activity, 0017004 cytochrome complex assembly, 0030288 outer membrane-bounded periplasmic space. Probab=99.22 E-value=1.2e-11 Score=88.18 Aligned_cols=90 Identities=22% Similarity=0.591 Sum_probs=70.5 Q ss_pred HHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-----------------------CHHHHH Q ss_conf 999998489949999876997022213466665421000123332267232-----------------------657777 Q gi|254780822|r 11 FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE-----------------------SSEIST 67 (107) Q Consensus 11 f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~-----------------------~~~l~~ 67 (107) .+.++..+++++||.|||+||++|+.-.|.|.++|+. |++.++-||--+ +-+++= T Consensus 56 ~~~~~~~qG~~~LlNVWAsWCp~CraEHp~L~eLak~--Grl~ivG~dYKD~~~~Al~~LkelGNPy~~~~~D~~G~~gl 133 (175) T TIGR00385 56 YTADIFRQGKPVLLNVWASWCPPCRAEHPYLNELAKE--GRLPIVGVDYKDQSQNALKFLKELGNPYQLILADPKGKLGL 133 (175) T ss_pred CCHHHHHCCCEEEEEEEECCCCCCHHCCHHHHHHHHC--CCCEEEEEECCCCCHHHHHHHHHCCCCEEEEEECCCCCEEE T ss_conf 3644530896069988403688831000578999753--97307886347884578888764489066888789984653 Q ss_pred HHCCCCCCEEEEE-ECCEEEEEEECCCCCHHHHHHHH Q ss_conf 6231568879999-79989858874899989999999 Q gi|254780822|r 68 RYQISSIPTLILF-KDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 68 ~~~v~~~Pt~~~~-~~g~~~~~~~~g~~~~~~l~~~i 103 (107) .+||.|.|=.+++ .+|...+| +.|..+.+...+-+ T Consensus 134 DlGV~GaPETflvdg~G~I~YR-haG~l~~~~w~~~l 169 (175) T TIGR00385 134 DLGVYGAPETFLVDGNGVILYR-HAGPLNKEVWTEEL 169 (175) T ss_pred ECCCCCCCCCEEECCCCEEEEE-ECCCCCCHHHHHHC T ss_conf 2266889854786798658777-43788601122212 No 64 >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases. Probab=99.21 E-value=1.8e-11 Score=87.16 Aligned_cols=73 Identities=32% Similarity=0.761 Sum_probs=60.5 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCC-----------------------CCHHHHHHHCCCC Q ss_conf 899499998769970222134666654210001-2333226723-----------------------2657777623156 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIE-----------------------ESSEISTRYQISS 73 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d-----------------------~~~~l~~~~~v~~ 73 (107) ++++++|.|||+||++|++..|.+.++.+++++ .+.++.|+.+ ...++.+.|++.+ T Consensus 18 ~gk~~vl~f~a~wC~~C~~~~~~l~~~~~~~~~~~v~vi~i~~~~~~~~~~~~~~~~~~~~~p~~~D~~~~~~~~~~v~~ 97 (116) T cd02966 18 KGKVVLVNFWASWCPPCRAEMPELEALAKEYKDDGVEVVGVNVDDDDPAAVKAFLKKYGITFPVLLDPDGELAKAYGVRG 97 (116) T ss_pred CCCEEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCCHHHHHCCCCC T ss_conf 99959999992789975453642023301344564138999788788899999887439833899869852899849980 Q ss_pred CCEEEEE-ECCEEEEEEE Q ss_conf 8879999-7998985887 Q gi|254780822|r 74 IPTLILF-KDGKVIDRMM 90 (107) Q Consensus 74 ~Pt~~~~-~~g~~~~~~~ 90 (107) +|+++++ ++|+.+.+.. T Consensus 98 ~P~~~iid~~G~i~~~~~ 115 (116) T cd02966 98 LPTTFLIDRDGRIRARHV 115 (116) T ss_pred CCEEEEECCCCEEEEEEE T ss_conf 457999999999999997 No 65 >KOG0913 consensus Probab=99.19 E-value=3.9e-12 Score=91.04 Aligned_cols=99 Identities=28% Similarity=0.617 Sum_probs=86.4 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 177576779999984899499998769970222134666654210001-2333226723265777762315688799997 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) ++.++++|+.. ++ ..-+++.|+||||+.|+...|+|+..+.--.| .+.+++||+..|+.|.-+|-|.++||+.-.+ T Consensus 26 ~~~~~eenw~~-~l--~gewmi~~~ap~~psc~~~~~~~~~~a~~s~dL~v~va~VDvt~npgLsGRF~vtaLptIYHvk 102 (248) T KOG0913 26 LTRIDEENWKE-LL--TGEWMIEFGAPWCPSCSDLIPHLENFATVSLDLGVKVAKVDVTTNPGLSGRFLVTALPTIYHVK 102 (248) T ss_pred EEEECCCCHHH-HH--CHHHHHHHCCCCCCCCCCHHHHHHCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEECCEEEEEE T ss_conf 57843544655-31--4188998557788530023899851577667875058888888456632246777423588850 Q ss_pred CCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 9989858874899989999999841 Q gi|254780822|r 82 DGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 82 ~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) +|+- |+|+|++++..++.|++.+ T Consensus 103 DGeF--rrysgaRdk~dfisf~~~r 125 (248) T KOG0913 103 DGEF--RRYSGARDKNDFISFEEHR 125 (248) T ss_pred CCCC--CCCCCCCCCHHHHHHHHHH T ss_conf 4553--1224765520478899866 No 66 >TIGR00411 redox_disulf_1 redox-active disulfide protein 1; InterPro: IPR004502 This group of proteins includes thioredoxins, glutaredoxins, protein-disulphide isomerases, and others, some of which have several such domains. The sequence of proteins in this group at the redox-active disufide site, CPYC, matches glutaredoxins rather than thioredoxins, although overall the sequence seems closer to thioredoxins. Proteins may be involved in a ribonucleotide-reducing system component distinct from thioredoxin or glutaredoxin.; GO: 0009055 electron carrier activity, 0015035 protein disulfide oxidoreductase activity, 0045454 cell redox homeostasis. Probab=99.14 E-value=9.8e-11 Score=82.98 Aligned_cols=79 Identities=28% Similarity=0.562 Sum_probs=72.8 Q ss_pred EEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 99876997022213466665421000123332267232657777623156887999979989858874899989999999 Q gi|254780822|r 24 VDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 24 v~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) =.|+||.||||=+-..+.+++++++++.+...+||++++++=|-.|||+++||+++ ||+. ++ -|..++++|.+.| T Consensus 4 ~lFTSPtCPyCP~A~~VV~~vakE~gd~~~v~~in~~e~~~kA~~yGi~aVPaivI--Ng~v--~f-~GaP~~eeL~eaI 78 (82) T TIGR00411 4 ELFTSPTCPYCPKAEKVVEEVAKEEGDLVEVEKINVMEDLKKALEYGIMAVPAIVI--NGKV--RF-VGAPDKEELVEAI 78 (82) T ss_pred EEECCCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHCCCCCCCEEEE--CCEE--EE-EEECCHHHHHHHH T ss_conf 55118876888543688988740589734322212454847887516352684787--7906--88-5308868999997 Q ss_pred HHCC Q ss_conf 8419 Q gi|254780822|r 104 LSRV 107 (107) Q Consensus 104 ~~~l 107 (107) ++.+ T Consensus 79 ~k~~ 82 (82) T TIGR00411 79 RKRL 82 (82) T ss_pred HHCC T ss_conf 6319 No 67 >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors. RdCVF was isolated and identified as a factor that supports cone survival in retinal cultures. Cone photoreceptor loss is responsible for the visual handicap resulting from the inherited disease, retinitis pigmentosa. RdCVF shows 33% similarity to TRX but does not exhibit any detectable thiol oxidoreductase activity. Probab=99.08 E-value=2.3e-10 Score=80.84 Aligned_cols=71 Identities=23% Similarity=0.447 Sum_probs=54.9 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC----------CCCCCCCCCCC---------CH--------------H Q ss_conf 899499998769970222134666654210001----------23332267232---------65--------------7 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD----------KVKITKLDIEE---------SS--------------E 64 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~----------~i~~~~vd~d~---------~~--------------~ 64 (107) .+|.+.++|.|.|||||+.+.|.|.++.+++++ .|.|+.-|-++ -| + T Consensus 24 ~GKvVgLYFSA~WCpPCr~FTP~L~~fY~~l~~~~~~~~~~~fEIVfVS~Drse~~f~~y~~~MP~~WlAlPf~d~~~~~ 103 (146) T cd03008 24 ENRVLLLFFGAVVSPQCQLFAPKLKDFFVRLTDEFYVDRSAQLALVYVSMDQSEQQQESFLKDMPKKWLFLPFEDEFRRE 103 (146) T ss_pred CCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHCCCCEEECCCCCHHHHH T ss_conf 89999999747868148767789999999998765440378779999836899999999999779872665769689999 Q ss_pred HHHHHCCCCCCEEEEEE-CCEEEEE Q ss_conf 77762315688799997-9989858 Q gi|254780822|r 65 ISTRYQISSIPTLILFK-DGKVIDR 88 (107) Q Consensus 65 l~~~~~v~~~Pt~~~~~-~g~~~~~ 88 (107) |.++|+|+++||++++. +|+.+.+ T Consensus 104 L~~~f~V~gIPtLVil~~dG~vit~ 128 (146) T cd03008 104 LEAQFSVEELPTVVVLKPDGDVLAA 128 (146) T ss_pred HHHHCCCCCCCEEEEECCCCCEECH T ss_conf 9998599878889999899989737 No 68 >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. Probab=99.08 E-value=2.8e-10 Score=80.31 Aligned_cols=73 Identities=25% Similarity=0.497 Sum_probs=60.2 Q ss_pred HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCC-----------------------------CCCHHH Q ss_conf 848994999987699702221346666542100012-33322672-----------------------------326577 Q gi|254780822|r 16 LECSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDI-----------------------------EESSEI 65 (107) Q Consensus 16 ~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~-----------------------------d~~~~l 65 (107) +..++++++.||++|||+|+...|.+..+.++|.++ +.|+.||. |...++ T Consensus 22 ~~~~k~vvl~F~~~~CP~c~~~~p~l~~l~~~~~~~gv~~lgVn~~~~~~~~~ds~~~~~~~~~~~~~~fPvL~D~~g~v 101 (171) T cd02969 22 FADGKALVVMFICNHCPYVKAIEDRLNRLAKEYGAKGVAVVAINSNDIEAYPEDSPENMKAKAKEHGYPFPYLLDETQEV 101 (171) T ss_pred HCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCHH T ss_conf 77999899999589991788888765567767634782899996687443755699999999987023717999589749 Q ss_pred HHHHCCCCCCEEEEEE-CCEEEEE Q ss_conf 7762315688799997-9989858 Q gi|254780822|r 66 STRYQISSIPTLILFK-DGKVIDR 88 (107) Q Consensus 66 ~~~~~v~~~Pt~~~~~-~g~~~~~ 88 (107) ++.|++..+|+.+++. +|+.++| T Consensus 102 a~~yg~~~tP~~fvID~~G~i~Yr 125 (171) T cd02969 102 AKAYGAACTPDFFLFDPDGKLVYR 125 (171) T ss_pred HHHCCCCCCCEEEEECCCCEEEEE T ss_conf 997499648807998899989986 No 69 >KOG0914 consensus Probab=99.06 E-value=1.1e-10 Score=82.65 Aligned_cols=83 Identities=28% Similarity=0.610 Sum_probs=70.7 Q ss_pred CHHHHHHHH-HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCC------CCCEEE Q ss_conf 767799999-84899499998769970222134666654210001-2333226723265777762315------688799 Q gi|254780822|r 7 DTKSFDSEV-LECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQIS------SIPTLI 78 (107) Q Consensus 7 ~~~~f~~~v-~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~------~~Pt~~ 78 (107) +.+.+++++ -+..+.|+|.|||.|.+.|...+|++.+++-+|.. .++|++||+-..++.+++|+|+ .+||++ T Consensus 131 ~~q~~deel~rnk~t~WlIeFfa~ws~~Cv~~spvfaeLS~kyn~~~lkFGkvDiGrfpd~a~kfris~s~~srQLPT~i 210 (265) T KOG0914 131 NMQLEDEELDRNKRTYWLIEFFACWSPKCVRFSPVFAELSIKYNNNLLKFGKVDIGRFPDVAAKFRISLSPGSRQLPTYI 210 (265) T ss_pred CHHHHHHHHCCCCCEEEEEEEEEECCHHHCCCCCCCHHHHHHHCCCCCCCCCEEECCCCCHHHHEEECCCCCCCCCCEEE T ss_conf 52467888616873499999874068523015644077787727887751203204575757752424685322488689 Q ss_pred EEECCEEEEEE Q ss_conf 99799898588 Q gi|254780822|r 79 LFKDGKVIDRM 89 (107) Q Consensus 79 ~~~~g~~~~~~ 89 (107) +|.+|+++.|+ T Consensus 211 lFq~gkE~~Rr 221 (265) T KOG0914 211 LFQKGKEVSRR 221 (265) T ss_pred EECCCHHHHCC T ss_conf 97166012017 No 70 >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain. Denaturation studies indicate that the reduced form is more stable than the oxidized form, suggesting that the protein is involved in disulfide bond formation. In vitro, ERp19 has been shown to possess thiol-disulfide oxidase activity which is dependent on the presence of both active site cysteines. Although described as protein disulfide isomerase (PDI)-like, the protein does not complement for PDI activity. ERp19 shows a wide tissue distribution but is most abundant in liver, testis, heart and kidney. Probab=98.92 E-value=1e-09 Score=77.14 Aligned_cols=79 Identities=18% Similarity=0.516 Sum_probs=56.1 Q ss_pred HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHH--HCCCCCCCCCCCCCCCHHHHHHHCCCC--CCEEEEEE-CC Q ss_conf 77999998489949999876997022213466665421--000123332267232657777623156--88799997-99 Q gi|254780822|r 9 KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIAD--ELADKVKITKLDIEESSEISTRYQISS--IPTLILFK-DG 83 (107) Q Consensus 9 ~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~--~~~~~i~~~~vd~d~~~~l~~~~~v~~--~Pt~~~~~-~g 83 (107) +-+++ ..+++||++|.||++||++|+.|+|.+.+-.+ ++..++..+.|+-|+.++ ...|.+-| +|.++|+. +| T Consensus 10 eal~~-Ak~~~KPiml~~~~~wC~~Ck~mk~~f~e~~ei~~ls~~FVminvd~deep~-~~~~~~DG~YvPri~FlD~~g 87 (117) T cd02959 10 DGIKE-AKDSGKPLMLLIHKTWCGACKALKPKFAESKEISELSHNFVMVNLEDDEEPK-DEEFSPDGGYIPRILFLDPSG 87 (117) T ss_pred HHHHH-HHHHCCCEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHCCEEEECCCCCCCC-CCCCCCCCCCCCEEEEECCCC T ss_conf 99999-9984999999973211767999999986199999997565798636777775-200265787132289989999 Q ss_pred EEEEEE Q ss_conf 898588 Q gi|254780822|r 84 KVIDRM 89 (107) Q Consensus 84 ~~~~~~ 89 (107) +..... T Consensus 88 ~v~~di 93 (117) T cd02959 88 DVHPEI 93 (117) T ss_pred CCCHHH T ss_conf 782433 No 71 >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent; InterPro: IPR004508 This enzyme, involved in the assimilation of inorganic sulphate, is closely related to the thioredoxin-dependent PAPS reductase of Bacteria (CysH) and Saccharomyces cerevisiae. However, it has its own C-terminal thioredoxin-like domain and is not thioredoxin-dependent. Also, it has a substrate preference for 5'-adenylylsulphate (APS) over 3'-phosphoadenylylsulphate (PAPS) so the pathway does not require an APS kinase (CysC) to convert APS to PAPS. Arabidopsis thaliana appears to have three isozymes, all able to complement Escherichia coli CysH mutants (even in backgrounds lacking thioredoxin or APS kinase) but likely localized to different compartments in Arabidopsis.; GO: 0016671 oxidoreductase activity acting on sulfur group of donors disulfide as acceptor, 0019421 sulfate reduction APS pathway. Probab=98.89 E-value=6.1e-09 Score=72.65 Aligned_cols=103 Identities=19% Similarity=0.410 Sum_probs=74.0 Q ss_pred EEEECHHHHHHHH--HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCC-HHHH-HHHCCCCCCEE Q ss_conf 1775767799999--84899499998769970222134666654210001-233322672326-5777-76231568879 Q gi|254780822|r 3 ALKVDTKSFDSEV--LECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD-KVKITKLDIEES-SEIS-TRYQISSIPTL 77 (107) Q Consensus 3 ~i~i~~~~f~~~v--~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~-~~l~-~~~~v~~~Pt~ 77 (107) ++.++....++++ -....+|+|..|||||+.|+.|...+.+++.++.+ ..++++...|-+ ++.+ +.++..++||+ T Consensus 359 ~~~lsr~G~enllkle~r~e~W~vvlyaPWC~fCqame~sy~ela~klaG~G~kv~kf~adG~qk~fa~qelql~s~Pti 438 (469) T TIGR00424 359 VVALSRQGIENLLKLEERKEAWLVVLYAPWCPFCQAMEASYVELAEKLAGSGVKVAKFRADGDQKEFAKQELQLGSFPTI 438 (469) T ss_pred EEEHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCCCEE T ss_conf 11010444788886530567358998156103577765669999998537983233220462267888775422576638 Q ss_pred EEEECCEEEEEEEC-CCCCHHHHHHHHHH Q ss_conf 99979989858874-89998999999984 Q gi|254780822|r 78 ILFKDGKVIDRMMP-GASSQSDIIEWILS 105 (107) Q Consensus 78 ~~~~~g~~~~~~~~-g~~~~~~l~~~i~~ 105 (107) ++|......+-.|. ..++.+.|..|++- T Consensus 439 l~fPk~~~~~ikyPse~rdv~sl~~f~n~ 467 (469) T TIGR00424 439 LLFPKRSSRPIKYPSEKRDVDSLMSFVNL 467 (469) T ss_pred EEECCCCCCCCCCCCCHHHHHHHHHHHHH T ss_conf 88026677654487200117899999986 No 72 >KOG1672 consensus Probab=98.89 E-value=3e-09 Score=74.43 Aligned_cols=88 Identities=27% Similarity=0.445 Sum_probs=76.8 Q ss_pred EEEE-CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 1775-767799999848994999987699702221346666542100012333226723265777762315688799997 Q gi|254780822|r 3 ALKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 3 ~i~i-~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) .-+| +..+|-+.+.. +.-|++.||-|.-..|+-|...++.+|+.+-+ .+|++||++..|-++.+++|.-+|++.+|+ T Consensus 68 y~ev~~Ekdf~~~~~k-S~kVVcHFY~~~f~RCKimDkhLe~LAk~h~e-TrFikvnae~~PFlv~kL~IkVLP~v~l~k 145 (211) T KOG1672 68 YEEVASEKDFFEEVKK-SEKVVCHFYRPEFFRCKIMDKHLEILAKRHVE-TRFIKVNAEKAPFLVTKLNIKVLPTVALFK 145 (211) T ss_pred EEEECCHHHHHHHHHC-CCEEEEEEECCCCCCEEHHHHHHHHHHHHCCC-CEEEEEECCCCCEEEEEEEEEEEEEEEEEE T ss_conf 7970558889998625-76289999738775202288899998774556-348997332486223242006720689997 Q ss_pred CCEEEEEEECCC Q ss_conf 998985887489 Q gi|254780822|r 82 DGKVIDRMMPGA 93 (107) Q Consensus 82 ~g~~~~~~~~g~ 93 (107) +|+.+.+.+ |. T Consensus 146 ~g~~~D~iV-GF 156 (211) T KOG1672 146 NGKTVDYVV-GF 156 (211) T ss_pred CCEEEEEEE-EH T ss_conf 577789996-17 No 73 >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis. It was identified as an IAP binding protein through a screen of a human B-cell library using a prototype IAP. VIAF lacks a consensus IAP binding motif and while it does not function as an IAP antagonist, it still plays a regulatory role in the complete activation of caspases. VIAF itself is a substrate for IAP-mediated ubiquitination, suggesting that it may be a target of IAPs in the prevention of cell death. The similarity of VIAF to Phd points to a potential role distinct from apoptosis regulation. Phd functions as a cytosolic regulator of G protein by specifically binding to G protein betagamma (Gbg)-subunits. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain. Probab=98.89 E-value=9.9e-09 Score=71.42 Aligned_cols=100 Identities=19% Similarity=0.411 Sum_probs=83.3 Q ss_pred CEEEECHHHHHHHHHHCC--CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 517757677999998489--949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 2 SALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~--~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) .+.+|+.++|-+.|.+.+ -.|+|.+|.+..+.|+.+...|..+|.+|+. ++|+++-.++. ...|.-+++||+++ T Consensus 83 ~V~eIs~~dy~~eVt~ask~~~VVvhly~~~~~~C~~ln~~l~~LA~kyp~-vKF~ki~s~~~---i~nypd~nlPtllv 158 (192) T cd02988 83 EVYEISKPDYVREVTEASKDTWVVVHLYKDGIPLCRLLNQHLSELARKFPD-TKFVKIISTQC---IPNYPDKNLPTILV 158 (192) T ss_pred EEEECCHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCC-EEEEEEEHHHC---CCCCCCCCCCEEEE T ss_conf 179726789999998457983899999549973699999999999986797-07999871111---65897037987999 Q ss_pred EECCEEEEEEEC-----C-CCCHHHHHHHHHH Q ss_conf 979989858874-----8-9998999999984 Q gi|254780822|r 80 FKDGKVIDRMMP-----G-ASSQSDIIEWILS 105 (107) Q Consensus 80 ~~~g~~~~~~~~-----g-~~~~~~l~~~i~~ 105 (107) |++|+.+..+++ | ..+.+.+..++.+ T Consensus 159 Yk~G~~~~q~vgl~~~gG~~~~~~dlE~~L~~ 190 (192) T cd02988 159 YRNGDIVKQFIGLLEFGGMNTTMEDLEWLLVQ 190 (192) T ss_pred EECCCHHHHEECHHHHCCCCCCHHHHHHHHHH T ss_conf 84882344242288728986889999999986 No 74 >pfam00578 AhpC-TSA AhpC/TSA family. This family contains proteins related to alkyl hydroperoxide reductase (AhpC) and thiol specific antioxidant (TSA). Probab=98.88 E-value=4e-09 Score=73.68 Aligned_cols=69 Identities=20% Similarity=0.432 Sum_probs=56.8 Q ss_pred CCCCEEEEEECC-CCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCC---------------------CCHHHHHHHCCC-- Q ss_conf 899499998769-9702221346666542100012-333226723---------------------265777762315-- Q gi|254780822|r 18 CSNPVVVDFWAS-WCRPCVKLSPIIDDIADELADK-VKITKLDIE---------------------ESSEISTRYQIS-- 72 (107) Q Consensus 18 ~~~~vlv~f~a~-wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d---------------------~~~~l~~~~~v~-- 72 (107) .+++++|.||+. ||++|+...|.+.++.++|.++ +.++.|+.| .+.+++++|||. T Consensus 24 ~gk~~vl~f~~~~wC~~C~~~~~~l~~~~~~~~~~~~~vv~is~d~~~~~~~~~~~~~~~~~~l~D~~~~~~~~~gv~~~ 103 (124) T pfam00578 24 KGKWVVLFFYPKDFTPVCTTELPALADLYEEFKKLGVEVLGVSVDSPESHKKFAEKLGLPFPLLSDPDGEVARAYGVLNE 103 (124) T ss_pred CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHCCCCCC T ss_conf 99919999988999927299999998744323135874667858999999999998599947999597499998599846 Q ss_pred ----CCCEEEEEE-CCEEE Q ss_conf ----688799997-99898 Q gi|254780822|r 73 ----SIPTLILFK-DGKVI 86 (107) Q Consensus 73 ----~~Pt~~~~~-~g~~~ 86 (107) ++|+.+++. +|+.. T Consensus 104 ~~~~~~P~~~lID~~G~I~ 122 (124) T pfam00578 104 EAGGALRTTFVIDPDGKIR 122 (124) T ss_pred CCCCEEEEEEEECCCCEEE T ss_conf 6798824899998999798 No 75 >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle. It stores calcium ions in sufficient quantities (up to 20 mM) to allow repetitive contractions and is essential to maintain movement, respiration and heart beat. A missense mutation in human cardiac calsequestrin is associated with catecholamine-induced polymorphic ventricular tachycardia (CPVT), a rare disease characterized by seizures or sudden death in response to physiologic or emotional stress. Calsequestrin is a highly acidic protein with up to 50 calcium binding sites formed simply by the clustering of two or more acidic residues. The monomer contains three redox inactive TRX-fold domains. Calsequestrin is condensed as a linear polymer in the SR lumen and is membrane-anchored through binding with intra-membrane proteins triadin, junctin and ryanodine receptor (RyR) Ca2 Probab=98.87 E-value=1.7e-08 Score=70.06 Aligned_cols=101 Identities=13% Similarity=0.289 Sum_probs=81.3 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHH-----HHHHHH-CCC-CCCCCCCCCCCCHHHHHHHCCCCCC Q ss_conf 177576779999984899499998769970222134666-----654210-001-2333226723265777762315688 Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPII-----DDIADE-LAD-KVKITKLDIEESSEISTRYQISSIP 75 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~-----~~l~~~-~~~-~i~~~~vd~d~~~~l~~~~~v~~~P 75 (107) +++||..||.+.+ ...+...|.|+.|||++|....+.- -+|+.+ +.+ .+.|+.||..+...++++.+....+ T Consensus 11 V~~L~~kNfk~~~-Kk~d~l~l~f~~p~~s~~~~qkq~~~~e~~LELaAQVle~k~igfg~VD~~kd~~lAkKlg~~e~g 89 (120) T cd03065 11 VIDLNEKNYKQVL-KKYDVLCLLYHEPVESDKEAQKQFQMEELVLELAAQVLEDKGIGFGLVDSKKDAKVAKKLGLDEED 89 (120) T ss_pred EEECCHHHHHHHH-HHHCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHCCCCCC T ss_conf 3564335399998-664179999964885246577688899999999998723418766986018888999984757676 Q ss_pred EEEEEECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 7999979989858874899989999999841 Q gi|254780822|r 76 TLILFKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 76 t~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) ++.+|++|+.+. |.|.++++.|.+|+..- T Consensus 90 siyvfk~~~~IE--ydG~~sadtLVeFL~dl 118 (120) T cd03065 90 SIYVFKDDEVIE--YDGEFAADTLVEFLLDL 118 (120) T ss_pred EEEEEECCCEEE--ECCEECHHHHHHHHHHH T ss_conf 289986893886--64713758999999986 No 76 >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Probab=98.87 E-value=1.2e-08 Score=71.05 Aligned_cols=85 Identities=36% Similarity=0.893 Sum_probs=72.2 Q ss_pred CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-CCHHHHHHHC--CCCCCEEEEEECCEEEEEEECC--C Q ss_conf 994999987699702221346666542100012333226723-2657777623--1568879999799898588748--9 Q gi|254780822|r 19 SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE-ESSEISTRYQ--ISSIPTLILFKDGKVIDRMMPG--A 93 (107) Q Consensus 19 ~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d-~~~~l~~~~~--v~~~Pt~~~~~~g~~~~~~~~g--~ 93 (107) ++++++.||++||++|+.+.|.+.++++++...+.+..+|.. ..+++...|+ +..+|+++++.+|..+.+. .+ . T Consensus 32 ~~~~~~~f~~~~C~~C~~~~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~-~~~~~ 110 (127) T COG0526 32 GKPVLVDFWAPWCPPCRAEAPLLEELAEEYGGDVEVVAVNVDDENPDLAAEFGVAVRSIPTLLLFKDGKEVDRL-VGGKV 110 (127) T ss_pred CCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCCCEEEEEECCCCEEEE-ECCCC T ss_conf 87199995389994299999999999987166836999968750778999965025467628998767000566-12556 Q ss_pred CCHHHHHHHHH Q ss_conf 99899999998 Q gi|254780822|r 94 SSQSDIIEWIL 104 (107) Q Consensus 94 ~~~~~l~~~i~ 104 (107) .+...+..... T Consensus 111 ~~~~~~~~~~~ 121 (127) T COG0526 111 LPKEALIDALG 121 (127) T ss_pred CCHHHHHHHHH T ss_conf 98999999763 No 77 >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Probab=98.83 E-value=1.7e-08 Score=70.13 Aligned_cols=91 Identities=18% Similarity=0.391 Sum_probs=71.3 Q ss_pred HHHHHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCC----------------CHHHHHHHCCCC Q ss_conf 99984899499998769970222134666---65421000123332267232----------------657777623156 Q gi|254780822|r 13 SEVLECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEE----------------SSEISTRYQISS 73 (107) Q Consensus 13 ~~v~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~----------------~~~l~~~~~v~~ 73 (107) +.+...++..+++|-++.|++|.++...+ ..+.+.+.+.+.++.+|+.. .++|++.|+|++ T Consensus 36 ksi~~~~Kylllmfes~~C~yC~~fKKd~~~~krlrEylk~hf~~~~l~i~~skpv~f~~g~kee~~s~~ELa~kf~vrs 115 (182) T COG2143 36 KSISPNDKYLLLMFESNGCSYCERFKKDLKNVKRLREYLKEHFSAYYLNISYSKPVLFKVGDKEEKMSTEELAQKFAVRS 115 (182) T ss_pred HHCCCCCCEEEEEECCCCCHHHHHHHHHHCCHHHHHHHHHHCEEEEEEEECCCCCEEEECCCEEEEECHHHHHHHHCCCC T ss_conf 74595675899997589970799998862463879999762758999983157626741276545543999998735556 Q ss_pred CCEEEEEE-CCEEEEEEECCCCCHHHHHHHHH Q ss_conf 88799997-99898588748999899999998 Q gi|254780822|r 74 IPTLILFK-DGKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 74 ~Pt~~~~~-~g~~~~~~~~g~~~~~~l~~~i~ 104 (107) +||+++|+ +|+.+.. ..|.++++++...++ T Consensus 116 tPtfvFfdk~Gk~Il~-lPGY~ppe~Fl~vlk 146 (182) T COG2143 116 TPTFVFFDKTGKTILE-LPGYMPPEQFLAVLK 146 (182) T ss_pred CCEEEEECCCCCEEEE-CCCCCCHHHHHHHHH T ss_conf 8659998588977986-478789899999999 No 78 >pfam08534 Redoxin Redoxin. This family of redoxins includes peroxiredoxin, thioredoxin and glutaredoxin proteins. Probab=98.80 E-value=1.8e-08 Score=69.94 Aligned_cols=77 Identities=22% Similarity=0.568 Sum_probs=60.2 Q ss_pred CCCCEEEEEECC-CCHHHHHHHHHHHHHHHHCCCC-CCCCCCCC----------------------CCCHHHHHHHCCC- Q ss_conf 899499998769-9702221346666542100012-33322672----------------------3265777762315- Q gi|254780822|r 18 CSNPVVVDFWAS-WCRPCVKLSPIIDDIADELADK-VKITKLDI----------------------EESSEISTRYQIS- 72 (107) Q Consensus 18 ~~~~vlv~f~a~-wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~----------------------d~~~~l~~~~~v~- 72 (107) .+++++|.||+. ||++|+...|.++++.+++.++ +.++.|+. |.+.+++++||+. T Consensus 26 ~Gk~vvl~f~~~~wCp~C~~e~~~l~~~~~~~~~~~~~iv~I~~~~~~~~~~~~~~~~~~~fp~l~D~~~~~~~~~gv~~ 105 (142) T pfam08534 26 KGKKVVLNFWPGAFCPTCSAEHPYLEKLSKLYKAKGVDVVAVNASNDPFFVMNFWAKEGLKYPVLADGDGAFTKAYGLTE 105 (142) T ss_pred CCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHCCCCEEEECCCHHHHHHCCCCC T ss_conf 99969999978988926456356566778874165338998833760788999999869970799869649999829974 Q ss_pred ----CCCEEEEEE-CCEEEEEEECCCCC Q ss_conf ----688799997-99898588748999 Q gi|254780822|r 73 ----SIPTLILFK-DGKVIDRMMPGASS 95 (107) Q Consensus 73 ----~~Pt~~~~~-~g~~~~~~~~g~~~ 95 (107) ++|+.+++. +|+.+.+.. |..+ T Consensus 106 ~~~~~~p~~~lId~~G~I~~~~~-g~~~ 132 (142) T pfam08534 106 DAGLRTPRYFLIDEDGKVVYLEV-GPDP 132 (142) T ss_pred CCCCEEEEEEEECCCCEEEEEEE-CCCC T ss_conf 46630768999927997999997-7998 No 79 >KOG0911 consensus Probab=98.79 E-value=2.5e-09 Score=74.84 Aligned_cols=94 Identities=24% Similarity=0.467 Sum_probs=80.8 Q ss_pred CCEEEECH-HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 95177576-77999998489949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 1 MSALKVDT-KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 1 M~~i~i~~-~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) |++.++.. +.| ...+.+..++.||++||.+|++|..+++.+++.. .++.+++++.++.++++..+.+.+.|++.+ T Consensus 1 ~~v~~i~~~~~f---~~~~~~~~~~~f~a~wa~~~~q~~~v~~~~~~~~-~~~~~~k~~a~~~~eis~~~~v~~vp~~~~ 76 (227) T KOG0911 1 MTVQFIVFQEQF---LDQKGKLLVLHFWAIWAVVQKQMDQVFDHLAEYF-KNAQFLKLEAEEFPEISNLIAVEAVPYFVF 76 (227) T ss_pred CCCEEEHHHHHH---HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHEEEHHHHHHHHHHHHHHHHCCCCEEE T ss_conf 973450248999---9823214435333056506646999999987775-532301002544568998888734651023 Q ss_pred EECCEEEEEEECCCCCHHHH Q ss_conf 97998985887489998999 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDI 99 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l 99 (107) +..|+.+.+. .|..+.... T Consensus 77 ~~~~~~v~~l-~~~~~~~~~ 95 (227) T KOG0911 77 FFLGEKVDRL-SGADPPFLV 95 (227) T ss_pred ECCCHHHHHH-HCCCCHHHH T ss_conf 3044667776-236867676 No 80 >cd02958 UAS UAS family; UAS is a domain of unknown function. Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP), Probab=98.78 E-value=5.1e-08 Score=67.33 Aligned_cols=90 Identities=11% Similarity=0.218 Sum_probs=72.4 Q ss_pred HHHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCC--CHHHHHHHCCCCCCEEEEEE--CCEEEE Q ss_conf 984899499998769970222134666---65421000123332267232--65777762315688799997--998985 Q gi|254780822|r 15 VLECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEE--SSEISTRYQISSIPTLILFK--DGKVID 87 (107) Q Consensus 15 v~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~--~~~l~~~~~v~~~Pt~~~~~--~g~~~~ 87 (107) ....+|+++|+++++||.+|+.+...+ +.+.+-.+++..+..+|++. ...++..|++.++|++.++. .|+.+. T Consensus 13 Ak~~~K~llVyl~~~~~~~~~~~~r~v~~~~~V~~~i~~~fV~w~~d~~~~eg~~~~~~y~~~~~P~i~iidp~tge~v~ 92 (114) T cd02958 13 AKSEKKWLLVYLQSEDEFDSQVLNRDLWSNESVKEFIRENFIFWQCDIDSSEGQRFLQSYKVDKYPHIAIIDPRTGEVLK 92 (114) T ss_pred HHHHCCEEEEEEECCCCCCHHHHHHHHCCCHHHHHHHHHHEEEEEEECCCHHHHHHHHHCCCCCCCEEEEEECCCCCEEE T ss_conf 99719889999846997438999998458889999997116898631698579999986699998979999789995998 Q ss_pred EEECCCCCHHHHHHHHHH Q ss_conf 887489998999999984 Q gi|254780822|r 88 RMMPGASSQSDIIEWILS 105 (107) Q Consensus 88 ~~~~g~~~~~~l~~~i~~ 105 (107) +. .|..+++++.+.+.+ T Consensus 93 ~~-~G~~~p~~~l~~L~~ 109 (114) T cd02958 93 VW-SGNITPEDLLSQLIE 109 (114) T ss_pred EE-ECCCCHHHHHHHHHH T ss_conf 98-689998999999999 No 81 >KOG2501 consensus Probab=98.64 E-value=2.6e-08 Score=69.06 Aligned_cols=71 Identities=35% Similarity=0.737 Sum_probs=55.4 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-----CCCCCCCCCC-----------------------CHHHHHHH Q ss_conf 8994999987699702221346666542100012-----3332267232-----------------------65777762 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-----VKITKLDIEE-----------------------SSEISTRY 69 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-----i~~~~vd~d~-----------------------~~~l~~~~ 69 (107) .+|.+.++|.|.||+||+.+-|.+.++.++..++ +.|+.-|-+. -.+++++| T Consensus 32 ~gKvV~lyFsA~wC~pCR~FTP~Lk~fYe~l~~~~~~fEVvfVS~D~~~~~~~~y~~~~~~~W~~iPf~d~~~~~l~~ky 111 (157) T KOG2501 32 QGKVVGLYFSAHWCPPCRDFTPILKDFYEELKDNAAPFEVVFVSSDRDEESLDEYMLEHHGDWLAIPFGDDLIQKLSEKY 111 (157) T ss_pred CCCEEEEEEEEEECCCHHHCCCHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHC T ss_conf 78689999887877835648866899999997368966999995688778999999963998688428987999878761 Q ss_pred CCCCCCEEEEEE-CCEEEEE Q ss_conf 315688799997-9989858 Q gi|254780822|r 70 QISSIPTLILFK-DGKVIDR 88 (107) Q Consensus 70 ~v~~~Pt~~~~~-~g~~~~~ 88 (107) +|.++|++.+.+ +|..+.+ T Consensus 112 ~v~~iP~l~i~~~dG~~v~~ 131 (157) T KOG2501 112 EVKGIPALVILKPDGTVVTE 131 (157) T ss_pred CCCCCCEEEEECCCCCEEHH T ss_conf 66767536786599878657 No 82 >PRK13703 conjugal pilus assembly protein TraF; Provisional Probab=98.63 E-value=1.5e-07 Score=64.55 Aligned_cols=86 Identities=17% Similarity=0.167 Sum_probs=68.6 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC---------CHHHHHHHCCCCCCEEEEEE--CCEEE Q ss_conf 89949999876997022213466665421000123332267232---------65777762315688799997--99898 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE---------SSEISTRYQISSIPTLILFK--DGKVI 86 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~---------~~~l~~~~~v~~~Pt~~~~~--~g~~~ 86 (107) +++.-|++||...|++|.++.|++..+++.|+=.+..+.+|.-- +...++++||..+|+++++. .|+.. T Consensus 141 a~~~GLffFy~~~c~~c~~~apil~~fa~~yg~~vi~VS~DG~~~p~fp~~r~d~Gqa~~l~V~~~PAL~Lv~p~t~~~~ 220 (247) T PRK13703 141 AEHYGLMFFYRGQDPIDGQLAQVINGFRKTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPALMLVDPKSGSVR 220 (247) T ss_pred HHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEEEECCCCCEE T ss_conf 87123899986898046998999999999859779998338986877787777867897369841656999988999288 Q ss_pred EEEECCCCCHHHHHHHHH Q ss_conf 588748999899999998 Q gi|254780822|r 87 DRMMPGASSQSDIIEWIL 104 (107) Q Consensus 87 ~~~~~g~~~~~~l~~~i~ 104 (107) +-- .|.++.++|.+-|. T Consensus 221 Pva-~G~iS~deL~~Ri~ 237 (247) T PRK13703 221 PLS-YGFITQDDLAKRFL 237 (247) T ss_pred EEE-ECCCCHHHHHHHHH T ss_conf 773-11277999999999 No 83 >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti. It contains a CXXC motif, assumed to be imbedded in a DsbA-like structure. Its homology to DsbA suggests that the protein is a protein disulfide oxidoreductase. The role of such a protein in pathogenesis is unknown. Probab=98.58 E-value=2.3e-07 Score=63.61 Aligned_cols=80 Identities=24% Similarity=0.490 Sum_probs=60.0 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCC-------------------------------------- Q ss_conf 899499998769970222134666654210001233322672-------------------------------------- Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI-------------------------------------- 59 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~-------------------------------------- 59 (107) +.+..++.|....||+|+++.|.++++.+++++ +.+...+. T Consensus 4 ~A~v~ivef~d~~Cp~C~~~~~~l~~~~~~~~~-v~~~~~~~P~~~~~~~~aa~~~~~~~~~~~~~f~~~~~~l~~~~~~ 82 (154) T cd03023 4 NGDVTIVEFFDYNCGYCKKLAPELEKLLKEDPD-VRVVFKEFPILGESSVLAARVALAVWKNGPGKYLEFHNALMATRGR 82 (154) T ss_pred CCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCC-CEEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCC T ss_conf 999999998899986378888999999985887-0488550642564639999999999986812599999999983642 Q ss_pred ---------------------------------CCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHH Q ss_conf ---------------------------------326577776231568879999799898588748999899999998 Q gi|254780822|r 60 ---------------------------------EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 60 ---------------------------------d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~ 104 (107) .++.++++++||+|+||+++ ||+. +.|..+.+.|.+.|+ T Consensus 83 ~~~~~l~~~a~~~gld~~~f~~~~~s~~~~~~v~~~~~~a~~~gI~gTPt~~I--ng~~----~~G~~~~~~l~~~ie 154 (154) T cd03023 83 LNEESLLRIAKKAGLDEAKLKKDMDDPEIEATIDKNRQLARALGITGTPAFII--GDTV----IPGAVPADTLKEAID 154 (154) T ss_pred CHHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCEEEE--CCEE----ECCCCCHHHHHHHHC T ss_conf 03899999999839988999988658889999999899999859978998989--9999----438899999999759 No 84 >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain. Probab=98.58 E-value=2.3e-07 Score=63.54 Aligned_cols=85 Identities=22% Similarity=0.579 Sum_probs=61.1 Q ss_pred HCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCC------------------------------------- Q ss_conf 4899499998769970222134666654210001233322672------------------------------------- Q gi|254780822|r 17 ECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI------------------------------------- 59 (107) Q Consensus 17 ~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~------------------------------------- 59 (107) ...+..+|.|++..||+|+.+.+.+.++.+++++++.|..+.+ T Consensus 13 p~a~vtIvEf~dy~Cp~C~~~~~~l~~~~~~~~~~v~f~~~pv~~~~~~~~~~A~~~~~a~~~~~~~~~~~~~F~~~~~~ 92 (178) T cd03019 13 PSGKPEVIEFFSYGCPHCYNFEPILEAWVKKLPKDVKFEKVPVVFGGGEGEPLARAFYAAEALGLEDKLHAALFEAIHEK 92 (178) T ss_pred CCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH T ss_conf 99996799998888861688828999999847997599998556788358999999999998494878899999999985 Q ss_pred -------------------------------------CCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHH Q ss_conf -------------------------------------3265777762315688799997998985887489998999999 Q gi|254780822|r 60 -------------------------------------EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEW 102 (107) Q Consensus 60 -------------------------------------d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~ 102 (107) +++.++++.++|+|+||+++ ||+-+- ..+..+.+++.+. T Consensus 93 ~~~~~~~~~l~~~a~~~Gld~~~f~~~~~s~~~~~~i~~~~~~a~~~gI~gTPtfiI--NGKy~i--~~~~~~~~~~~~~ 168 (178) T cd03019 93 RKRLLDPDDIRKIFLSQGVDKKKFDAAYNSFSVKALVAKAEKLAKKYKITGVPAFVV--NGKYVV--NPSAIGGDDTLQV 168 (178) T ss_pred HCCCCCHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEE--CCEEEE--CCCCCCHHHHHHH T ss_conf 014467668999999919899999999708899999999999999958986787999--999998--7887883889999 Q ss_pred HHH Q ss_conf 984 Q gi|254780822|r 103 ILS 105 (107) Q Consensus 103 i~~ 105 (107) ++. T Consensus 169 ~~~ 171 (178) T cd03019 169 LDE 171 (178) T ss_pred HHH T ss_conf 999 No 85 >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides. The protein was named BCP based on its electrophoretic mobility before its function was known. BCP shows substrate selectivity toward fatty acid hydroperoxides rather than hydrogen peroxide or alkyl hydroperoxides. BCP contains the peroxidatic cysteine but appears not to possess a resolving cysteine (some sequences, not all, contain a second cysteine but its role is still unknown). Unlike other PRXs, BCP exists as a monomer. The plant homolog of BCP is PRX Q, which is expressed only in leaves and is cellularly localized in the chloroplasts and the guard cells of stomata. Also included in this subfamily is the fungal nuclear protein, Dot5p (for disrupter of telomere silencing protein 5), w Probab=98.51 E-value=4.7e-07 Score=61.76 Aligned_cols=85 Identities=16% Similarity=0.290 Sum_probs=63.7 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCC---------------------CCHHHHHHHCCCCC Q ss_conf 8994999987-69970222134666654210001-2333226723---------------------26577776231568 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDIE---------------------ESSEISTRYQISSI 74 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d---------------------~~~~l~~~~~v~~~ 74 (107) .+++++|.|| +.||++|....+.+.+...++.+ .+.++.|+.| .+.+++++||+... T Consensus 22 ~Gk~vvl~F~p~~~~p~C~~e~~~~~~~~~~~~~~g~~vv~IS~d~~~~~~~~~~~~~~~fp~l~D~~~~v~~~ygv~~~ 101 (140) T cd03017 22 RGKPVVLYFYPKDDTPGCTKEACDFRDLYEEFKALGAVVIGVSPDSVESHAKFAEKYGLPFPLLSDPDGKLAKAYGVWGE 101 (140) T ss_pred CCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCHHHHHHCCCCCC T ss_conf 99849999966878997889999999999998741984899827889999999998699837999497399998699865 Q ss_pred C---------EEEEE-ECCEEEEEEECCCCCHHHHHHHH Q ss_conf 8---------79999-79989858874899989999999 Q gi|254780822|r 75 P---------TLILF-KDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 75 P---------t~~~~-~~g~~~~~~~~g~~~~~~l~~~i 103 (107) | +.+++ ++|+... .|.|..+.+...+.| T Consensus 102 ~~~~~~~~~R~tfvId~~G~I~~-i~~~~~~~~~~~~~l 139 (140) T cd03017 102 KKKKYMGIERSTFLIDPDGKIVK-VWRKVKPKGHAEEVL 139 (140) T ss_pred CCCCCCCEEEEEEEECCCCEEEE-EECCCCCCCHHHHHH T ss_conf 76666747679999989998999-985899454898962 No 86 >pfam02114 Phosducin Phosducin. Probab=98.51 E-value=1.4e-06 Score=59.01 Aligned_cols=102 Identities=17% Similarity=0.303 Sum_probs=80.6 Q ss_pred EEEE-CHHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 1775-767799999848--9949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 3 ALKV-DTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i-~~~~f~~~v~~~--~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) +++| +.++|-..|-+. .-+|+|..|-+.-+.|..|...|..||.+|+. ++|++|....- .+..+|.-.++||+++ T Consensus 127 v~eL~sge~FLeaIdkE~k~ttVIVHIYe~~i~~C~~lN~cL~~LA~eYp~-VKFcki~aS~~-G~s~~F~~~~lPaLLV 204 (265) T pfam02114 127 VLEIESGEGFLDMIDKEQKITLIMVHIYEDGIKGCDALNGCLICLAAEYPM-VKFCKIKASNI-GAGDRFSRDALPALLI 204 (265) T ss_pred EEECCCHHHHHHHHHCCCCCEEEEEEEEECCCHHHHHHHHHHHHHHHHCCC-CEEEEEEECCC-CHHHHCCCCCCCEEEE T ss_conf 888156767999973769865999998308873799999999999986896-15897640445-8566366258875788 Q ss_pred EECCEEEEEEEC--C----CCCHHHHHHHHHHC Q ss_conf 979989858874--8----99989999999841 Q gi|254780822|r 80 FKDGKVIDRMMP--G----ASSQSDIIEWILSR 106 (107) Q Consensus 80 ~~~g~~~~~~~~--g----~~~~~~l~~~i~~~ 106 (107) |++|+.+.-++. . .--+..+..|+.++ T Consensus 205 YK~GeLIgNFvrvtd~lgedFfa~DvE~FL~E~ 237 (265) T pfam02114 205 YKAGELIGNFIRVTDQLAEDFFAGDLEAFLNEF 237 (265) T ss_pred EECCEEEEEEEEECHHHCCCCCHHHHHHHHHHC T ss_conf 608825763145125443645587899999982 No 87 >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif. The human/rat protein, called SSP411, is specifically expressed in the testis in an age-dependent manner. The SSP411 mRNA is increased during spermiogenesis and is localized in round and elongated spermatids, suggesting a function in fertility regulation. Probab=98.43 E-value=9e-07 Score=60.13 Aligned_cols=80 Identities=19% Similarity=0.290 Sum_probs=64.1 Q ss_pred CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCCCHHHHHHH--------CCCCCC Q ss_conf 76779999984899499998769970222134666---6542100012333226723265777762--------315688 Q gi|254780822|r 7 DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEESSEISTRY--------QISSIP 75 (107) Q Consensus 7 ~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~~~~l~~~~--------~v~~~P 75 (107) +++.|++ ..+.+||++|.+++.||..|+.|...- .++++-+.+.+.-++||.|+.|++.+.| +-.|-| T Consensus 4 ~~eal~~-Ak~e~KpIflsig~~~C~wC~vM~~esF~d~eVA~~lN~~FVpVkVDreerPdld~~y~~~~~~~~~~gGWP 82 (124) T cd02955 4 GEEAFEK-ARREDKPIFLSIGYSTCHWCHVMEHESFEDEEVAAILNENFVPIKVDREERPDVDKIYMNAAQAMTGQGGWP 82 (124) T ss_pred CHHHHHH-HHHCCCCEEEEEECCCCHHHHHHHHHHCCCHHHHHHHHHHCEEEECCHHHCHHHHHHHHHHHHHHCCCCCCC T ss_conf 9999999-997299889997467698899999873189999999984203433063348558999999999970799986 Q ss_pred EEEEEE-CCEEEE Q ss_conf 799997-998985 Q gi|254780822|r 76 TLILFK-DGKVID 87 (107) Q Consensus 76 t~~~~~-~g~~~~ 87 (107) ..++.. +|++.. T Consensus 83 l~vfltp~~~Pf~ 95 (124) T cd02955 83 LNVFLTPDLKPFF 95 (124) T ss_pred EEEEECCCCCEEE T ss_conf 0367879996468 No 88 >TIGR02740 TraF-like TraF-like protein; InterPro: IPR014111 This entry contains TraF-like proteins that are related to the F-type conjugation system pilus assembly proteins TraF (IPR014110 from INTERPRO)and TrbB (IPR014109 from INTERPRO) both of which exhibit a thioredoxin fold . The proteins in this entry have the same length and architecture as TraF, but lack the CXXC-motif found in TrbB that is believed to be responsible for the disulphide isomerase activity.. Probab=98.41 E-value=2.1e-06 Score=57.97 Aligned_cols=87 Identities=20% Similarity=0.332 Sum_probs=70.8 Q ss_pred CCCCEEEEEECCC-CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-----------CHHHHHHHCC---CCCCEEEEEEC Q ss_conf 8994999987699-7022213466665421000123332267232-----------6577776231---56887999979 Q gi|254780822|r 18 CSNPVVVDFWASW-CRPCVKLSPIIDDIADELADKVKITKLDIEE-----------SSEISTRYQI---SSIPTLILFKD 82 (107) Q Consensus 18 ~~~~vlv~f~a~w-C~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~-----------~~~l~~~~~v---~~~Pt~~~~~~ 82 (107) +++..|-+||... |++|..+.|++..++..|+=.|..+.+|.-- +..++++++| +.+|+++++.. T Consensus 193 a~~~GlFFFf~S~~C~~C~~~~pil~~~~~~YG~~V~pvS~DG~PLp~G~FPn~~pD~G~a~~L~iGtd~~VPA~~L~~p 272 (306) T TIGR02740 193 AKKSGLFFFFKSDDCPYCHAQAPILKAFEDRYGIEVLPVSVDGGPLPGGKFPNARPDAGQAQKLKIGTDRTVPAVFLVDP 272 (306) T ss_pred HCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCEEEEEEC T ss_conf 40751689972788662268999999999731970899984588878788888521403675404676654665899985 Q ss_pred -CEEEEEEECCCCCHHHHHHHHH Q ss_conf -9898588748999899999998 Q gi|254780822|r 83 -GKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 83 -g~~~~~~~~g~~~~~~l~~~i~ 104 (107) ++.....=.|.++.++|.+-|. T Consensus 273 ~p~~~~~igfG~~S~~~L~~Ri~ 295 (306) T TIGR02740 273 KPNQITPIGFGVMSADELVDRIL 295 (306) T ss_pred CCCCEEEEEECCCCHHHHHHHHH T ss_conf 89903687402003888988877 No 89 >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE. AhpE is described as a 1-cys PRX because of the absence of a resolving cysteine. The structure and sequence of AhpE, however, show greater similarity to 2-cys PRXs than 1-cys PRXs. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. The first step of catalysis is the nucleophilic attack by the peroxidatic cysteine on the peroxide leading to the formation of a cysteine sulfenic acid intermediate. The absence of a resolving cysteine suggests that functional AhpE is regenerated by an external reductant. The solution behavior and crystal structure of AhpE show that it forms dimers and octamers. Probab=98.38 E-value=1.7e-06 Score=58.61 Aligned_cols=87 Identities=15% Similarity=0.274 Sum_probs=62.1 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCC-----------------------CCHHHHHHHCCC Q ss_conf 8994999987-69970222134666654210001-2333226723-----------------------265777762315 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDIE-----------------------ESSEISTRYQIS 72 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d-----------------------~~~~l~~~~~v~ 72 (107) .++++++.|| +.||++|....+.+.+...++.+ .+.++.|..| .+.+++++||+. T Consensus 27 g~~~vvl~F~p~~~cp~C~~e~~~~~~~~~~~~~~~v~Vv~IS~D~~~~~~~f~~~~~l~fpllsD~~~~~~va~~ygv~ 106 (149) T cd03018 27 GRKPVVLVFFPLAFTPVCTKELCALRDSLELFEAAGAEVLGISVDSPFSLRAWAEENGLTFPLLSDFWPHGEVAKAYGVF 106 (149) T ss_pred CCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCHHHHCCCC T ss_conf 99809999988889997587898888888876347839996369999999999998799961999689870249886995 Q ss_pred ------CCCEEEEE-ECCEEEEEEECC---CCCHHHHHHHHH Q ss_conf ------68879999-799898588748---999899999998 Q gi|254780822|r 73 ------SIPTLILF-KDGKVIDRMMPG---ASSQSDIIEWIL 104 (107) Q Consensus 73 ------~~Pt~~~~-~~g~~~~~~~~g---~~~~~~l~~~i~ 104 (107) ..|+.+++ ++|+.....+.. .++..++.+.++ T Consensus 107 ~~~~g~~~r~tfiID~~G~V~~~~v~~~~~~r~~~~~~~~l~ 148 (149) T cd03018 107 DEDLGVAERAVFVIDRDGIIRYAWVSDDGEPRDLPDYDEALD 148 (149) T ss_pred CCCCCCCCCEEEEECCCCEEEEEEEECCCCCCCHHHHHHHHC T ss_conf 067798448899997999899999907996788579999965 No 90 >PRK10877 thiol:disulfide interchange protein DsbC; Provisional Probab=98.35 E-value=1.8e-06 Score=58.43 Aligned_cols=84 Identities=14% Similarity=0.337 Sum_probs=59.9 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHH--------CC------CC-C----------------------CCCCCCC- Q ss_conf 899499998769970222134666654210--------00------12-3----------------------3322672- Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADE--------LA------DK-V----------------------KITKLDI- 59 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~--------~~------~~-i----------------------~~~~vd~- 59 (107) .++.++..|..|.||+|+++...+.++.+. |+ +. - .+..-+| T Consensus 106 ~~k~~i~VFTDpdCpYCrklh~el~~~~~~gItV~y~~fPr~g~~~~s~~k~~~iWCa~Dr~~A~~~~~~g~~~~~~~C~ 185 (232) T PRK10877 106 QEKHVITVFTDITCGYCHKLHEQMKDYNALGITVRYLAFPRQGLESQAEKDMKSIWCAKDKNKAFDDAMAGKDVSPASCD 185 (232) T ss_pred CCCEEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCC T ss_conf 87579999969998789999999986102674999996045568953799999998547899999999759999922278 Q ss_pred ---CCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf ---32657777623156887999979989858874899989999999841 Q gi|254780822|r 60 ---EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 60 ---d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) +++-++.+++||+|+||+++ .+|+. ..|..+.++|.++++++ T Consensus 186 ~pv~~~~~lg~~lGV~GTPtiv~-~dG~~----vpGy~pa~~L~~~L~~~ 230 (232) T PRK10877 186 VDIADHYALGVQLGVQGTPAIVL-SNGTL----VPGYQGPKEMKAFLDEH 230 (232) T ss_pred CHHHHHHHHHHHCCCCCCCEEEE-CCCCC----CCCCCCHHHHHHHHHHC T ss_conf 85999999999839986775994-89979----87988999999999865 No 91 >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein. It is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 interacts with multiple splicing-associated proteins, suggesting that it functions at multiple control points in the splicing of pre-mRNA as part of a large spliceosomal complex involving many protein-protein interactions. U5 snRNP contains seven core proteins (common to all snRNPs) and nine U5-specific proteins, one of which is Dim1. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif. It is essential for G2/M phase transition, as a consequence to its role in pre-mRNA splicing. Probab=98.34 E-value=2.7e-06 Score=57.40 Aligned_cols=91 Identities=22% Similarity=0.431 Sum_probs=73.9 Q ss_pred HHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEEC-C Q ss_conf 998489949999876997022213466665421000123332267232657777623156887999979989858874-8 Q gi|254780822|r 14 EVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMP-G 92 (107) Q Consensus 14 ~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~-g 92 (107) .+.+..+.++|.|+.+|.+.|.+|...|.+.+++.++-..++.+|+++-|+..+.|.+...||+++|-+|+-+---++ | T Consensus 9 I~~e~drvvViRFGr~~d~~Cm~mDeiL~k~a~~v~nfa~iylvDideVpdfn~myeL~dp~t~mFFfrnkHm~vD~GTg 88 (114) T cd02954 9 ILSEEEKVVVIRFGRDWDPVCMQMDEVLAKIAEDVSNFAVIYLVDIDEVPDFNKMYELYDPPTVMFFFRNKHMKIDLGTG 88 (114) T ss_pred HHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHCCCCCCCEEEEEECCCEEEEEECCC T ss_conf 74667269999805999927988989999999997546089999876463133210036785689998385689973699 Q ss_pred --------CCCHHHHHHHHH Q ss_conf --------999899999998 Q gi|254780822|r 93 --------ASSQSDIIEWIL 104 (107) Q Consensus 93 --------~~~~~~l~~~i~ 104 (107) ..++++++..++ T Consensus 89 nnnK~n~~~~~kqe~IDiie 108 (114) T cd02954 89 NNNKINWVFEDKQEFIDIIE 108 (114) T ss_pred CCCEEEEECCCHHHHHHHHH T ss_conf 87568886283888999999 No 92 >pfam06110 DUF953 Eukaryotic protein of unknown function (DUF953). This family consists of several hypothetical eukaryotic proteins of unknown function. Probab=98.26 E-value=2.5e-06 Score=57.61 Aligned_cols=93 Identities=20% Similarity=0.484 Sum_probs=63.6 Q ss_pred HHHHHHHHH---HCCCCEEEEEEC-------CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-------HH--HHHH Q ss_conf 677999998---489949999876-------9970222134666654210001233322672326-------57--7776 Q gi|254780822|r 8 TKSFDSEVL---ECSNPVVVDFWA-------SWCRPCVKLSPIIDDIADELADKVKITKLDIEES-------SE--ISTR 68 (107) Q Consensus 8 ~~~f~~~v~---~~~~~vlv~f~a-------~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~-------~~--l~~~ 68 (107) -++|.+.+. .++++++|+|++ +|||.|.+..|++++..++.+++..|+.+.+-+- .. .-.. T Consensus 5 y~ef~~~~~~~~~~~~~vfv~F~g~kd~~G~SWCPDCv~AePvi~~~f~~~~~~~~~i~v~VG~r~~Wkdp~n~fR~~~~ 84 (119) T pfam06110 5 FEEFNKAVKESENGSKPIFALFTGSKDTTGESWCPDCVRAEPVIREALKHAPEDCHFIYVDVGDRPYWKDPNNPFRKDPN 84 (119) T ss_pred HHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCC T ss_conf 99999999999737982999997777999793690076614889999983888857999997682712699997665966 Q ss_pred HCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 23156887999979989858874899989999999 Q gi|254780822|r 69 YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 69 ~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) +++.++||++-+++.+ |..........+++.+ T Consensus 85 ~~l~~iPTLlrw~~~~---rL~~~qc~~~~lv~~~ 116 (119) T pfam06110 85 LKLTGVPTLLRWGGPQ---RLDESQCLNSHLVEMF 116 (119) T ss_pred CCCCCCCEEEEECCCC---CCCHHHCCCHHHHHHH T ss_conf 1245477678858954---0471120598999998 No 93 >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer. Probab=98.22 E-value=2.8e-06 Score=57.30 Aligned_cols=81 Identities=22% Similarity=0.390 Sum_probs=55.5 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCC-------------------------------------CCC-- Q ss_conf 89949999876997022213466665421000123332-------------------------------------267-- Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKIT-------------------------------------KLD-- 58 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~-------------------------------------~vd-- 58 (107) +.+..+..|..|.||+|+++.+.+..+.+...=.+.+. .-. T Consensus 76 ~~~~~i~vFtDp~CpyC~kl~~~l~~~~~~i~v~~~~~P~~g~~~s~~~~~~i~Ca~d~~~a~~~~~~~~~~~~~~~~c~ 155 (197) T cd03020 76 NGKRVVYVFTDPDCPYCRKLEKELKPNADGVTVRIFPVPILGLPDSTAKAAAIWCAKDRAKAWTDAMSGGKVPPPAASCD 155 (197) T ss_pred CCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCC T ss_conf 98879999979898789999999885458849999982157785169999999806899999999985799889644346 Q ss_pred --CCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf --232657777623156887999979989858874899989999999 Q gi|254780822|r 59 --IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 59 --~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) +.++..+++++||+|+||+++ .+|+. ..|..+.++|.++| T Consensus 156 ~~v~~~~~l~~~lGi~GTPtiv~-~dG~~----v~G~~~~~~L~~~L 197 (197) T cd03020 156 NPVAANLALGRQLGVNGTPTIVL-ADGRV----VPGAPPAAQLEALL 197 (197) T ss_pred CHHHHHHHHHHHHCCCCCCEEEE-CCCCC----CCCCCCHHHHHHHC T ss_conf 49999999999829984777996-89979----77989999999439 No 94 >KOG2603 consensus Probab=98.21 E-value=3.8e-06 Score=56.55 Aligned_cols=104 Identities=20% Similarity=0.380 Sum_probs=78.7 Q ss_pred CEEEECHHHHHHHHHHCCC--CEEEEEEC----CCCHHHHHHHHHHHHHHHHCC------C--CCCCCCCCCCCCHHHHH Q ss_conf 5177576779999984899--49999876----997022213466665421000------1--23332267232657777 Q gi|254780822|r 2 SALKVDTKSFDSEVLECSN--PVVVDFWA----SWCRPCVKLSPIIDDIADELA------D--KVKITKLDIEESSEIST 67 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~~~--~vlv~f~a----~wC~~C~~~~p~~~~l~~~~~------~--~i~~~~vd~d~~~~l~~ 67 (107) .+|.+|+++|.+.+..... ..+|+|.| ..|+-|+....++.-+++.+. + ++-|+.||.|+.+++.+ T Consensus 41 ~VI~~n~d~~~~~v~~~prNys~IvmftA~~~~~~C~lC~~~~~Ef~iva~S~r~~~~~sn~tklFF~~Vd~~e~p~~Fq 120 (331) T KOG2603 41 GVIRMNDDKFSKFVRPPPRNYSLIVMFTALQPHSQCQLCLQAEEEFQIVANSWRYNSPFSNGTKLFFCMVDYDESPQVFQ 120 (331) T ss_pred CEEEECCCCHHHHCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCHHHHH T ss_conf 74886676445543599988689998211688776730114788887998886236888875168999986432579999 Q ss_pred HHCCCCCCEEEEEECCEEEE-------EEECCCCCHHHHHHHHHHC Q ss_conf 62315688799997998985-------8874899989999999841 Q gi|254780822|r 68 RYQISSIPTLILFKDGKVID-------RMMPGASSQSDIIEWILSR 106 (107) Q Consensus 68 ~~~v~~~Pt~~~~~~g~~~~-------~~~~g~~~~~~l~~~i~~~ 106 (107) ++++++.|++++|...+.-. ....|. ..|++.+|++.+ T Consensus 121 ~l~ln~~P~l~~f~P~~~n~~~s~~~d~~~~g~-~Ae~iaqfv~~~ 165 (331) T KOG2603 121 QLNLNNVPHLVLFSPAKGNKKRSDQMDQQDLGF-EAEQIAQFVADR 165 (331) T ss_pred HHCCCCCCEEEEECCCCCCCCCCCCCHHHHCCH-HHHHHHHHHHHH T ss_conf 841257874887189866655676411200126-699999999876 No 95 >pfam03190 DUF255 Protein of unknown function, DUF255. Probab=98.19 E-value=6.6e-06 Score=55.15 Aligned_cols=80 Identities=21% Similarity=0.325 Sum_probs=63.3 Q ss_pred CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCCCHHHHHHH--------CCCCCC Q ss_conf 76779999984899499998769970222134666---6542100012333226723265777762--------315688 Q gi|254780822|r 7 DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEESSEISTRY--------QISSIP 75 (107) Q Consensus 7 ~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~~~~l~~~~--------~v~~~P 75 (107) +++.|++ ..+.+||++|.+++.||..|+.|...- .++++-+...+.-++||.++.|++.+.| +-.|-| T Consensus 26 ~~ea~~~-Ak~e~Kpiflsig~~~ChwChvM~~esF~d~~vA~~lN~~Fv~VkVDree~PdiD~~Ym~~~q~~~g~gGWP 104 (163) T pfam03190 26 GEEAFAK-ARREDKPIFLSIGYSTCHWCHVMAHESFEDPEVAAILNEHFVPIKVDREERPDIDAIYMTAVQALTGSGGWP 104 (163) T ss_pred CHHHHHH-HHHCCCCEEEEEECCCCHHHHHHHHHHCCCHHHHHHHHHHEEEEEECHHHCHHHHHHHHHHHHHHHCCCCCC T ss_conf 9999999-997199889995278787899999873489999999974203334063237557899999999970789975 Q ss_pred EEEEEE-CCEEEE Q ss_conf 799997-998985 Q gi|254780822|r 76 TLILFK-DGKVID 87 (107) Q Consensus 76 t~~~~~-~g~~~~ 87 (107) ..++.. +|++.. T Consensus 105 L~vfltPdg~Pf~ 117 (163) T pfam03190 105 LTVFLTPDGKPFF 117 (163) T ss_pred CEEEECCCCCEEE T ss_conf 1246879997468 No 96 >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding. PfPDO contains two redox active CXXC motifs in two contiguous TRX-fold subdomains. The active site in the N-terminal TRX-fold subdomain is required for isomerase but not for reductase activity of PfPDO. The exclusive presence of PfPDO-like proteins in extremophiles may suggest that they have a special role in adaptation to extreme conditions. Probab=98.18 E-value=8.5e-06 Score=54.52 Aligned_cols=86 Identities=26% Similarity=0.458 Sum_probs=68.7 Q ss_pred CCCE-EEEEEC-CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC-EEEEEEECCCCC Q ss_conf 9949-999876-9970222134666654210001233322672326577776231568879999799-898588748999 Q gi|254780822|r 19 SNPV-VVDFWA-SWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG-KVIDRMMPGASS 95 (107) Q Consensus 19 ~~~v-lv~f~a-~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g-~~~~~~~~g~~~ 95 (107) ..|| ++.|.+ ..|.+|..+..-+++++.-- +++.+...|.+++++++++|||..+||+++..+| +...-+|.|... T Consensus 20 ~~pV~ivvF~~~~~c~yc~~t~~ll~ela~ls-dKi~~~~~~~~~d~e~a~k~gVer~Pti~i~~~~~~~~~irf~GiP~ 98 (113) T cd02975 20 KNPVDLVVFSSKEGCQYCEVTKQLLEELSELS-DKLKLEIYDFDEDKEKAEKYGVERVPTTIFLQDGGKDGGIRYYGLPA 98 (113) T ss_pred CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCHHHHHHHCCEECCEEEEECCCCCCCCEEEEECCC T ss_conf 99869999957988711699999999999748-85389996676697999983981465799974888755269950786 Q ss_pred HHHHHHHHHH Q ss_conf 8999999984 Q gi|254780822|r 96 QSDIIEWILS 105 (107) Q Consensus 96 ~~~l~~~i~~ 105 (107) -+++..+|+. T Consensus 99 G~Ef~slie~ 108 (113) T cd02975 99 GYEFASLIED 108 (113) T ss_pred CHHHHHHHHH T ss_conf 2769999999 No 97 >TIGR02187 GlrX_arch Glutaredoxin-like domain protein; InterPro: IPR011903 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This entry of archaeal proteins contains a C-terminal domain with homology to bacterial and eukaryotic glutaredoxins, including a CPYC motif. There is an N-terminal domain which has even more distant homology to glutaredoxins. The name "glutaredoxin" may be inappropriate in the sense of working in tandem with glutathione and glutathione reductase which may not be present in the archaea. The overall domain structure appears to be related to bacterial alkylhydroperoxide reductases, but the homology may be distant enough that the function of this family is wholly different.. Probab=98.18 E-value=1.6e-05 Score=52.92 Aligned_cols=76 Identities=22% Similarity=0.492 Sum_probs=46.2 Q ss_pred CCHHHHHHHHHHHHHHHHC-----CCC--CCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC-EEEEEEECCCCCHHHHHH Q ss_conf 9702221346666542100-----012--33322672326577776231568879999799-898588748999899999 Q gi|254780822|r 30 WCRPCVKLSPIIDDIADEL-----ADK--VKITKLDIEESSEISTRYQISSIPTLILFKDG-KVIDRMMPGASSQSDIIE 101 (107) Q Consensus 30 wC~~C~~~~p~~~~l~~~~-----~~~--i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g-~~~~~~~~g~~~~~~l~~ 101 (107) .|.+|+....-++.+++.- +++ +.++..|.++.++.+++|+|..+||+++..+| +-..-+|.|...-+++.+ T Consensus 39 ~C~yC~~t~qLl~e~~e~~p~~~gg~KL~L~iyd~~t~e~KE~~ekY~VErvPt~~~~~~G~kD~~iRy~G~PaG~Ef~~ 118 (237) T TIGR02187 39 RCQYCKETKQLLEELSEVSPEASGGDKLKLEIYDFDTPEDKELVEKYKVERVPTTILLEEGSKDYGIRYTGIPAGYEFAA 118 (237) T ss_pred CCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCHHHHHHCCCCCCCEEEEEECCCEEEEEEEEECCCHHHHHH T ss_conf 88655899999998875166446896225888627998420234233755210689820896356788972154368999 Q ss_pred HHHH Q ss_conf 9984 Q gi|254780822|r 102 WILS 105 (107) Q Consensus 102 ~i~~ 105 (107) +|+. T Consensus 119 L~ed 122 (237) T TIGR02187 119 LIED 122 (237) T ss_pred HHHH T ss_conf 9999 No 98 >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Probab=98.15 E-value=1.6e-05 Score=52.88 Aligned_cols=88 Identities=15% Similarity=0.308 Sum_probs=63.0 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCC---------------------CCCHHHHHHHCCCCC Q ss_conf 8994999987-69970222134666654210001-233322672---------------------326577776231568 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDI---------------------EESSEISTRYQISSI 74 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~---------------------d~~~~l~~~~~v~~~ 74 (107) .++++++.|| ..||+.|....+.+.+..+++.+ .+.++.|.. |.+.++++.|||.+. T Consensus 29 ~gk~vvl~Fyp~~~tp~C~~e~~~f~d~~~~f~~~g~~VigIS~D~~~~~~~f~~~~~l~f~lLsD~~~~v~~~ygv~~~ 108 (156) T PRK09437 29 QGKKVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVVVLGISPDKPEKLSKFAEKELLNFTLLSDEDHQVAEQFGVWGE 108 (156) T ss_pred CCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEECCCHHHHHHCCCCCC T ss_conf 89979999976878998746889999999875325818998768889999999997099974898898069998499754 Q ss_pred C-------------EEEEEECCEEEEEEECCCCC---HHHHHHHHHHC Q ss_conf 8-------------79999799898588748999---89999999841 Q gi|254780822|r 75 P-------------TLILFKDGKVIDRMMPGASS---QSDIIEWILSR 106 (107) Q Consensus 75 P-------------t~~~~~~g~~~~~~~~g~~~---~~~l~~~i~~~ 106 (107) | |+++=++|+.+. .+.+..+ .+++.++|+++ T Consensus 109 ~~~~g~~~~g~~R~tfiID~~G~I~~-v~~~v~~~~h~~~vL~~Lk~~ 155 (156) T PRK09437 109 KKFMGKTYDGIHRISFLIDEDGKIEH-VFDKFKTKDHHDVVLDYLKEN 155 (156) T ss_pred CCCCCCCCCCCCEEEEEECCCCEEEE-EECCCCCCCCHHHHHHHHHHH T ss_conf 42356544788506999999998999-978999875399999999852 No 99 >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified. PRXs are thiol-specific antioxidant (TSA) proteins also known as TRX peroxidases and alkyl hydroperoxide reductase C22 (AhpC) proteins. They confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either TRX, glutathione, trypanothione and AhpF. They are distinct from other peroxidases in that they have no cofactors such as metals or prosthetic groups. The first step of catalysis, common to all PRXs, is the nucleophilic attack by the catalytic cysteine (also known as the peroxidatic cysteine) on the peroxide leading to cleavage of the oxygen-oxygen bond and the formation of a Probab=98.13 E-value=9.2e-06 Score=54.32 Aligned_cols=74 Identities=18% Similarity=0.302 Sum_probs=54.3 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCC----------------------CCHHHHHHHCCCC Q ss_conf 8994999987-69970222134666654210001-2333226723----------------------2657777623156 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDIE----------------------ESSEISTRYQISS 73 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d----------------------~~~~l~~~~~v~~ 73 (107) .++++++.|| +.||++|....|.+.+..+++.+ .+.++.|..| ...+++++||+.. T Consensus 21 ~gk~vvl~f~p~~~~p~C~~e~~~~~~~~~~~~~~g~~vv~Is~d~~~~~~~~~~~~~~~~f~~l~D~~~~~~~~ygv~~ 100 (140) T cd02971 21 KGKWVVLFFYPKDFTPVCTTELCAFRDLAEEFAKGGAEVLGVSVDSPFSHKAWAEKEGGLNFPLLSDPDGEFAKAYGVLI 100 (140) T ss_pred CCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEECCCHHHHHHCCCCC T ss_conf 98949999999988999614468899998875047716877628999999999998458886588868689999839973 Q ss_pred ---------CCEEEEEE-CCEEEEEEEC Q ss_conf ---------88799997-9989858874 Q gi|254780822|r 74 ---------IPTLILFK-DGKVIDRMMP 91 (107) Q Consensus 74 ---------~Pt~~~~~-~g~~~~~~~~ 91 (107) .|+.+++. +|+.....+. T Consensus 101 ~~~~~~~~~~r~tfvId~~G~I~~~~i~ 128 (140) T cd02971 101 EKSAGGGLAARATFIIDPDGKIRYVEVE 128 (140) T ss_pred CCCCCCCCCCCEEEEECCCCEEEEEEEC T ss_conf 4655789521089999999989999988 No 100 >TIGR02187 GlrX_arch Glutaredoxin-like domain protein; InterPro: IPR011903 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This entry of archaeal proteins contains a C-terminal domain with homology to bacterial and eukaryotic glutaredoxins, including a CPYC motif. There is an N-terminal domain which has even more distant homology to glutaredoxins. The name "glutaredoxin" may be inappropriate in the sense of working in tandem with glutathione and glutathione reductase which may not be present in the archaea. The overall domain structure appears to be related to bacterial alkylhydroperoxide reductases, but the homology may be distant enough that the function of this family is wholly different.. Probab=98.09 E-value=2e-05 Score=52.36 Aligned_cols=98 Identities=19% Similarity=0.372 Sum_probs=65.2 Q ss_pred ECHHHHHHHHHH-CCCCE-EEEEECCCCHHHHHHHHHHHHHHHHC--CC--CCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 576779999984-89949-99987699702221346666542100--01--23332267232657777623156887999 Q gi|254780822|r 6 VDTKSFDSEVLE-CSNPV-VVDFWASWCRPCVKLSPIIDDIADEL--AD--KVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 6 i~~~~f~~~v~~-~~~~v-lv~f~a~wC~~C~~~~p~~~~l~~~~--~~--~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) |++++-+. +.+ =+++| +-.|=+|.||+|=.-...=+++|-+. .| +|.==.|++.+|++++++|||+|+|.+++ T Consensus 133 L~~~~~e~-l~~kl~~~v~I~vfVTPtCPYCP~AV~mAH~fA~~~~kaGk~~I~gemIEA~E~~~~Ae~y~V~sVP~IvI 211 (237) T TIGR02187 133 LSEETVEE-LKSKLDEPVRIEVFVTPTCPYCPRAVLMAHKFALANDKAGKGKILGEMIEANENPDLAEKYGVMSVPKIVI 211 (237) T ss_pred CCHHHHHH-HHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCHHHHCEECCEECCCEEE T ss_conf 50899999-97337983599999856899725799999999983544779716886674126833542105044374378 Q ss_pred EECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 97998985887489998999999984 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) =++.+..-+ +-|+.+.+++.+.|.+ T Consensus 212 N~~~~~kv~-F~GA~Pe~~Fl~~~~~ 236 (237) T TIGR02187 212 NKDVEDKVE-FVGAYPEEQFLEYILE 236 (237) T ss_pred CCCCCEEEE-EEECCCHHHHHHHHHH T ss_conf 188610578-9732886999999971 No 101 >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB; InterPro: IPR014109 This entry includes thiol-disulphide isomerase (TrbB), a protein that is involved in conjugative transfer of plasmid DNA, specifically in the F-type system. TrbB has been predicted to contain a thioredoxin fold, it also contains a conserved pair of cysteines and has been shown to function as a thiol disulphide isomerase by complementation of Escherichia coli DsbA mutants . TtbB is believed to be involved in pilin assembly . TrbB is closely related to TraF (IPR014110 from INTERPRO) though somewhat longer lacking the cysteine motif and is apparently not functional as a disulphide bond isomerase.. Probab=98.07 E-value=4.3e-06 Score=56.24 Aligned_cols=88 Identities=18% Similarity=0.363 Sum_probs=67.6 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC----------CHHHHHH------HCCCCCCEEEEEE Q ss_conf 89949999876997022213466665421000123332267232----------6577776------2315688799997 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE----------SSEISTR------YQISSIPTLILFK 81 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~----------~~~l~~~------~~v~~~Pt~~~~~ 81 (107) .++.-+|.||...|+||++++|+|+.++..++=.+.-..+|..- -+|+.+. |..-.+|+++++. T Consensus 70 ~~~~~~vfF~~S~CPyCh~FAP~LK~f~~~~~~~V~a~SlDG~g~~~FP~~~P~tpE~~~~~F~~~ey~~~~~PalFLvN 149 (176) T TIGR02738 70 LDDYALVFFYQSTCPYCHQFAPVLKRFSQQFGLSVYAFSLDGQGLAEFPDALPATPEVMQTFFPNGEYRPVVTPALFLVN 149 (176) T ss_pred HHCCEEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCCEECCCEEEEEC T ss_conf 44350788862889640022657787887628753788733897877887657876578763388970301023223331 Q ss_pred -CCEEEEEEECCCCCHHHHHHHHHH Q ss_conf -998985887489998999999984 Q gi|254780822|r 82 -DGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 82 -~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) +.++..+...|..+..+|.+-+.+ T Consensus 150 vnt~~~~~v~~G~~~~~~L~~r~~~ 174 (176) T TIGR02738 150 VNTRKAYPVLQGAVDEAELANRMDE 174 (176) T ss_pred CCHHHHHHHHCCCCCHHHHHHHHHH T ss_conf 5378887643387678999999987 No 102 >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family; InterPro: IPR011911 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This glutaredoxin-like protein family contains the conserved CxxC motif and includes the Clostridium pasteurianum protein YruB which has been cloned from a rubredoxin operon . Somewhat related to NrdH, it is unknown whether this protein actually interacts with glutathione/glutathione reducatase, or, like NrdH, some other reductant system.. Probab=98.07 E-value=9.2e-06 Score=54.32 Aligned_cols=67 Identities=21% Similarity=0.508 Sum_probs=49.9 Q ss_pred EEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH----HHHHHHC-CCCCCEEE---EEEC-CEEEEEEECCCCC Q ss_conf 987699702221346666542100012333226723265----7777623-15688799---9979-9898588748999 Q gi|254780822|r 25 DFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS----EISTRYQ-ISSIPTLI---LFKD-GKVIDRMMPGASS 95 (107) Q Consensus 25 ~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~----~l~~~~~-v~~~Pt~~---~~~~-g~~~~~~~~g~~~ 95 (107) .+..||||+|++.+..|.+. .|.|-.+|+++++ ++.+.++ =+|+|+++ + + ++.+ .|+ + T Consensus 4 vYt~~~Cp~C~~aK~yL~~~------gv~f~~~dV~~d~~A~~~~~k~~gG~~gVPv~vsGdi--~~~~i~----~GF-~ 70 (79) T TIGR02196 4 VYTTPWCPPCKKAKEYLTSK------GVAFEEIDVEKDSAAREELLKKLGGQRGVPVIVSGDI--GTHKII----VGF-D 70 (79) T ss_pred EEEECCCCCHHHHHHHHHHC------CCCEEEECCCCCHHHHHHHHHHHCCCCCCCEEEECCC--CCCEEE----EEC-C T ss_conf 87408982078999999954------9945763433697889999998389854555763423--797248----706-9 Q ss_pred HHHHHHHHH Q ss_conf 899999998 Q gi|254780822|r 96 QSDIIEWIL 104 (107) Q Consensus 96 ~~~l~~~i~ 104 (107) ++.|-++|+ T Consensus 71 ~~kld~~l~ 79 (79) T TIGR02196 71 PEKLDKLLE 79 (79) T ss_pred HHHHHHHCC T ss_conf 799999709 No 103 >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox state of target proteins via the reversible oxidation of their active site dithiol. The PDO members of this superfamily include TRX, protein disulfide isomerase (PDI), tlpA-like, glutaredoxin, NrdH redoxin, and the bacterial Dsb (DsbA, DsbC, DsbG, DsbE, DsbDgamma) protein families. Members of the superfamily that do not function as PDOs but contain a TRX-fold domain include phosducins, peroxiredoxins and glutathione (GSH) peroxidases, SCO proteins, GSH transferases (GST, N-terminal domain), arsenic reductases, TRX-like ferredoxins and calsequestrin, among others. Probab=98.05 E-value=5.3e-06 Score=55.70 Aligned_cols=60 Identities=33% Similarity=0.803 Sum_probs=52.0 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHH---HHCCCCCCEEEEEECC Q ss_conf 999876997022213466665421000123332267232657777---6231568879999799 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST---RYQISSIPTLILFKDG 83 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~---~~~v~~~Pt~~~~~~g 83 (107) ++.||++||++|+.+.+.+.++ ......+.+..++++......+ ++++..+|+++++.+| T Consensus 1 l~~f~~~~~~~c~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~~~~ 63 (69) T cd01659 1 LVLFYAPWCPFCQALRPVLAEL-ALLNKGVKFEAVDVDEDPALEKELKRYGVGGVPTLVVFGPG 63 (69) T ss_pred CCEEECCCCHHHHHHHHHHHHH-HHHCCCCEEEEEECCCCHHHHHHHHHCCCEECCEEEEEECC T ss_conf 9479998887889767999999-97779987999989998678888886795632789999899 No 104 >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). All members contain a redox-active CXXC motif and may function as PDOs. The archaeal proteins Mj0307 and Mt807 show structures more similar to GRX, but activities more similar to TRX. Some members of the family are similar to PfPDO in that they contain a second CXXC motif located in a second TRX-fold subdomain at the N-terminus; the superimposable N- and C-terminal TRX subdomains form a compact structure. PfPDO is postulated to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI). The C-terminal CXXC motif of PfPDO is required for its oxidase, reductase and isomerase activities. Also included in the family is the C-terminal TRX-fold subdomain of the N-terminal domain (NTD) of bacteri Probab=97.98 E-value=1.1e-05 Score=53.94 Aligned_cols=60 Identities=22% Similarity=0.421 Sum_probs=52.4 Q ss_pred EEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEE Q ss_conf 998769970222134666654210001233322672326577776231568879999799898 Q gi|254780822|r 24 VDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVI 86 (107) Q Consensus 24 v~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~ 86 (107) =.|.++.|++|-.....+++++.. .+++..-.+|+..+++++++|+|+++|++++ ||+.. T Consensus 4 ~vfvS~sCp~CP~~v~~~~~~a~~-n~~I~~~~id~~~~~~~~~~y~V~~VP~ivi--n~~~~ 63 (67) T cd02973 4 EVFVSPTCPYCPDAVQAANRIAAL-NPNISAEMIDAAEFPDLADEYGVMSVPAIVI--NGKVE 63 (67) T ss_pred EEEECCCCCCCHHHHHHHHHHHHH-CCCEEEEEEECCCCHHHHHHCCCCCCCEEEE--CCEEE T ss_conf 999769999978999999999976-8980899999954987999769876898999--99988 No 105 >PRK10954 periplasmic protein disulfide isomerase I; Provisional Probab=97.98 E-value=1.7e-05 Score=52.74 Aligned_cols=40 Identities=25% Similarity=0.710 Sum_probs=30.4 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCC Q ss_conf 899499998769970222134666---6542100012333226 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKL 57 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~v 57 (107) ++++-++.|++=+||||..+.|.+ +...+..++.+.|.++ T Consensus 36 ~~~~eV~EfFsy~CpHCy~fEp~l~i~~~~~k~lp~~v~f~r~ 78 (207) T PRK10954 36 AGAPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKY 78 (207) T ss_pred CCCCCEEEEEEECCCCHHHCCHHCCCHHHHHHHCCCCCEEEEE T ss_conf 9997089999746972551070015169999748999789996 No 106 >pfam11009 DUF2847 Protein of unknown function (DUF2847). Some members in this bacterial family of proteins with unknown function are annotated as YtxJ, a putative general stress protein. This cannot be confirmed. Probab=97.96 E-value=6.6e-05 Score=49.42 Aligned_cols=93 Identities=18% Similarity=0.312 Sum_probs=72.3 Q ss_pred CHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH----HHHHHHCCC-CCCEEEEE Q ss_conf 767799999848-994999987699702221346666542100012333226723265----777762315-68879999 Q gi|254780822|r 7 DTKSFDSEVLEC-SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS----EISTRYQIS-SIPTLILF 80 (107) Q Consensus 7 ~~~~f~~~v~~~-~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~----~l~~~~~v~-~~Pt~~~~ 80 (107) |.++|++.+..+ ++|++|.=+++.|+-+.+....+++........+.++.+|+-+++ .++++|+|. --|.++++ T Consensus 5 t~~ql~~i~~~S~~~pv~ifKHSt~C~IS~~a~~~~e~~~~~~~~~~~~y~ldv~~~R~vSn~IAe~~~V~HESPQ~ivi 84 (104) T pfam11009 5 TEEQLDEIIEESKEKPVLIFKHSTTCPISRMALKQFEAFAEEDEEDLPVYYLDVQEYRDVSNEIAEKFGVKHESPQVIVI 84 (104) T ss_pred CHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEECCHHHHHHHHHHCCCCCCCCEEEE T ss_conf 89999999996689828999439987210999999998862552348879999641855789999995996689818999 Q ss_pred ECCEEEEEEECCCCCHHHH Q ss_conf 7998985887489998999 Q gi|254780822|r 81 KDGKVIDRMMPGASSQSDI 99 (107) Q Consensus 81 ~~g~~~~~~~~g~~~~~~l 99 (107) ++|+.+...-....+.+.| T Consensus 85 ~~G~~v~~~SH~~It~~~l 103 (104) T pfam11009 85 KNGEVVWHASHWDITADAL 103 (104) T ss_pred ECCEEEEECCCCCCCHHHC T ss_conf 8997999665012798774 No 107 >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells. It forms homodimers and higher oligomers in vitro and in vivo. It contains a redox inactive TRX-like domain at the N-terminus, which is homologous to the redox active TRX (a) domains of PDI, and a C-terminal helical domain similar to the C-terminal domain of P5. The expression profile of ERp29 suggests a role in secretory protein production distinct from that of PDI. It has also been identified as a member of the thyroglobulin folding complex. The Drosophila homolog, Wind, is the product of windbeutel, an essential gene in the development of dorsal-ventral patterning. Wind is required for correct targeting of Pipe, a Golgi-resident type II transmembrane protein with homology to 2-O-sulfotransferase. Probab=97.96 E-value=3e-05 Score=51.36 Aligned_cols=101 Identities=19% Similarity=0.320 Sum_probs=75.1 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHC-C--CCCCCCCCCC-----CCCHHHHHHHCCC-- Q ss_conf 1775767799999848994999987699702221346666542100-0--1233322672-----3265777762315-- Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADEL-A--DKVKITKLDI-----EESSEISTRYQIS-- 72 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~-~--~~i~~~~vd~-----d~~~~l~~~~~v~-- 72 (107) .+.|++-+|.+ +...-+.+||.|= |--|--.-...|.+++++. + +.+.++.|-+ .+|.+|+++|+|. T Consensus 3 cV~LD~~tFdK-vi~~f~~~lVKFD--~ayPYGeKhdaF~~~a~~~~~~~~dlLVAeVGikDYGek~N~~L~~Ry~v~~e 79 (116) T cd03007 3 CVDLDTVTFYK-VIPKFKYSLVKFD--TAYPYGEKHEAFTRLAESSASATDDLLVAEVGIKDYGEKLNMELGERYKLDKE 79 (116) T ss_pred CEECCHHHHHH-HHCCCCEEEEEEE--CCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCHH T ss_conf 15311110555-0113761799971--34777622799999999972266652899956664563656999987099820 Q ss_pred CCCEEEEEECCEEE-EEEECC-CCCHHHHHHHHHHC Q ss_conf 68879999799898-588748-99989999999841 Q gi|254780822|r 73 SIPTLILFKDGKVI-DRMMPG-ASSQSDIIEWILSR 106 (107) Q Consensus 73 ~~Pt~~~~~~g~~~-~~~~~g-~~~~~~l~~~i~~~ 106 (107) .+|.+.+|.+|..- +..+.| ..+.+.|..|+.+| T Consensus 80 ~fP~~~LF~~g~~e~p~~~~~~d~t~d~l~~fvk~n 115 (116) T cd03007 80 SYPVIYLFHGGDFENPVPYSGADVTVDALQRFLKGN 115 (116) T ss_pred HCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHCC T ss_conf 097799863898778616786662599999998637 No 108 >KOG3425 consensus Probab=97.96 E-value=1.7e-05 Score=52.83 Aligned_cols=75 Identities=24% Similarity=0.538 Sum_probs=57.9 Q ss_pred HHHHHHHHH--HCCCCEEEEEEC--------CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-------CHHHHHHHC Q ss_conf 677999998--489949999876--------997022213466665421000123332267232-------657777623 Q gi|254780822|r 8 TKSFDSEVL--ECSNPVVVDFWA--------SWCRPCVKLSPIIDDIADELADKVKITKLDIEE-------SSEISTRYQ 70 (107) Q Consensus 8 ~~~f~~~v~--~~~~~vlv~f~a--------~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~-------~~~l~~~~~ 70 (107) .+.|++.+. ++++.++|.|++ +|||.|.+..|++.+.-++.+.++.|+.+++-+ +.......+ T Consensus 12 ~e~~~~~~~~~~n~~~ifvlF~gskd~~tGqSWCPdCV~AEPvi~~alk~ap~~~~~v~v~VG~rp~Wk~p~n~FR~d~~ 91 (128) T KOG3425 12 YESFEETLKNVENGKTIFVLFLGSKDDTTGQSWCPDCVAAEPVINEALKHAPEDVHFVHVYVGNRPYWKDPANPFRKDPG 91 (128) T ss_pred HHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCC T ss_conf 89999999987278669999965668888983782187763899999973877617999970687741489985434987 Q ss_pred C-CCCCEEEEEEC Q ss_conf 1-56887999979 Q gi|254780822|r 71 I-SSIPTLILFKD 82 (107) Q Consensus 71 v-~~~Pt~~~~~~ 82 (107) + .++||++=+++ T Consensus 92 ~lt~vPTLlrw~~ 104 (128) T KOG3425 92 ILTAVPTLLRWKR 104 (128) T ss_pred CEEECCEEEEECC T ss_conf 4140334368737 No 109 >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO. They are proteins serving a critical role in the assembly of multimeric [NiFe] hydrogenases, the enzymes that catalyze the oxidation of molecular hydrogen to enable microorganisms to utilize hydrogen as the sole energy source. The E. coli HyaE protein is a chaperone that specifically interacts with the twin-arginine translocation (Tat) signal peptide of the [NiFe] hydrogenase-1 beta subunit precursor. Tat signal peptides target precursor proteins to the Tat protein export system, which facilitates the transport of fully folded proteins across the inner membrane. HyaE may be involved in regulating the traffic of [NiFe] hydrogenase-1 on the Tat transport pathway. Probab=97.93 E-value=3.9e-05 Score=50.70 Aligned_cols=89 Identities=16% Similarity=0.426 Sum_probs=67.4 Q ss_pred ECHHHHHHHHHHCCCCEEEEEECCCCHHHHH-----HHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEE Q ss_conf 5767799999848994999987699702221-----34666654210001233322672326577776231568879999 Q gi|254780822|r 6 VDTKSFDSEVLECSNPVVVDFWASWCRPCVK-----LSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80 (107) Q Consensus 6 i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~-----~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~ 80 (107) ++..++... +......++ |.+. -|++. ...++-++.+++.+.+..+.++.+...+|..+||+..+|++++| T Consensus 15 vd~~~~d~~-~~~~~~~vl-fl~g--Dp~R~pE~~DvaVVLPEL~~~f~~~~~~Avv~~~~E~~l~~rfgv~~~Pallf~ 90 (111) T cd02965 15 VDAATLDDW-LAAGGDLVL-LLAG--DPVRFPEVLDVAVVLPELLKAFPGRFRAAVVGRADEQALAARFGVLRTPALLFF 90 (111) T ss_pred CCCCCHHHH-HHCCCCEEE-EECC--CCCCCCCCCCHHHCCHHHHHHHHCCCEEEEECHHHHHHHHHHHCCCCCCEEEEE T ss_conf 045236778-747884899-9589--976586622223130999998517331878575889999997397547759999 Q ss_pred ECCEEEEEEECCCCCHHHH Q ss_conf 7998985887489998999 Q gi|254780822|r 81 KDGKVIDRMMPGASSQSDI 99 (107) Q Consensus 81 ~~g~~~~~~~~g~~~~~~l 99 (107) ++|+.+.. ..|.++-++. T Consensus 91 r~G~~vg~-i~gi~dW~eY 108 (111) T cd02965 91 RDGRYVGV-LAGIRDWDEY 108 (111) T ss_pred ECCEEEEE-ECCCCCHHHH T ss_conf 89988130-3252449988 No 110 >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1. TRP14 catalyzes the reduction of small disulfide-containing peptides but does not reduce disulfides of ribonucleotide reductase, peroxiredoxin and methionine sulfoxide reductase, which are TRX1 substrates. TRP14 also plays a role in tumor necrosis factor (TNF)-alpha signaling pathways, distinct from that of TRX1. Its depletion promoted TNF-alpha induced activation of c-Jun N-terminal kinase and mitogen-activated protein kinases. Probab=97.92 E-value=2e-05 Score=52.45 Aligned_cols=91 Identities=22% Similarity=0.515 Sum_probs=59.8 Q ss_pred HHHHHHHHH-CCCCEEEEEEC-------CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-------HHHHHHHCC-C Q ss_conf 779999984-89949999876-------9970222134666654210001233322672326-------577776231-5 Q gi|254780822|r 9 KSFDSEVLE-CSNPVVVDFWA-------SWCRPCVKLSPIIDDIADELADKVKITKLDIEES-------SEISTRYQI-S 72 (107) Q Consensus 9 ~~f~~~v~~-~~~~vlv~f~a-------~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~-------~~l~~~~~v-~ 72 (107) ++|.+.+.+ .+++++|.|++ +||+.|.+..|++++..++.+++..|+.+.+-+- ...-....+ . T Consensus 10 eef~~~~~~~~~k~ifi~F~g~~d~~G~SWCPDCv~AePvv~~~~~~~~~~~~~i~v~VG~R~~Wkdp~n~fR~~~~~~~ 89 (119) T cd02952 10 EEFLKLLKSHEGKPIFILFYGDKDPDGQSWCPDCVKAEPVVREALKAAPEDCVFIYCDVGDRPYWRDPNNPFRTDPKLTT 89 (119) T ss_pred HHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCC T ss_conf 99999999706987999996776999694790087716899999971898866999997683712799997666943014 Q ss_pred CCCEEEEEECCEEEEEEECCCCCHHHHHHH Q ss_conf 688799997998985887489998999999 Q gi|254780822|r 73 SIPTLILFKDGKVIDRMMPGASSQSDIIEW 102 (107) Q Consensus 73 ~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~ 102 (107) ++||++-++.. .|...+.....++.+. T Consensus 90 ~iPTLirw~~~---~rL~~~~c~~~dlv~~ 116 (119) T cd02952 90 GVPTLLRWKTP---QRLVEDECLQADLVEM 116 (119) T ss_pred CCCEEEECCCC---CCCCHHHHCCHHHHHH T ss_conf 88638961882---2146544349899999 No 111 >pfam07912 ERp29_N ERp29, N-terminal domain. ERp29 is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle. The protein exists as a homodimer, with each monomer being composed of two domains. The N-terminal domain featured in this family is organized into a thioredoxin-like fold that resembles the a domain of human protein disulphide isomerase (PDI). However, this domain lacks the C-X-X-C motif required for the redox function of PDI; it is therefore thought that ERp29's function is similar to the chaperone function of PDI. The N-terminal domain is exclusively responsible for the homodimerization of the protein, without covalent linkages or additional contacts with other domains. Probab=97.90 E-value=7.6e-05 Score=49.04 Aligned_cols=101 Identities=20% Similarity=0.320 Sum_probs=74.9 Q ss_pred EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHH-CC--CCCCCCCCCC-----CCCHHHHHHHCCC-- Q ss_conf 177576779999984899499998769970222134666654210-00--1233322672-----3265777762315-- Q gi|254780822|r 3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADE-LA--DKVKITKLDI-----EESSEISTRYQIS-- 72 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~-~~--~~i~~~~vd~-----d~~~~l~~~~~v~-- 72 (107) .+.|++-+|.+ +...-+.++|.|= |--|--.-...|.+++++ .+ +.+.++.|-+ .+|.+|+++|+|. T Consensus 6 cV~LD~~tFdK-vv~~f~~~lVKFD--vayPYGeKHdaF~~~A~ea~~~~~dlLvAeVGikDYGekeN~~L~~ry~v~~e 82 (126) T pfam07912 6 CVDLDTVTFYK-VIPKFKYSLVKFD--TAYPYGEKHEAFTRLAKENSASTEELLVAEVGIKDYGEKLNMELGERYKLDKE 82 (126) T ss_pred EEECCHHHHHH-HHCCCCEEEEEEE--CCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCC T ss_conf 68622110555-1213761799972--34777622799999999872466542899956664673667999987198845 Q ss_pred CCCEEEEEECCEEEEEEE--CCCCCHHHHHHHHHHC Q ss_conf 688799997998985887--4899989999999841 Q gi|254780822|r 73 SIPTLILFKDGKVIDRMM--PGASSQSDIIEWILSR 106 (107) Q Consensus 73 ~~Pt~~~~~~g~~~~~~~--~g~~~~~~l~~~i~~~ 106 (107) .+|.+.+|++|..-+-.+ .|..+.+.|.+|+.+| T Consensus 83 ~fP~i~LF~~~~~~pv~~~~~~d~t~dnl~~fvk~~ 118 (126) T pfam07912 83 SYPVIYLFRGDLENPVLYPSNGAVTVDALQRFLKGQ 118 (126) T ss_pred CCCEEEEECCCCCCCEECCCCCCCCHHHHHHHHHHC T ss_conf 497899953899785436766870699999999839 No 112 >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI, calsequestrin and other PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5 and PDIR. PDI, ERp57, ERp72, P5 and PDIR are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and one or more redox inactive TRX-like (b) domains. The molecular structure of PDI is abb'a'. Also included in this family is the PDI-related protein ERp27, w Probab=97.89 E-value=7.7e-05 Score=49.00 Aligned_cols=97 Identities=13% Similarity=0.242 Sum_probs=75.2 Q ss_pred HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCC--CCCEEEEEECCEEE Q ss_conf 7799999848994999987699702221346666542100012333226723265777762315--68879999799898 Q gi|254780822|r 9 KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS--SIPTLILFKDGKVI 86 (107) Q Consensus 9 ~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~--~~Pt~~~~~~g~~~ 86 (107) .++..- ..+++|.++.|+.+.-+.-..+...+.++|+++++++.|+.+|.+++....+.||+. ..|.+.+....... T Consensus 3 ~~~~~~-~~~~~p~~~lF~~~~~~~~~~~~~~~~~vAk~~kgki~Fv~~d~~~~~~~l~~~gl~~~~~P~~~i~~~~~~~ 81 (103) T cd02982 3 ETFFNY-EESGKPLLVLFYNKDDSESEELRERFKEVAKKFKGKLLFVVVDADDFGRHLEYFGLKEEDLPVIAIINLSDGK 81 (103) T ss_pred HHHHHH-HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHCCCCCCCCCEEEEEECCCCC T ss_conf 028889-8659987999956980559999999999999821727899970287288999859984549769998633067 Q ss_pred EEEECC-CCCHHHHHHHHHHC Q ss_conf 588748-99989999999841 Q gi|254780822|r 87 DRMMPG-ASSQSDIIEWILSR 106 (107) Q Consensus 87 ~~~~~g-~~~~~~l~~~i~~~ 106 (107) ...... ..+.+.|.+|+++- T Consensus 82 Ky~~~~~~~~~e~l~~F~~~~ 102 (103) T cd02982 82 KYLMPEEELTAESLEEFVEDF 102 (103) T ss_pred CCCCCCCCCCHHHHHHHHHHH T ss_conf 568985656999999999974 No 113 >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus. They are implicated in the formation of the cement gland and the induction of forebrain fate. The human homologs, hAG-2 and hAG-3, are secreted proteins associated with estrogen-positive breast tumors. Yeast two-hybrid studies identified the metastasis-associated C4.4a protein and dystroglycan as binding partners, indicating possible roles in the development and progression of breast cancer. hAG-2 has also been implicated in prostate cancer. Its gene was cloned as an androgen-inducible gene and it was shown to be overexpressed in prostate cancer cells at the mRNA and protein levels. AGR proteins contain one conserved cysteine corresponding to the first cysteine in the CXXC motif of TRX. They show high sequence similarity to ERp19. Probab=97.89 E-value=1.3e-05 Score=53.39 Aligned_cols=69 Identities=13% Similarity=0.200 Sum_probs=47.5 Q ss_pred HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHH--CCCCCCCCCCCCCCCHHHHHHHCCC--CCCEEEEEE-CCEE Q ss_conf 984899499998769970222134666654210--0012333226723265777762315--688799997-9989 Q gi|254780822|r 15 VLECSNPVVVDFWASWCRPCVKLSPIIDDIADE--LADKVKITKLDIEESSEISTRYQIS--SIPTLILFK-DGKV 85 (107) Q Consensus 15 v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~--~~~~i~~~~vd~d~~~~l~~~~~v~--~~Pt~~~~~-~g~~ 85 (107) ..+++||++|.++.+||++|++++|.|.+-.+- +. +=.|+-||+++.+.= +.|..- .+|.++|.. +|.. T Consensus 19 ak~s~KPlMvIiH~~~C~~c~aLKk~Fa~s~eI~~la-~e~FVMvNl~~E~~d-~~~~pDG~YvPRIlFlDp~g~V 92 (130) T cd02960 19 AKKSNKPLMVIHHLEDCPHSQALKKAFAEHKEIQKLA-QEDFIMLNLVHETTD-KNLSPDGQYVPRIMFVDPSLTV 92 (130) T ss_pred HHHCCCCEEEEEECCCCHHHHHHHHHHHCCHHHHHHH-HCCEEEEECCCCCCC-CCCCCCCCEECCEEEECCCCCC T ss_conf 9972999799986023867899999860579899873-557689965657874-3449998636438998999858 No 114 >KOG3414 consensus Probab=97.88 E-value=0.00012 Score=47.97 Aligned_cols=96 Identities=23% Similarity=0.450 Sum_probs=74.8 Q ss_pred HHHHHHHHH-CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEE Q ss_conf 779999984-8994999987699702221346666542100012333226723265777762315688799997998985 Q gi|254780822|r 9 KSFDSEVLE-CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVID 87 (107) Q Consensus 9 ~~f~~~v~~-~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~ 87 (107) ..-++.++. +.+.+++.|..+|-+.|..|...+.+.++...+-+.++-+|+|+-++..+.|++...||+++|-+++-+. T Consensus 12 ~~VdqaI~~t~~rlvViRFGr~~Dp~C~~mD~~L~~i~~~vsnfa~IylvdideV~~~~~~~~l~~p~tvmfFfn~kHmk 91 (142) T KOG3414 12 WEVDQAILSTEERLVVIRFGRDWDPTCMKMDELLSSIAEDVSNFAVIYLVDIDEVPDFVKMYELYDPPTVMFFFNNKHMK 91 (142) T ss_pred HHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCEEEEEEECCHHHHHHHHHCCCCCCEEEEEECCCEEE T ss_conf 77777874442169999955889804766988999999997504489998422036665332256786689998384689 Q ss_pred EEEC-C--------CCCHHHHHHHHH Q ss_conf 8874-8--------999899999998 Q gi|254780822|r 88 RMMP-G--------ASSQSDIIEWIL 104 (107) Q Consensus 88 ~~~~-g--------~~~~~~l~~~i~ 104 (107) --++ | ..+++++++.++ T Consensus 92 iD~gtgdn~Kin~~~~~kq~~Idiie 117 (142) T KOG3414 92 IDLGTGDNNKINFAFEDKQEFIDIIE 117 (142) T ss_pred EEECCCCCCEEEEEECCHHHHHHHHH T ss_conf 86079987668888425899999999 No 115 >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides. AhpF contains an NTD containing two contiguous TRX-fold subdomains similar to Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). It also contains a catalytic core similar to TRX reductase containing FAD and NADH binding domains with an active site disulfide. The proposed mechanism of action of AhpF is similar to a TRX/TRX reductase system. The flow of reducing equivalents goes from NADH - catalytic core of AhpF - NTD of AhpF - AhpC - peroxide substrates. The catalytic CXXC motif of the NTD of AhpF is contained in its C-terminal TRX subdomain. Probab=97.85 E-value=9.8e-05 Score=48.41 Aligned_cols=81 Identities=14% Similarity=0.210 Sum_probs=64.9 Q ss_pred HHHCCC-CEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCC Q ss_conf 984899-4999987699702221346666542100012333226723265777762315688799997998985887489 Q gi|254780822|r 15 VLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGA 93 (107) Q Consensus 15 v~~~~~-~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~ 93 (107) +.+=++ .-+=.|-++.|+.|-.....+..+|-..+ ++.--.+|+..+++++++|+|+++|++++ ||+.. +.|- T Consensus 7 i~~i~~~~~i~vfVSlsC~~CP~vV~a~~~~A~~Np-~I~~~~iD~~~f~d~~~~~~ImsVP~vvi--N~e~~---~~G~ 80 (89) T cd03026 7 IRRLNGPINFETYVSLSCHNCPDVVQALNLMAVLNP-NIEHEMIDGALFQDEVEERGIMSVPAIFL--NGELF---GFGR 80 (89) T ss_pred HHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCC-CCEEEEEEHHHCHHHHHHCCCCCCCEEEE--CCEEE---EECC T ss_conf 985699768999982899997899999999998699-81699998064788999759644897999--99677---4065 Q ss_pred CCHHHHHH Q ss_conf 99899999 Q gi|254780822|r 94 SSQSDIIE 101 (107) Q Consensus 94 ~~~~~l~~ 101 (107) .+.++|.+ T Consensus 81 ~~~~ell~ 88 (89) T cd03026 81 MTLEEILA 88 (89) T ss_pred CCHHHHHC T ss_conf 15998942 No 116 >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1. Like Dim1, it is also implicated in pre-mRNA splicing and cell cycle progression. DLP is located in the nucleus and has been shown to interact with the U5 small nuclear ribonucleoprotein particle (snRNP)-specific 102kD protein (or Prp6). Dim1 protein, also known as U5 snRNP-specific 15kD protein is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif. Probab=97.83 E-value=0.00011 Score=48.12 Aligned_cols=96 Identities=21% Similarity=0.354 Sum_probs=74.5 Q ss_pred HHHHHHHH-HCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEE Q ss_conf 77999998-48994999987699702221346666542100012333226723265777762315688799997998985 Q gi|254780822|r 9 KSFDSEVL-ECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVID 87 (107) Q Consensus 9 ~~f~~~v~-~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~ 87 (107) ++-.+.++ +..+.++|.|..+|-+.|.+|...|.+.++..++-..++-+|+++-|+..+.|.+...|++++|-+++-+- T Consensus 3 ~~VDqAI~~e~drvvViRFGr~~d~~Cm~mDeiL~k~a~~v~nfAviYlvDid~Vpdf~~myeL~~~p~t~FFfrnkHm~ 82 (114) T cd02986 3 KEVDQAIKSTAEKVLVLRFGRDEDAVCLQLDDILSKTSHDLSKMASIYLVDVDKVPVYTQYFDISYIPSTIFFFNGQHMK 82 (114) T ss_pred HHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHCEECCCCCEEEEEECCCEEE T ss_conf 56667763656369999846999934988989999999987461499998377576332103425797799998584789 Q ss_pred EEEC-C--------CCCHHHHHHHHH Q ss_conf 8874-8--------999899999998 Q gi|254780822|r 88 RMMP-G--------ASSQSDIIEWIL 104 (107) Q Consensus 88 ~~~~-g--------~~~~~~l~~~i~ 104 (107) --++ | ..++++++..|+ T Consensus 83 ~D~GTgnnnK~n~~~~~KQe~IDiiE 108 (114) T cd02986 83 VDYGSPDHTKFVGSFKTKQDFIDLIE 108 (114) T ss_pred EECCCCCCCEEEEEECCHHHHHHHHH T ss_conf 86179987789887085467889999 No 117 >pfam02966 DIM1 Mitosis protein DIM1. Probab=97.81 E-value=1e-04 Score=48.37 Aligned_cols=93 Identities=22% Similarity=0.303 Sum_probs=73.5 Q ss_pred HHHH-HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEE Q ss_conf 9999-848994999987699702221346666542100012333226723265777762315688799997998985887 Q gi|254780822|r 12 DSEV-LECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMM 90 (107) Q Consensus 12 ~~~v-~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~ 90 (107) .+.+ .+.++.++|.|..+|-+.|.+|...|.+.++..++-..++-+|+++-|+..+.|.+...||+++|-+++-+---+ T Consensus 12 DqAI~~e~drvvViRFGr~~d~~Cm~mDeiL~~~a~~v~nfA~iYlvDi~~Vp~fn~myeL~dp~tvmFFfrnkHm~vD~ 91 (133) T pfam02966 12 DQAILSEEDRLVVIRFGRDDDPVCMQMDEILAKIAEKLSNFAVIYLVDIDEVPDFNKMYELYDPSTVMFFFRNKHMMCDF 91 (133) T ss_pred HHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHCEECCCCCEEEEEECCCEEEEEC T ss_conf 78774666369999836899927888878999999986371499998554361233002135686799998585789860 Q ss_pred C--------C-CCCHHHHHHHHH Q ss_conf 4--------8-999899999998 Q gi|254780822|r 91 P--------G-ASSQSDIIEWIL 104 (107) Q Consensus 91 ~--------g-~~~~~~l~~~i~ 104 (107) + + ..++++++..++ T Consensus 92 GTgnnnK~n~~~~~KQe~IDiiE 114 (133) T pfam02966 92 GTGDNNKLNFAFEDKQEFIDIIE 114 (133) T ss_pred CCCCCCEEEEECCCHHHHHHHHH T ss_conf 79987689886185788999999 No 118 >cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. The C-terminal domain is likely involved in substrate binding, similar to the b and b' domains of PDI. Probab=97.72 E-value=0.00018 Score=46.83 Aligned_cols=103 Identities=15% Similarity=0.237 Sum_probs=79.5 Q ss_pred EEEEC-HHHHHHHHHHCCCCEEEEEEC---CCCHHHH-HHHHHHHHHHHHCCCC-CCCCCCCCCCCHHHHHHHCC--CCC Q ss_conf 17757-677999998489949999876---9970222-1346666542100012-33322672326577776231--568 Q gi|254780822|r 3 ALKVD-TKSFDSEVLECSNPVVVDFWA---SWCRPCV-KLSPIIDDIADELADK-VKITKLDIEESSEISTRYQI--SSI 74 (107) Q Consensus 3 ~i~i~-~~~f~~~v~~~~~~vlv~f~a---~wC~~C~-~~~p~~~~l~~~~~~~-i~~~~vd~d~~~~l~~~~~v--~~~ 74 (107) ++|++ ++.|++. =.++..++|-|-- +.-..|+ .....+.+++++|+++ +.|+.++..+++++-+.++| .++ T Consensus 4 v~el~s~~~~~~~-C~~~~lCviafLP~ilD~~a~~Rn~yl~~l~~~a~k~k~~p~~~~W~eag~Q~~lE~~l~vg~~Gy 82 (130) T cd02983 4 IIELTSEDVFEET-CEEKQLCIIAFLPHILDCQASCRNKYLEILKSVAEKFKKKPWGWLWTEAGAQLDLEEALNIGGFGY 82 (130) T ss_pred CEEECCHHHHHHH-CCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHCCCCCCC T ss_conf 3565499999865-578985999972831137788999999999999999617974699954765887998618677898 Q ss_pred CEEEEEECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 87999979989858874899989999999841 Q gi|254780822|r 75 PTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 75 Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) |+++.+...+.....+.|.-+.+.|.+|+.+- T Consensus 83 Pa~valn~~K~~ya~~rGsFs~~~i~eFl~~v 114 (130) T cd02983 83 PAMVAINFRKMKFATLKGSFSEDGINEFLREL 114 (130) T ss_pred CEEEEEECCCCHHHHHHCCCCHHHHHHHHHHH T ss_conf 36899712333446763666787899999998 No 119 >PRK11200 grxA glutaredoxin 1; Provisional Probab=97.71 E-value=0.00015 Score=47.34 Aligned_cols=75 Identities=20% Similarity=0.442 Sum_probs=53.6 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC----HHHHHHHC--CCCCCEEEEEECCEEEEEEECCCCCH Q ss_conf 9998769970222134666654210001233322672326----57777623--15688799997998985887489998 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES----SEISTRYQ--ISSIPTLILFKDGKVIDRMMPGASSQ 96 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~----~~l~~~~~--v~~~Pt~~~~~~g~~~~~~~~g~~~~ 96 (107) ++.|..++||+|.+.+.-++++..++.+ +.+..+|.+.. .++....+ ++.+|.+++ +|+- .+| - T Consensus 3 V~Iysk~~CpyC~~AK~Ll~~l~~~~~~-~~~~~idi~~~~~~~~~l~~~~g~~~~TVPQIfI--~g~~----IGG---y 72 (87) T PRK11200 3 VVIFGRPGCPYCVRAKELAEKLSEERDD-FDYRYVDIHAEGISKADLEKTVGKPVETVPQIFV--DQKH----IGG---C 72 (87) T ss_pred EEEEECCCCHHHHHHHHHHHHHCCCCCC-CCEEEEECCCCHHHHHHHHHHHCCCCCCCCEEEE--CCEE----ECC---H T ss_conf 9998189986699999999982533576-2079972677767899999984899874387989--9998----539---9 Q ss_pred HHHHHHHHHCC Q ss_conf 99999998419 Q gi|254780822|r 97 SDIIEWILSRV 107 (107) Q Consensus 97 ~~l~~~i~~~l 107 (107) +++.+|+++++ T Consensus 73 ~dL~~~~~en~ 83 (87) T PRK11200 73 TDFEAYVKENL 83 (87) T ss_pred HHHHHHHHHCC T ss_conf 99999998544 No 120 >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, cou Probab=97.67 E-value=0.00015 Score=47.40 Aligned_cols=68 Identities=15% Similarity=0.350 Sum_probs=47.8 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHH----CCCCCCEEEEEECCEEEEEEECCCCCHHH Q ss_conf 99987699702221346666542100012333226723265777762----31568879999799898588748999899 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY----QISSIPTLILFKDGKVIDRMMPGASSQSD 98 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~----~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~ 98 (107) ++.|..+||++|++.+..|++. .+.|..+|++++++..+.+ |.+++|++++ +|+ .+.|. +++. T Consensus 2 I~iYt~~~C~~C~~ak~~L~~~------gi~y~~~di~~d~~~~~~l~~~~g~~~vP~i~i--~~~----~i~Gf-~~~~ 68 (73) T cd02976 2 VTVYTKPDCPYCKATKRFLDER------GIPFEEVDVDEDPEALEELKKLNGYRSVPVVVI--GDE----HLSGF-RPDK 68 (73) T ss_pred EEEECCCCCHHHHHHHHHHHHC------CCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEE--CCE----EEECC-CHHH T ss_conf 9999189997799999999983------990499987999999999998659996188999--999----99387-9999 Q ss_pred HHHHH Q ss_conf 99999 Q gi|254780822|r 99 IIEWI 103 (107) Q Consensus 99 l~~~i 103 (107) |.+.| T Consensus 69 l~~~l 73 (73) T cd02976 69 LRALL 73 (73) T ss_pred HHHHC T ss_conf 99649 No 121 >cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI, calsequestrin and other PDI-related proteins like ERp72, ERp57, ERp44 and PDIR. PDI, ERp57 (or ERp60), ERp72 and PDIR are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and one or more redox inactive TRX-like (b) domains. The molecular structure of PDI is abb'a'. Also included in this family is the PDI-related protein ERp27, which contai Probab=97.67 E-value=0.00035 Score=45.23 Aligned_cols=96 Identities=17% Similarity=0.254 Sum_probs=72.0 Q ss_pred EEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC Q ss_conf 77576779999984899499998769970222134666654210001233322672326577776231568879999799 Q gi|254780822|r 4 LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG 83 (107) Q Consensus 4 i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g 83 (107) .+|++..--+..++++++++|-|+.+--+ .....|.++|..+.+.+.|+.+. ++++++.+++ ..|++++|+++ T Consensus 2 ~~l~s~~~~~~~~~~~~~~Vvg~f~~~~~---~~~~~f~~vA~~lr~~~~F~~~~---~~~~~~~~~~-~~~~i~l~k~~ 74 (97) T cd02981 2 KELTSKEELEKFLDKDDVVVVGFFKDEES---EEYKTFEKVAESLRDDYGFGHTS---DKEVAKKLKV-KPGSVVLFKPF 74 (97) T ss_pred CCCCCHHHHHHHHHCCCEEEEEEECCCCC---HHHHHHHHHHHHHHCCEEEEEEC---CHHHHHHCCC-CCCEEEEEEEC T ss_conf 22067999999972288199999668884---78999999999603460799987---8999997299-99959998467 Q ss_pred EEEEEEECCCCCHHHHHHHHHHC Q ss_conf 89858874899989999999841 Q gi|254780822|r 84 KVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 84 ~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) ..-...|.|..+.+.|.+||..+ T Consensus 75 ~~~~~~~~g~~~~~~l~~Fi~~~ 97 (97) T cd02981 75 EEEPVEYDGEFTEESLVEFIKDN 97 (97) T ss_pred CCCCCCCCCCCCHHHHHHHHHHC T ss_conf 98751268998989999999709 No 122 >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Probab=97.65 E-value=0.00019 Score=46.71 Aligned_cols=81 Identities=14% Similarity=0.258 Sum_probs=52.3 Q ss_pred CEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCC------------------------------------------CC- Q ss_conf 49999876997022213466665421000123332------------------------------------------26- Q gi|254780822|r 21 PVVVDFWASWCRPCVKLSPIIDDIADELADKVKIT------------------------------------------KL- 57 (107) Q Consensus 21 ~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~------------------------------------------~v- 57 (107) -++-.|..|.|++|+++....+...+.-+=+++.+ .+ T Consensus 121 ~~VyVFtDpnCpYC~kl~~~~~p~~~~g~v~vr~i~v~~l~~~S~~kaaaI~~A~Dp~~A~~~~e~~~~~~~~~~~~~ip 200 (253) T PRK11657 121 RVVYVFADPNCPYCKQFWQQARPWVDSGKVQLRHILVGIIKPDSPAKAAAILAAKDPAKALQEYEASGGKLGLKPPASIP 200 (253) T ss_pred EEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCC T ss_conf 79999969798478999999776641595699999960458987899999980899999999987437655768788888 Q ss_pred -----CCCCCHHHHHHHCCCCCCEEEEEE-CCEEEEEEECCCCCHHHHHHHH Q ss_conf -----723265777762315688799997-9989858874899989999999 Q gi|254780822|r 58 -----DIEESSEISTRYQISSIPTLILFK-DGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 58 -----d~d~~~~l~~~~~v~~~Pt~~~~~-~g~~~~~~~~g~~~~~~l~~~i 103 (107) -+++|.+|.+++|++++|++++-. +|+. +...|..+.++|.+.+ T Consensus 201 ~~~~~~l~~n~~Lm~~lGi~GTPaIvy~d~~g~~--~~~~GlP~~~~L~~il 250 (253) T PRK11657 201 AAVRKQLADNQKLMDDLGANATPAIYYMDKDGTL--QQAVGLPDPAQLNEIM 250 (253) T ss_pred HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCE--EEECCCCCHHHHHHHH T ss_conf 8999999999999998399836669998799988--8861899989999862 No 123 >smart00594 UAS UAS domain. Probab=97.65 E-value=0.0004 Score=44.88 Aligned_cols=97 Identities=9% Similarity=0.214 Sum_probs=71.0 Q ss_pred HHHHHHHH---HHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCC--CHHHHHHHCCCCCCEEEE Q ss_conf 67799999---84899499998769970222134666---65421000123332267232--657777623156887999 Q gi|254780822|r 8 TKSFDSEV---LECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEE--SSEISTRYQISSIPTLIL 79 (107) Q Consensus 8 ~~~f~~~v---~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~--~~~l~~~~~v~~~Pt~~~ 79 (107) ..+|++.+ ....|+.+|++++++|..|..+...+ +.+.+-...++.|-..|++. ...++..|++.++|.+.+ T Consensus 13 ~gs~~~A~~~Ak~~~K~LlVylh~~~~~~~~~f~Rdvl~~~~V~~~i~~nfVfw~~d~~~~eg~~~~~~y~~~~~P~vai 92 (122) T smart00594 13 QGSLEAAKQEASRQRRLLWLYLHSQDSPDSQVFNRDVLCNEAVKSLIRENFIFWQVDVDTSEGQRVSQFYKLDSFPYVAI 92 (122) T ss_pred CCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCHHHHHHHHHCEEEEEECCCCHHHHHHHHHCCCCCCCEEEE T ss_conf 06999999999850672699993788543899999862788899999734889875168745999998628999997999 Q ss_pred E--ECCEE---EEEEECCCCCHHHHHHHHH Q ss_conf 9--79989---8588748999899999998 Q gi|254780822|r 80 F--KDGKV---IDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 80 ~--~~g~~---~~~~~~g~~~~~~l~~~i~ 104 (107) + +.|+. +-....|..+.+++..+++ T Consensus 93 idprtg~~~~~~~~~i~g~~~~~~l~~~l~ 122 (122) T smart00594 93 VDPRTGQRVIEWVGVVEGEISPEELMTFLE 122 (122) T ss_pred EECCCCCEEEEEEEEECCCCCHHHHHHHHC T ss_conf 927988700789988528889999998649 No 124 >PRK13728 conjugal transfer protein TrbB; Provisional Probab=97.61 E-value=0.00019 Score=46.74 Aligned_cols=87 Identities=17% Similarity=0.299 Sum_probs=61.7 Q ss_pred CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC----------CHHHHHH-HC--CCCCCEEEEEE-CCE Q ss_conf 9949999876997022213466665421000123332267232----------6577776-23--15688799997-998 Q gi|254780822|r 19 SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE----------SSEISTR-YQ--ISSIPTLILFK-DGK 84 (107) Q Consensus 19 ~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~----------~~~l~~~-~~--v~~~Pt~~~~~-~g~ 84 (107) .+.-+|.||...|++|.+++|.++.++..++=.+.-+.+|.-- -+++.+. |+ =..+|+.++.. +.. T Consensus 69 ~dy~lV~F~rS~CPyChqFAP~Lk~~a~~~gi~V~~~SlDG~g~~~FP~~lPaTpei~~tfF~n~~~~tPatFLvNvnT~ 148 (181) T PRK13728 69 ADWKVVLFMQGHCPYCHQFDPVLKQLAQQYGFSVFPYTLDGQGDTAFPEALPAPPDVMQTFFPNIPVATPTTFLVNVNTL 148 (181) T ss_pred CCEEEEEEECCCCCHHHHHCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCC T ss_conf 34189999738892577658899999998597179985369888788867779879999974789878861699733741 Q ss_pred EEEEEECCCCCHHHHHHHHHH Q ss_conf 985887489998999999984 Q gi|254780822|r 85 VIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 85 ~~~~~~~g~~~~~~l~~~i~~ 105 (107) ...-.+.|..+..++..-+++ T Consensus 149 ~ayPv~qG~~~~~~l~~R~d~ 169 (181) T PRK13728 149 EALPLLQGATDAAGFMARMDT 169 (181) T ss_pred CEECCCCCCCCHHHHHHHHHH T ss_conf 100111165578999999999 No 125 >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit. This enzyme is the partner of the peroxiredoxin (alkyl hydroperoxide reductase) AhpC which contains the peroxide-reactive cysteine. AhpF contains the reductant (NAD(P)H) binding domain (pfam00070) and presumably acts to resolve the disulfide which forms after oxidation of the active site cysteine in AphC. This proteins contains two paired conserved cysteine motifs, CxxCP and CxHCDGP. Probab=97.59 E-value=0.00061 Score=43.84 Aligned_cols=94 Identities=15% Similarity=0.243 Sum_probs=73.3 Q ss_pred EECHHHHHHHHHHCC-CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC Q ss_conf 757677999998489-9499998769970222134666654210001233322672326577776231568879999799 Q gi|254780822|r 5 KVDTKSFDSEVLECS-NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG 83 (107) Q Consensus 5 ~i~~~~f~~~v~~~~-~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g 83 (107) +++++..++ +.+=+ +.-+=.|-++.|..|=..-..++.++-..+ ++.--.||...++++.++|+|+++|++++ || T Consensus 103 ~l~~~~~~~-I~~i~~~~~~~~~vSlsC~~CPdvVqAln~~A~~Np-~I~~~miDg~~f~~~~~~~~I~sVP~v~~--n~ 178 (515) T TIGR03140 103 KLDEGIIDR-IRRLNGPLHFETYVSLTCQNCPDVVQALNQMALLNP-NISHTMIDGALFQDEVEALGIQGVPAVFL--NG 178 (515) T ss_pred CCCHHHHHH-HHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCC-CCEEEEEECHHCHHHHHHCCCCCCCEEEE--CC T ss_conf 989999999-984799823899984688898799999999986099-85299997210777898648674772777--88 Q ss_pred EEEEEEECCCCCHHHHHHHHHH Q ss_conf 8985887489998999999984 Q gi|254780822|r 84 KVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 84 ~~~~~~~~g~~~~~~l~~~i~~ 105 (107) +.. .+|-++.++|.+-+.. T Consensus 179 e~~---~~g~~~~~~~~~kl~~ 197 (515) T TIGR03140 179 EEF---HNGRMDLAELLEKLEE 197 (515) T ss_pred EEE---EECCCCHHHHHHHHHC T ss_conf 387---2256139999999855 No 126 >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds. It also displays chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp57 contains two redox-active TRX (a) domains and two redox inactive TRX-like (b) domains. It shares the same domain arrangement of abb'a' as PDI, but lacks the C-terminal acid-rich region (c domain) that is present in PDI. ERp57 interacts with the lectin chaperones, calnexin and calreticulin, and specifically promotes the oxidative folding of glycoproteins. Similar to PDI, the b domain of ERp57 is likely involved in binding to substrates. Probab=97.57 E-value=0.0007 Score=43.51 Aligned_cols=97 Identities=18% Similarity=0.276 Sum_probs=72.3 Q ss_pred CEEEEC-HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEE Q ss_conf 517757-6779999984899499998769970222134666654210001233322672326577776231568879999 Q gi|254780822|r 2 SALKVD-TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80 (107) Q Consensus 2 ~~i~i~-~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~ 80 (107) +.++|. .+++++. +++++.++|-|++.--. .....+.++|+.+.+++.|+-.. +.++.+.|++. +.+++| T Consensus 1 aS~el~t~~~~e~F-l~~~dv~VVGFF~~~ds---~~~~~Fl~~A~~lRd~~~Faht~---~~~v~~~~g~~--~~IVLf 71 (104) T cd03069 1 ASVELRTEAEFEKF-LSDDDASVVGFFEDEDS---KLLSEFLKAADTLRESFRFAHTS---DKQLLEKYGYG--EGVVLF 71 (104) T ss_pred CCEECCCHHHHHHH-HCCCCEEEEEEECCCCC---HHHHHHHHHHHHHHHCCEEEEEC---CHHHHHHHCCC--CCEEEE T ss_conf 97251779999987-36598699999837884---79999999999745255578748---29999981889--878998 Q ss_pred EC------CEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 79------9898588748999899999998419 Q gi|254780822|r 81 KD------GKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 81 ~~------g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) +. =++-...|.|..+.+.|.+||+.|+ T Consensus 72 rP~~l~nKFee~~~~y~g~~~~~~l~~Fik~N~ 104 (104) T cd03069 72 RPPRLSNKFEDSSVKFDGDLDSSKIKKFIRENI 104 (104) T ss_pred ECHHHHCCCCCCCCEECCCCCHHHHHHHHHHCC T ss_conf 325653002776430358678899999998529 No 127 >KOG3171 consensus Probab=97.35 E-value=0.0005 Score=44.32 Aligned_cols=101 Identities=21% Similarity=0.400 Sum_probs=75.5 Q ss_pred EEEEC-HHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 17757-67799999848--9949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 3 ALKVD-TKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 3 ~i~i~-~~~f~~~v~~~--~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) ++|++ .+.|...|-.. .-.++|..|-|.-.-|..+...+.=||.+|+ .++|+++-.. +-....+|...++||+++ T Consensus 140 V~El~~gkqfld~idke~ks~~i~VhIYEdgi~gcealn~~~~cLAAeyP-~vKFckikss-~~gas~~F~~n~lP~Lli 217 (273) T KOG3171 140 VYELETGKQFLDTIDKELKSTTIVVHIYEDGIKGCEALNSSLTCLAAEYP-IVKFCKIKSS-NTGASDRFSLNVLPTLLI 217 (273) T ss_pred EEEECCCHHHHHHHHCCCCEEEEEEEEECCCCCHHHHHHHHHHHHHCCCC-CEEEEEEEEC-CCCCHHHHCCCCCCEEEE T ss_conf 99951620478987403325899999824898427888656878650587-2367875202-434144430167745898 Q ss_pred EECCEEEEEEEC------CCCCHHHHHHHHHH Q ss_conf 979989858874------89998999999984 Q gi|254780822|r 80 FKDGKVIDRMMP------GASSQSDIIEWILS 105 (107) Q Consensus 80 ~~~g~~~~~~~~------g~~~~~~l~~~i~~ 105 (107) |++|+.+.-++. ..-....+.+|++. T Consensus 218 YkgGeLIgNFv~va~qlgedffa~dle~FL~e 249 (273) T KOG3171 218 YKGGELIGNFVSVAEQLGEDFFAGDLESFLNE 249 (273) T ss_pred EECCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 50872467899999997555526669999977 No 128 >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit. This family of thioredoxin reductase homologs is found adjacent to alkylhydroperoxide reductase C subunit predominantly in cases where there is only one C subunit in the genome and that genome is lacking the F subunit partner (also a thioredcxin reductase homolog) that is usually found (TIGR03140). Probab=97.31 E-value=0.0018 Score=41.19 Aligned_cols=92 Identities=15% Similarity=0.297 Sum_probs=72.3 Q ss_pred EECHHHHHHHHHHCCC-CEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC Q ss_conf 7576779999984899-499998769970222134666654210001233322672326577776231568879999799 Q gi|254780822|r 5 KVDTKSFDSEVLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG 83 (107) Q Consensus 5 ~i~~~~f~~~v~~~~~-~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g 83 (107) +++++..++ +..=++ .-+=.|.+-.|..|-..-..++.++-..+ ++.--.+|..-.+++.++|+|+++|++++ || T Consensus 462 ~~~~~~~~~-i~~~~~~~~~~~~vslsC~~CPdvV~a~~~~a~~np-~i~~~~id~~~f~~~~~~~~im~VP~~~~--n~ 537 (555) T TIGR03143 462 PLGEELLEK-IKKITKPVNIKIGVSLSCTLCPDVVLAAQRIASLNP-NVEAEMIDVSHFPDLKDEYGIMSVPAIVV--DD 537 (555) T ss_pred CCCHHHHHH-HHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCC-CCEEEEEEHHHCHHHHHHCCCCCCCEEEE--CC T ss_conf 989899999-984589726999997678898699999999997399-95199986363888898639653776999--99 Q ss_pred EEEEEEECCCCCHHHHHHHH Q ss_conf 89858874899989999999 Q gi|254780822|r 84 KVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 84 ~~~~~~~~g~~~~~~l~~~i 103 (107) +.+ ..|-++.++|.+.| T Consensus 538 ~~~---~~g~~~~~~il~~~ 554 (555) T TIGR03143 538 QQV---YFGKKTIEEMLELI 554 (555) T ss_pred EEC---CCCCCCHHHHHHHH T ss_conf 351---03635599999850 No 129 >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD; InterPro: IPR013478 MauD appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulphide bonds. MauD shares sequence similarity, including a CPxC motif, with a number of thiol:disulphide interchange proteins. In MauD mutants, the small subunit apparently does not form properly and is rapidly degraded .; GO: 0030416 methylamine metabolic process. Probab=97.30 E-value=0.00065 Score=43.69 Aligned_cols=85 Identities=31% Similarity=0.465 Sum_probs=59.9 Q ss_pred HCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCC--CC-----------------CHHHHHHHCCCCCCEE Q ss_conf 4899499998769970222134666654210001233322672--32-----------------6577776231568879 Q gi|254780822|r 17 ECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI--EE-----------------SSEISTRYQISSIPTL 77 (107) Q Consensus 17 ~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~--d~-----------------~~~l~~~~~v~~~Pt~ 77 (107) ..+.+.+++|+||.||-|.++-|..+.+++.-+-++.++ =|. ++ ..++-.+|+|.-+|.= T Consensus 72 a~~R~~LLMFTaPsCPvC~KL~PiIkSia~~E~~~Vv~I-SDG~~~EHr~FL~~H~L~~~~YVVSAE~GM~fQV~KiPYG 150 (189) T TIGR02661 72 ALGRPTLLMFTAPSCPVCDKLLPIIKSIARAEEIDVVLI-SDGTPEEHRRFLKDHELGEERYVVSAEIGMAFQVGKIPYG 150 (189) T ss_pred CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEE-ECCCCHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCE T ss_conf 677750354438888532243278988886725325897-2799279998864288887137886202210011225622 Q ss_pred EEEE-CCEEEEEEECCC-CCHHHHHHHHHH Q ss_conf 9997-998985887489-998999999984 Q gi|254780822|r 78 ILFK-DGKVIDRMMPGA-SSQSDIIEWILS 105 (107) Q Consensus 78 ~~~~-~g~~~~~~~~g~-~~~~~l~~~i~~ 105 (107) ++.. +|....+ |- .+.|.++..++. T Consensus 151 VLLD~~G~I~AK---GL~NTREHlESLlEa 177 (189) T TIGR02661 151 VLLDQDGVIRAK---GLTNTREHLESLLEA 177 (189) T ss_pred EEECCCCEEEEC---CCCCHHHHHHHHHHH T ss_conf 566799747742---676438889998862 No 130 >KOG3170 consensus Probab=97.28 E-value=0.00063 Score=43.77 Aligned_cols=99 Identities=20% Similarity=0.401 Sum_probs=74.7 Q ss_pred CEEEECHHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEE Q ss_conf 51775767799999848--9949999876997022213466665421000123332267232657777623156887999 Q gi|254780822|r 2 SALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79 (107) Q Consensus 2 ~~i~i~~~~f~~~v~~~--~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~ 79 (107) ++.+|+..+|.++|... +..|+|..|...-+.|+.+...+..++..|+. ++|+++=.... ..-|.=...||+++ T Consensus 92 ~V~~ISg~dyv~EVT~As~gvwVvvhLy~~gvp~c~Ll~~~l~~la~kfp~-iKFVki~at~c---IpNYPe~nlPTl~V 167 (240) T KOG3170 92 EVFPISGPDYVKEVTKASEGVWVVVHLYKQGVPLCALLSHHLQSLACKFPQ-IKFVKIPATTC---IPNYPESNLPTLLV 167 (240) T ss_pred CEEECCCHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCCC-CEEEECCCCCC---CCCCCCCCCCEEEE T ss_conf 046436348899998626763799986036647899999999987640776-42785333344---67886457986888 Q ss_pred EECCEEEEEEE-----CCC-CCHHHHHHHHH Q ss_conf 97998985887-----489-99899999998 Q gi|254780822|r 80 FKDGKVIDRMM-----PGA-SSQSDIIEWIL 104 (107) Q Consensus 80 ~~~g~~~~~~~-----~g~-~~~~~l~~~i~ 104 (107) |..|....... +|. .+.+.+..++- T Consensus 168 Y~~G~lk~q~igll~lgG~n~t~ed~e~~L~ 198 (240) T KOG3170 168 YHHGALKKQMIGLLELGGMNLTMEDVEDFLV 198 (240) T ss_pred EECCHHHHHEEHHHHHCCCCCCHHHHHHHHH T ss_conf 6233377630016642687688999999997 No 131 >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides. The functional unit of typical 2-cys PRX is a homodimer. A unique intermolecular redox-active disulfide center is utilized for its activity. Upon reaction with peroxides, its peroxidatic cysteine is oxidized into a sulfenic acid intermediate which is resolved by bonding with the resolving cysteine from the other subunit of the homodimer. This intermolecular disulfide bond is then reduced by thioredoxin, tryparedoxin or AhpF. Typical 2-cys PRXs, like 1-cys PRXs, form decamers which are stabilized by reduction of the active site cysteine. Typical 2-cys PRX interacts through beta strands at one edge of the monomer (B-type interface) to form the functional homodimer, and uses an A-type interface (similar to the dimeric Probab=97.18 E-value=0.0038 Score=39.25 Aligned_cols=88 Identities=13% Similarity=0.206 Sum_probs=61.5 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCC----------------------------CCCHHHHH Q ss_conf 8994999987-69970222134666654210001-233322672----------------------------32657777 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDI----------------------------EESSEIST 67 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~----------------------------d~~~~l~~ 67 (107) .++++++.|| +.||+.|......+.+...++.+ .+.++.|.+ |.+.++++ T Consensus 28 ~Gk~vvL~FyP~dfTp~Ct~E~~~f~~~~~ef~~~g~~vigIS~Ds~~sh~~~~~~~~~~~~~~~l~fplLsD~~~~v~~ 107 (173) T cd03015 28 KGKWVVLFFYPLDFTFVCPTEIIAFSDRYEEFKKLNAEVLGVSTDSHFSHLAWRNTPRKEGGLGKINFPLLADPKKKISR 107 (173) T ss_pred CCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCEEECCHHHHHH T ss_conf 89829999981789952279999999999999846967998607988999999876897568776446767776369999 Q ss_pred HHCCC----CC--CEEEEE-ECCEEEEEEECC---CCCHHHHHHHHHH Q ss_conf 62315----68--879999-799898588748---9998999999984 Q gi|254780822|r 68 RYQIS----SI--PTLILF-KDGKVIDRMMPG---ASSQSDIIEWILS 105 (107) Q Consensus 68 ~~~v~----~~--Pt~~~~-~~g~~~~~~~~g---~~~~~~l~~~i~~ 105 (107) .|||. ++ ++.+++ ++|+........ .++.+++.+.|++ T Consensus 108 ~yGv~~~~~g~~~R~tfiID~~g~Ir~~~~~~~~~gr~~~EiLr~l~a 155 (173) T cd03015 108 DYGVLDEEEGVALRGTFIIDPEGIIRHITVNDLPVGRSVDETLRVLDA 155 (173) T ss_pred HHCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 819975656877517999899986999997389989899999999998 No 132 >TIGR02200 GlrX_actino Glutaredoxin-like protein; InterPro: IPR011915 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.. Probab=97.05 E-value=0.00026 Score=45.95 Aligned_cols=68 Identities=22% Similarity=0.427 Sum_probs=46.8 Q ss_pred EEECCCCHHHHHHHHHH-HHHHHHCCCCCCCCCCCCCCCHHHHHHH-----CCCCCCEEEEEECCEEEEEEECCCCCHHH Q ss_conf 98769970222134666-6542100012333226723265777762-----31568879999799898588748999899 Q gi|254780822|r 25 DFWASWCRPCVKLSPII-DDIADELADKVKITKLDIEESSEISTRY-----QISSIPTLILFKDGKVIDRMMPGASSQSD 98 (107) Q Consensus 25 ~f~a~wC~~C~~~~p~~-~~l~~~~~~~i~~~~vd~d~~~~l~~~~-----~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~ 98 (107) .++++|||+|++++..| ++..-.|. .||+++.+.-+..- |=+.+||+.+ .+|... -..+..+ T Consensus 4 vY~~~WCgyC~~l~~~Lk~~~G~~Ye------~~di~~d~~AA~~v~svn~Gn~~vPtV~~-~DGs~~-----tnPSa~~ 71 (78) T TIGR02200 4 VYATTWCGYCAQLMRTLKDKDGAAYE------VVDIEEDEEAADYVKSVNDGNKTVPTVKF-ADGSFL-----TNPSAAQ 71 (78) T ss_pred EEECCCCCHHHHHHHHHHHCCCCCCE------EEECCCCCCCCCEEEEECCCCCEEEEEEE-CCCCCC-----CCCCHHH T ss_conf 64069980678998753430799511------45245484755286653088713016874-799444-----3867789 Q ss_pred HHHHHH Q ss_conf 999998 Q gi|254780822|r 99 IIEWIL 104 (107) Q Consensus 99 l~~~i~ 104 (107) +.+-|. T Consensus 72 v~~klq 77 (78) T TIGR02200 72 VKAKLQ 77 (78) T ss_pred HHHHHC T ss_conf 999843 No 133 >PRK11509 hydrogenase-1 operon protein HyaE; Provisional Probab=97.04 E-value=0.0057 Score=38.24 Aligned_cols=97 Identities=18% Similarity=0.284 Sum_probs=70.1 Q ss_pred ECHHHHHHHHHHCCCCEEEEEEC--CCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 57677999998489949999876--9970222134666654210001-23332267232657777623156887999979 Q gi|254780822|r 6 VDTKSFDSEVLECSNPVVVDFWA--SWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 6 i~~~~f~~~v~~~~~~vlv~f~a--~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) ++..++..-+. .....+|.|-. .-++-+.-..-++-+|.+++++ .+..+.++.+....+..+||+...|+++++++ T Consensus 22 vda~~ld~w~a-~~gd~VvllagDP~R~PE~~DvaVVLPELl~aFp~~~~~~Ava~~e~e~al~~RfGv~r~PaLlflrd 100 (132) T PRK11509 22 VSESRLDDWLT-QAPDGVVLLSSDPKRTPEVSDNPVMIGELLREFPDYTWQVAIADLEQSEAIGDRFGVFRFPATLVFTG 100 (132) T ss_pred CCHHHHHHHHH-CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEECCHHHHHHHHHHCCCCCCCEEEEEEC T ss_conf 55332789996-38977999579987684401214310999986404444432235878899987608664764899858 Q ss_pred CEEEEEEECCCCCHHHHHHHHH Q ss_conf 9898588748999899999998 Q gi|254780822|r 83 GKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 83 g~~~~~~~~g~~~~~~l~~~i~ 104 (107) |+.+.. .+|.++=.+..+-|. T Consensus 101 g~ylG~-lagi~dW~eYv~~i~ 121 (132) T PRK11509 101 GNYRGV-LNGIHPWAELINLMR 121 (132) T ss_pred CEEEEE-ECCCCCHHHHHHHHH T ss_conf 917762-125456899999999 No 134 >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known i Probab=97.01 E-value=0.0017 Score=41.35 Aligned_cols=56 Identities=18% Similarity=0.399 Sum_probs=39.4 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHH----HHH-CCCCCCEEEEEECCEEE Q ss_conf 99987699702221346666542100012333226723265777----762-31568879999799898 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS----TRY-QISSIPTLILFKDGKVI 86 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~----~~~-~v~~~Pt~~~~~~g~~~ 86 (107) ++.|..+||++|.+....|++. .+.+..+|++++++.. ++. +.+.+|.+++ +|+-+ T Consensus 2 V~iysk~~C~~C~~aK~lL~~~------~i~y~ei~v~~~~~~~~~~~~~~~~~~TvPqIfi--~g~~I 62 (75) T cd03418 2 VEIYTKPNCPYCVRAKALLDKK------GVDYEEIDVDGDPALREEMINRSGGRRTVPQIFI--GDVHI 62 (75) T ss_pred EEEEECCCCHHHHHHHHHHHHH------CCCCEEEECCCCHHHHHHHHHHCCCCCEECEEEE--CCEEE T ss_conf 9999679997799999999981------9986898627999999999998089935397999--99798 No 135 >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes Probab=96.99 E-value=0.002 Score=40.87 Aligned_cols=59 Identities=27% Similarity=0.557 Sum_probs=38.5 Q ss_pred CEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH-----HHHHHHCCCCCCEEEEEECCEEE Q ss_conf 4999987699702221346666542100012333226723265-----77776231568879999799898 Q gi|254780822|r 21 PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS-----EISTRYQISSIPTLILFKDGKVI 86 (107) Q Consensus 21 ~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~-----~l~~~~~v~~~Pt~~~~~~g~~~ 86 (107) ||+| |..+||++|++....|++..-+|. ...+|.+.+. .+.+.-+.+.+|.+++ +|+-+ T Consensus 1 pVvI-ysk~~Cp~C~~ak~lL~~~~i~~~----~~~~d~~~~~~~~~~~l~~~~g~~TvPqIfi--~g~~I 64 (82) T cd03419 1 PVVV-FSKSYCPYCKRAKSLLKELGVKPA----VVELDQHEDGSEIQDYLQELTGQRTVPNVFI--GGKFI 64 (82) T ss_pred CEEE-EECCCCHHHHHHHHHHHHCCCCEE----EEECCCCCCHHHHHHHHHHHCCCCCCCEEEE--CCEEE T ss_conf 9899-973888769999999998499806----9964656439999999998439998886999--99898 No 136 >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins. Probab=96.93 E-value=0.00052 Score=44.23 Aligned_cols=44 Identities=25% Similarity=0.378 Sum_probs=33.5 Q ss_pred HCCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCC Q ss_conf 48994999987-69970222134666654210001-2333226723 Q gi|254780822|r 17 ECSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDIE 60 (107) Q Consensus 17 ~~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d 60 (107) -.+++++|.|| ..||+.|+...+.+.+...++.+ .+.++.|-.+ T Consensus 21 ~~~~~vvl~F~R~~~Cp~C~~~l~~l~~~~~~~~~~gv~vvaIs~~ 66 (149) T cd02970 21 LGEGPVVVVFYRGFGCPFCREYLRALSKLLPELDALGVELVAVGPE 66 (149) T ss_pred CCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECC T ss_conf 0999799999778999421471989998899998769659999279 No 137 >COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Probab=96.78 E-value=0.0041 Score=39.05 Aligned_cols=80 Identities=23% Similarity=0.362 Sum_probs=60.8 Q ss_pred CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHH-H--HHHHHHCCCCCCCCCCCCCCCHHHHHHHC--------CCCCC Q ss_conf 7677999998489949999876997022213466-6--65421000123332267232657777623--------15688 Q gi|254780822|r 7 DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPI-I--DDIADELADKVKITKLDIEESSEISTRYQ--------ISSIP 75 (107) Q Consensus 7 ~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~-~--~~l~~~~~~~i~~~~vd~d~~~~l~~~~~--------v~~~P 75 (107) .++-|++ ....+||+++-....||-.|..|... | .++|.-+...+.-+|||-++-|++-+.|. --|-| T Consensus 32 ~~eAF~~-A~~edkPIfLSIGys~CHWChVMa~ESFedpeIA~ilN~~FV~IKVDREERPDvD~~Ym~~~q~~tG~GGWP 110 (667) T COG1331 32 GEEAFAK-AKEEDKPILLSIGYSTCHWCHVMAHESFEDPEIAAILNENFVPVKVDREERPDVDSLYMNASQAITGQGGWP 110 (667) T ss_pred CHHHHHH-HHHHCCCEEEEECCCCCHHHHHHCCCCCCCHHHHHHHHHCCEEEEECHHHCCCHHHHHHHHHHHHCCCCCCC T ss_conf 9999999-997299889992443025566531335599799999973771435681216488999999999964689886 Q ss_pred EEEEE-ECCEEEE Q ss_conf 79999-7998985 Q gi|254780822|r 76 TLILF-KDGKVID 87 (107) Q Consensus 76 t~~~~-~~g~~~~ 87 (107) --+|. .+|++.. T Consensus 111 LtVflTPd~kPFf 123 (667) T COG1331 111 LTVFLTPDGKPFF 123 (667) T ss_pred EEEEECCCCCEEE T ss_conf 0279889983356 No 138 >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Probab=96.75 E-value=0.0056 Score=38.30 Aligned_cols=67 Identities=18% Similarity=0.404 Sum_probs=44.2 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH-----HHHHHH-CCCCCCEEEEEECCEEEEEEECCCCCH Q ss_conf 99987699702221346666542100012333226723265-----777762-315688799997998985887489998 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS-----EISTRY-QISSIPTLILFKDGKVIDRMMPGASSQ 96 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~-----~l~~~~-~v~~~Pt~~~~~~g~~~~~~~~g~~~~ 96 (107) ++.|..+|||+|++....|++.. +.+..+|++++. +..++. |.+++|++++ +|+. ..|.... T Consensus 3 v~iyt~~~CPyC~~ak~~L~~~g------~~~~~i~~~~~~~~~~~~~~~~~~g~~tvP~I~i--~~~~----igg~~d~ 70 (80) T COG0695 3 VTIYTKPGCPYCKRAKRLLDRKG------VDYEEIDVDDDEPEEAREMVKRGKGQRTVPQIFI--GGKH----VGGCDDL 70 (80) T ss_pred EEEEECCCCCHHHHHHHHHHHCC------CCCEEEECCCCCHHHHHHHHHHHCCCCCCCEEEE--CCEE----EECCCCH T ss_conf 79993899964599999999779------9709998378867899999997189857698999--9998----7165898 Q ss_pred HHHHH Q ss_conf 99999 Q gi|254780822|r 97 SDIIE 101 (107) Q Consensus 97 ~~l~~ 101 (107) +++.. T Consensus 71 ~~~~~ 75 (80) T COG0695 71 DALEA 75 (80) T ss_pred HHHHH T ss_conf 99986 No 139 >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, as well as E. coli GRX1 and GRX3, which Probab=96.74 E-value=0.004 Score=39.13 Aligned_cols=55 Identities=22% Similarity=0.512 Sum_probs=40.3 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHH----HHHHHCCCCCCEEEEEECCEE Q ss_conf 999876997022213466665421000123332267232657----777623156887999979989 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE----ISTRYQISSIPTLILFKDGKV 85 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~----l~~~~~v~~~Pt~~~~~~g~~ 85 (107) ++.|..+||++|.+....|++.. +.+..+|++++++ +.+..+.+++|.+++ +|+- T Consensus 2 V~iYs~~~C~~C~~ak~~L~~~~------i~y~e~di~~~~~~~~~l~~~~g~~tvPqIfi--~g~~ 60 (72) T cd02066 2 VVVFSKSTCPYCKRAKRLLESLG------IEFEEIDILEDGELREELKELSGWPTVPQIFI--NGEF 60 (72) T ss_pred EEEEECCCCHHHHHHHHHHHHCC------CCCEEEEECCCHHHHHHHHHHHCCCCCCEEEE--CCEE T ss_conf 99997799976999999999569------97789980598889999999849988995999--9989 No 140 >PRK10638 glutaredoxin 3; Provisional Probab=96.74 E-value=0.0029 Score=39.94 Aligned_cols=57 Identities=14% Similarity=0.385 Sum_probs=40.6 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHH----HHHHHCCCCCCEEEEEECCEEEE Q ss_conf 999876997022213466665421000123332267232657----77762315688799997998985 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE----ISTRYQISSIPTLILFKDGKVID 87 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~----l~~~~~v~~~Pt~~~~~~g~~~~ 87 (107) ++.|..+|||+|.+....|+... +.+-.+|++..++ +.++.|-+.+|.+++ +|+-+. T Consensus 4 V~Iysk~~CpyC~~Ak~lL~~~g------i~y~ei~v~~~~~~~~~l~~~tg~~TVPqIfI--~g~~IG 64 (83) T PRK10638 4 IEIYTKATCPFCHRAKALLNSKG------VSFQEIPIDGDAAKREEMIKRSGRTTVPQIFI--DAQHIG 64 (83) T ss_pred EEEEECCCCHHHHHHHHHHHHCC------CCCEEEECCCCHHHHHHHHHHCCCCCCCEEEE--CCEEEE T ss_conf 89998999967999999999759------98769986799999999997369996196999--999995 No 141 >pfam05768 DUF836 Glutaredoxin-like domain (DUF836). These proteins are related to the pfam00462 family. Probab=96.70 E-value=0.0066 Score=37.87 Aligned_cols=74 Identities=19% Similarity=0.472 Sum_probs=59.2 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC-EEEEEEECCCCCHHHHHH Q ss_conf 9998769970222134666654210001233322672326577776231568879999799-898588748999899999 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG-KVIDRMMPGASSQSDIIE 101 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g-~~~~~~~~g~~~~~~l~~ 101 (107) ++.|..+.|.-|......+.++....+ +.+-.+|++.++++..+|+.+ +|.+.+ +| +. ......+.+++.+ T Consensus 2 l~Ly~r~gChLCe~a~~~L~~~~~~~~--~~~~~vdI~~d~~L~~~Y~~~-IPVl~~--~~~~~---~~~w~~d~~~L~~ 73 (76) T pfam05768 2 LTLYGKPGCHLCEGAKEVLAELEAALG--FDLERIDIDDDEELFARYGLE-IPVLAL--VGILE---ILSWRLDEEQLRA 73 (76) T ss_pred EEEEECCCCCHHHHHHHHHHHHHHCCC--CEEEEEECCCCHHHHHHHCCC-CCEEEE--CCCCC---EECCCCCHHHHHH T ss_conf 899918995738999999998753459--559999888998999984887-898998--79716---3179839999999 Q ss_pred HHH Q ss_conf 998 Q gi|254780822|r 102 WIL 104 (107) Q Consensus 102 ~i~ 104 (107) |++ T Consensus 74 ~L~ 76 (76) T pfam05768 74 WLE 76 (76) T ss_pred HHC T ss_conf 759 No 142 >TIGR02180 GRX_euk Glutaredoxin; InterPro: IPR011899 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This entry is found in eukaryotic glutaredoxins and includes sequences from fungi, plants and metazoans as well as viruses .; GO: 0006118 electron transport, 0045454 cell redox homeostasis. Probab=96.69 E-value=0.0035 Score=39.47 Aligned_cols=70 Identities=24% Similarity=0.424 Sum_probs=47.4 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH-----HHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHH Q ss_conf 99987699702221346666542100012333226723265-----7777623156887999979989858874899989 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS-----EISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~-----~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~ 97 (107) +|.|--+|||+|++.+..|.+.. =-++...++.+|--++. -|.+.-|.+.+|.+++ +|+ .++|.-+.. T Consensus 1 V~vFSKs~CPYC~~ak~~L~~~~-~~~~~~~v~ElD~~~~g~~~Q~~L~~~TG~~TVP~iFi--~g~----~iGG~~D~~ 73 (85) T TIGR02180 1 VVVFSKSYCPYCKKAKEILKKLN-VKPAKYKVVELDQLSNGSEIQDYLKEITGQRTVPNIFI--NGK----FIGGCSDLL 73 (85) T ss_pred CEEEECCCCCHHHHHHHHHHHCC-CCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCCCEEE--CCE----EECCCHHHH T ss_conf 95774389846889999987448-98676406770257885789999998448923882656--885----767824556 Q ss_pred HH Q ss_conf 99 Q gi|254780822|r 98 DI 99 (107) Q Consensus 98 ~l 99 (107) ++ T Consensus 74 ~~ 75 (85) T TIGR02180 74 AL 75 (85) T ss_pred HH T ss_conf 54 No 143 >COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Probab=96.59 E-value=0.0086 Score=37.21 Aligned_cols=39 Identities=21% Similarity=0.485 Sum_probs=31.2 Q ss_pred CHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 657777623156887999979989858874899989999999841 Q gi|254780822|r 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 62 ~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) +.+++.++||+++||+++ +|+ .+.|..+.+++.+.|.+. T Consensus 204 ~~~~a~~~gv~gTPt~~v--~~~----~~~g~~~~~~l~~~i~~~ 242 (244) T COG1651 204 NYKLAQQLGVNGTPTFIV--NGK----LVPGLPDLDELKAIIDEA 242 (244) T ss_pred HHHHHHHCCCCCCCEEEE--CCE----EECCCCCHHHHHHHHHHH T ss_conf 999999759555864998--993----532889989999999984 No 144 >pfam00462 Glutaredoxin Glutaredoxin. Probab=96.47 E-value=0.004 Score=39.13 Aligned_cols=55 Identities=24% Similarity=0.511 Sum_probs=39.8 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH----HHHHHHCCCCCCEEEEEECCEE Q ss_conf 99987699702221346666542100012333226723265----7777623156887999979989 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS----EISTRYQISSIPTLILFKDGKV 85 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~----~l~~~~~v~~~Pt~~~~~~g~~ 85 (107) ++.|..+||++|.+....|++.. +.+..+|+++++ ++.+..|.+++|.+++ +|+- T Consensus 1 v~iys~~~C~~C~~ak~~L~~~~------i~y~~~~v~~~~~~~~~l~~~~g~~tvPqI~i--~g~~ 59 (60) T pfam00462 1 VVLFTKPTCPFCKRAKRLLKSLG------VKFEEIDVDEDPEIREELKELSGWRTVPQVFI--DGEH 59 (60) T ss_pred CEEEECCCCHHHHHHHHHHHHCC------CCCEEEECCCCHHHHHHHHHHHCCCCCCEEEE--CCEE T ss_conf 98993898973999999999809------97533215899999999999829998197988--9999 No 145 >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative; InterPro: IPR005985 Class II bacteriocins are small are ribosomally-synthesized, non-lantibiotic peptide antibiotics produced by many bacteria . This entry represents a protein encoded within a number of operons responsible for class II bacteriocin production , , . It is generally the third protein in the operon and, together with the fourth protein, is responsible for transport to the extracellular environment . . Probab=96.41 E-value=0.025 Score=34.54 Aligned_cols=89 Identities=16% Similarity=0.293 Sum_probs=62.8 Q ss_pred HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC---------HHHHHHH----CCCCCCEEEEEE Q ss_conf 984899499998769970222134666654210001233322672326---------5777762----315688799997 Q gi|254780822|r 15 VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES---------SEISTRY----QISSIPTLILFK 81 (107) Q Consensus 15 v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~---------~~l~~~~----~v~~~Pt~~~~~ 81 (107) ...++...++...-..|++|+.+.+.+.....+....+.++....... .+....| +..++|+++.+. T Consensus 19 ~~~~~e~~~~~~g~~~c~~c~~f~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~p~~~~~~ 98 (122) T TIGR01295 19 ALDSGETFFLFIGFKTCPYCRKFSGTLSGFLAQSKFPIYYLDLENNGSFDLSSENELTDFKSFFGTPTGFLGTPTFVLLD 98 (122) T ss_pred HHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEE T ss_conf 53158636898504324002344345555431035633786437664311022445667766513422210167057740 Q ss_pred CCEEEEEEECCCCCHHHHHHHH Q ss_conf 9989858874899989999999 Q gi|254780822|r 82 DGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 82 ~g~~~~~~~~g~~~~~~l~~~i 103 (107) +|+++.....+..+..++.++- T Consensus 99 ~~~~~~~~~~~~~~~~~~~~~~ 120 (122) T TIGR01295 99 DGKPVSGFCGGSTTLQELQDIT 120 (122) T ss_pred CCEEEEEEECCCCCHHHHHHHH T ss_conf 8805777617752367666541 No 146 >PHA02278 thioredoxin-like protein Probab=96.36 E-value=0.0054 Score=38.40 Aligned_cols=84 Identities=20% Similarity=0.397 Sum_probs=58.1 Q ss_pred HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHH--CCCCCCCCCCC---CCCCHHHHHHHCCCCCCEEEEEECCEEEEEEE Q ss_conf 84899499998769970222134666654210--00123332267---23265777762315688799997998985887 Q gi|254780822|r 16 LECSNPVVVDFWASWCRPCVKLSPIIDDIADE--LADKVKITKLD---IEESSEISTRYQISSIPTLILFKDGKVIDRMM 90 (107) Q Consensus 16 ~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~--~~~~i~~~~vd---~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~ 90 (107) ....+.+++......||.|..+..+.--+.+. .+.-+....+| +|+. .+...|.+.++|.++-|++|+.+.. | T Consensus 14 irqkkd~i~~~tq~ncgkceilk~vip~~qesg~~~kp~~~lnld~~d~dre-~~v~~fd~mstpvligykdg~lvkk-~ 91 (106) T PHA02278 14 IRQKKDVIVMITQDNCGKCEILKSVIPMFQESGDIKKPILTLNLDAEDVDRE-KAVKLFDIMSTPVLIGYKDGQLVKK-Y 91 (106) T ss_pred HHHHCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHH-HHHHHHHHCCCCEEEEECCCHHHHH-H T ss_conf 8631566899714786237899998877642266367458985573201599-9988877505755774035048887-6 Q ss_pred CCCCCHHHHHH Q ss_conf 48999899999 Q gi|254780822|r 91 PGASSQSDIIE 101 (107) Q Consensus 91 ~g~~~~~~l~~ 101 (107) ....++.++.+ T Consensus 92 ed~vtp~qlqe 102 (106) T PHA02278 92 EDQVTPMQLQE 102 (106) T ss_pred HCCCCHHHHHH T ss_conf 43388899987 No 147 >KOG2640 consensus Probab=96.35 E-value=0.0016 Score=41.39 Aligned_cols=87 Identities=15% Similarity=0.289 Sum_probs=64.5 Q ss_pred HCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCH Q ss_conf 48994999987699702221346666542100012333226723265777762315688799997998985887489998 Q gi|254780822|r 17 ECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96 (107) Q Consensus 17 ~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~ 96 (107) ++..++=+.||+.||+..+...|.++-...-+..--.++.=+.-.-+....+|++.+.|++.+... ..+..|.|.+.. T Consensus 74 n~~~~vs~~fy~s~C~fsr~~~~~fd~~~sl~~~i~h~~vee~~~lpsv~s~~~~~~~ps~~~~n~--t~~~~~~~~r~l 151 (319) T KOG2640 74 NKNDYVSLLFYASWCPFSRAVRPEFDVRSSLFSSIQHFAVEESQALPSVFSSYGIHSEPSNLMLNQ--TCPASYRGERDL 151 (319) T ss_pred CCCCCCCCCCHHCCCCCCCCCCCCCCHHHHHCCCCCCCCHHHHHHCCCCHHCCCCCCCCCCEEECC--CCCHHHCCCCCH T ss_conf 457754445122346765334743120244302244313888764344021055556784034425--563243165208 Q ss_pred HHHHHHHHH Q ss_conf 999999984 Q gi|254780822|r 97 SDIIEWILS 105 (107) Q Consensus 97 ~~l~~~i~~ 105 (107) +.|++|..+ T Consensus 152 ~sLv~fy~~ 160 (319) T KOG2640 152 ASLVNFYTE 160 (319) T ss_pred HHHHHHHHH T ss_conf 899998886 No 148 >KOG1752 consensus Probab=96.33 E-value=0.027 Score=34.34 Aligned_cols=66 Identities=30% Similarity=0.568 Sum_probs=42.5 Q ss_pred HHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH-HH----HHHHCCCCCCEEEEEECCEEE Q ss_conf 999848994999987699702221346666542100012333226723265-77----776231568879999799898 Q gi|254780822|r 13 SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS-EI----STRYQISSIPTLILFKDGKVI 86 (107) Q Consensus 13 ~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~-~l----~~~~~v~~~Pt~~~~~~g~~~ 86 (107) +.+.. ..+++| |..+||++|.++...|.+ ++....++.+|-+.+. ++ .+.-+-+.+|.+++ +|+-+ T Consensus 8 ~~~i~-~~~VVi-fSKs~C~~c~~~k~ll~~----~~v~~~vvELD~~~~g~eiq~~l~~~tg~~tvP~vFI--~Gk~i 78 (104) T KOG1752 8 RKMIS-ENPVVI-FSKSSCPYCHRAKELLSD----LGVNPKVVELDEDEDGSEIQKALKKLTGQRTVPNVFI--GGKFI 78 (104) T ss_pred HHHHH-CCCEEE-EECCCCCHHHHHHHHHHH----CCCCCEEEECCCCCCCHHHHHHHHHHCCCCCCCEEEE--CCEEE T ss_conf 99862-398799-977857368999999984----7998679982589871899999997338788997999--99788 No 149 >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins. Members of this family contain a redox active CXXC motif (except GSTK and HCCA isomerase) imbedded in a TRX fold, and an alpha helical insert of about 75 residues (shorter in DsbC and DsbG) relative to TRX. DsbA is involved in the oxidative protein folding pathway in prokaryotes, catalyzing disulfide bond formation of proteins secreted into the bacterial periplasm. DsbC and DsbG function as protein disulfide isomerases and chaperones to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. Probab=96.26 E-value=0.0062 Score=38.03 Aligned_cols=58 Identities=14% Similarity=0.394 Sum_probs=40.6 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCC----C----------------------------CCHHHHHHHC Q ss_conf 9998769970222134666654210001233322672----3----------------------------2657777623 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI----E----------------------------ESSEISTRYQ 70 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~----d----------------------------~~~~l~~~~~ 70 (107) ++.|+.+.|++|..+.+.+.++.....+++.+..+.. . ++..+++++| T Consensus 1 i~~f~D~~Cp~C~~~~~~l~~~~~~~~~~v~v~~~~~~l~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~l~~~~~~~~~g 80 (98) T cd02972 1 IVEFFDPLCPYCYLFEPELEKLLYADDGGVRVVYRPFPLLGGMPPNSLAAARAALAAAAQGKFEALHEALADTALARALG 80 (98) T ss_pred CEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCC T ss_conf 97998999870898999999999865886799998477477667038999999999876582999999998389999819 Q ss_pred CCCCCEEEEE Q ss_conf 1568879999 Q gi|254780822|r 71 ISSIPTLILF 80 (107) Q Consensus 71 v~~~Pt~~~~ 80 (107) |+|+||+++- T Consensus 81 i~gtPt~vv~ 90 (98) T cd02972 81 VTGTPTFVVN 90 (98) T ss_pred CCCCCEEEEC T ss_conf 8889848899 No 150 >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions. GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions. Probab=96.24 E-value=0.01 Score=36.80 Aligned_cols=56 Identities=16% Similarity=0.376 Sum_probs=41.0 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHH----HHHHHCCCCCCEEEEEECCEEE Q ss_conf 999876997022213466665421000123332267232657----7776231568879999799898 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE----ISTRYQISSIPTLILFKDGKVI 86 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~----l~~~~~v~~~Pt~~~~~~g~~~ 86 (107) ++.|.++|||+|.+.+.-|++.. +.+..+|++.+++ +.++-|.+.+|.+++ +|+-+ T Consensus 3 V~IYsk~~CpyC~~AK~lL~~kg------i~y~ei~l~~~~~~~~~l~~~tg~~TVPQIFi--~~~~I 62 (73) T cd03027 3 VTIYSRLGCEDCTAVRLFLREKG------LPYVEINIDIFPERKAELEERTGSSVVPQIFF--NEKLV 62 (73) T ss_pred EEEEECCCCHHHHHHHHHHHHCC------CCEEEEECCCCHHHHHHHHHHHCCCCCCEEEE--CCEEE T ss_conf 99991899967999999999879------96499988899899999999719997597999--99998 No 151 >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals. ETEA shows homology to Fas-associated factor 1 (FAF1); both containing UAS and UBX (ubiquitin-associated) domains. Compared to FAF1, however, ETEA lacks the ubiquitin-associated UBA domain and a nuclear targeting domain. The function of ETEA is still unknown. A yeast two-hybrid assay showed that it can interact with Fas. Because of its homology to FAF1, it is postulated that ETEA could be involved in modulating Fas-mediated apoptosis of T-cells and eosinophils of atopic dermatitis patients, making them more resistant to apoptosis. Probab=96.24 E-value=0.05 Score=32.82 Aligned_cols=89 Identities=11% Similarity=0.178 Sum_probs=62.5 Q ss_pred HHCCCCEEEEEECCCCHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCC--CHHHHHHHCCCCCCEEEEE--ECC--EEE Q ss_conf 84899499998769970222134666---65421000123332267232--6577776231568879999--799--898 Q gi|254780822|r 16 LECSNPVVVDFWASWCRPCVKLSPII---DDIADELADKVKITKLDIEE--SSEISTRYQISSIPTLILF--KDG--KVI 86 (107) Q Consensus 16 ~~~~~~vlv~f~a~wC~~C~~~~p~~---~~l~~~~~~~i~~~~vd~d~--~~~l~~~~~v~~~Pt~~~~--~~g--~~~ 86 (107) ....|..+|++++|+++.|..+-... .++.+-...++.+-..|+.+ ..+++..+++..+|.+.++ +++ ..+ T Consensus 14 k~e~KfLlVYLhs~~h~dt~~F~r~~L~~~~vv~~in~n~v~Wggdv~~~Eg~~va~~l~~~~fPfla~i~l~~~~m~vv 93 (116) T cd02991 14 KQELRFLLVYLHGDDHQDTDEFCRNTLCAPEVIEYINTRMLFWACSVAKPEGYRVSQALRERTYPFLAMIMLKDNRMTIV 93 (116) T ss_pred HHHCCEEEEEECCCCCCCHHHHHHHHCCCHHHHHHHHHCEEEEEEECCCHHHHHHHHHCCCCCCCEEEEEEEECCCEEEE T ss_conf 98385899998179998888999986388999999750869999755975899999976888799589999708834899 Q ss_pred EEEECCCCCHHHHHHHHHH Q ss_conf 5887489998999999984 Q gi|254780822|r 87 DRMMPGASSQSDIIEWILS 105 (107) Q Consensus 87 ~~~~~g~~~~~~l~~~i~~ 105 (107) .| ..|..+++++.+-+.. T Consensus 94 ~r-~eG~~~p~el~~~L~~ 111 (116) T cd02991 94 GR-LEGLIQPEDLINRLTF 111 (116) T ss_pred EE-EECCCCHHHHHHHHHH T ss_conf 99-5268998999999999 No 152 >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF; InterPro: IPR014110 This entry includes TraF; a protein that is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically in the F-type system. TraF has been predicted to contain a thioredoxin fold and has been shown to be localized to the periplasm . Unlike the related protein TrbB (IPR014109 from INTERPRO), TraF does not contain a conserved pair of cysteines and has been shown not to function as a thiol disulphide isomerase by complementation of an Escherichia coli DsbA defect . The protein is believed to be involved in pilin assembly . Even more closely related than TrbB is a clade of genes (IPR014111 from INTERPRO), which do contain the CXXC motif, but it is unclear whether these are involved in type-F conjugation systems per se.. Probab=96.18 E-value=0.026 Score=34.50 Aligned_cols=84 Identities=24% Similarity=0.246 Sum_probs=67.1 Q ss_pred CEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCC---------C----CHHHHHHHCCCCCCEEEEEE--CCEE Q ss_conf 4999987699702221346666542100012333226723---------2----65777762315688799997--9989 Q gi|254780822|r 21 PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE---------E----SSEISTRYQISSIPTLILFK--DGKV 85 (107) Q Consensus 21 ~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d---------~----~~~l~~~~~v~~~Pt~~~~~--~g~~ 85 (107) .=|+.||.-.-+-..+|++++...++.|+=++.=+.+|.. . +..-+.+++|.-+|+++++. .++. T Consensus 162 ~Gl~FFYrG~sp~s~~~a~~i~~F~~~y~~~vi~vS~DG~~~p~l~n~R~iPledsgqa~~l~V~~~PAl~LV~P~~~~~ 241 (270) T TIGR02739 162 YGLFFFYRGKSPISQKLAPVIQAFAKEYGISVIPVSVDGTLIPELPNSRLIPLEDSGQAQKLGVKYFPALYLVDPKSQKM 241 (270) T ss_pred CCEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEEEECCCCCE T ss_conf 62478865998456789999998885419667566124320546688883565451357661342034256872676722 Q ss_pred EEEEECCCCCHHHHHHHHHH Q ss_conf 85887489998999999984 Q gi|254780822|r 86 IDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 86 ~~~~~~g~~~~~~l~~~i~~ 105 (107) .|--| |..+.++|.+-|.. T Consensus 242 ~PlAY-Gf~Sqd~L~~ri~~ 260 (270) T TIGR02739 242 SPLAY-GFISQDELKERILN 260 (270) T ss_pred EEEEH-HHCCHHHHHHHHHH T ss_conf 01001-02048899999998 No 153 >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins. PRX-GRX hybrid proteins from Haemophilus influenza and Neisseria meningitis exhibit GSH-dependent peroxidase activity. The flow of reducing equivalents in the catalytic cycle of the hybrid protein goes from NADPH - GSH reductase - GSH - GRX domain of hybrid - PRX domain of hybrid - peroxide substrate. Probab=96.13 E-value=0.012 Score=36.47 Aligned_cols=56 Identities=14% Similarity=0.341 Sum_probs=39.1 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC---HHHHHHHCCCCCCEEEEEECCEEE Q ss_conf 9998769970222134666654210001233322672326---577776231568879999799898 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES---SEISTRYQISSIPTLILFKDGKVI 86 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~---~~l~~~~~v~~~Pt~~~~~~g~~~ 86 (107) ++.|..++||+|.+.+..|++..-+|. .+++++. +.+.+.-|.+.+|.+++ +|+-+ T Consensus 3 V~Iysk~~CpyC~~AK~lL~~~gi~y~------ei~l~~~~~~~~l~~~~g~~TvPQIfi--~g~~I 61 (72) T cd03029 3 VSLFTKPGCPFCARAKAALQENGISYE------EIPLGKDITGRSLRAVTGAMTVPQVFI--DGELI 61 (72) T ss_pred EEEECCCCCHHHHHHHHHHHHCCCCEE------EEECCCCHHHHHHHHHCCCCEECEEEE--CCEEE T ss_conf 999908999679999999998599659------998887767999987439972298999--99999 No 154 >pfam07449 HyaE Hydrogenase-1 expression protein HyaE. This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long. This includes the E. coli protein HyaE, and the homologous proteins HoxO of R. eutropha and HupG of R. leguminosarum. Deletion of the hoxO gene in R. eutropha led to complete loss of the uptake [NiFe] hydrogenase activity, suggesting that it has a critical role in hydrogenase assembly. Probab=96.01 E-value=0.03 Score=34.08 Aligned_cols=88 Identities=15% Similarity=0.379 Sum_probs=59.0 Q ss_pred ECHHHHHHHHHHCCCCEEEEEECC--CCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC Q ss_conf 576779999984899499998769--970222134666654210001233322672326577776231568879999799 Q gi|254780822|r 6 VDTKSFDSEVLECSNPVVVDFWAS--WCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG 83 (107) Q Consensus 6 i~~~~f~~~v~~~~~~vlv~f~a~--wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g 83 (107) ++.++.... +......++.|-.+ -.+-+.-..-++-++.+.+++.+..+.+.-+....+..+|++...|+++++++| T Consensus 14 vd~~~ld~~-~~~~g~~vLfl~gDp~R~pE~~DvAVVLPEL~~aF~~~~~~avv~~~~E~al~~rfgv~~~PaLvf~r~g 92 (107) T pfam07449 14 VDADTLDDW-LAAPGDGVLLLAGDPNRFPEVLDVAVVLPELLRAFPQRFRGAVVAREQEEALAARFGVRRFPSLLFFRDG 92 (107) T ss_pred ECHHHHHHH-HHCCCCEEEEECCCCCCCCCCCCCEEECHHHHHHHHCCCCEEEECHHHHHHHHHHHCCCCCCEEEEEECC T ss_conf 041227889-7388958999179977587634410371999998644031225686789999998597547648999899 Q ss_pred EEEEEEECCCCC Q ss_conf 898588748999 Q gi|254780822|r 84 KVIDRMMPGASS 95 (107) Q Consensus 84 ~~~~~~~~g~~~ 95 (107) +.+.. ..|.++ T Consensus 93 ~~lG~-i~~i~d 103 (107) T pfam07449 93 RYLGV-LAGIRD 103 (107) T ss_pred EEEEE-ECCCCC T ss_conf 68774-535446 No 155 >pfam01216 Calsequestrin Calsequestrin. Probab=95.96 E-value=0.041 Score=33.32 Aligned_cols=101 Identities=16% Similarity=0.201 Sum_probs=52.9 Q ss_pred EEEECHHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC--CCCCCCCCCCCHHHHH----HHCCC-- Q ss_conf 1775767799999848--994999987699702221346666542100012--3332267232657777----62315-- Q gi|254780822|r 3 ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADK--VKITKLDIEESSEIST----RYQIS-- 72 (107) Q Consensus 3 ~i~i~~~~f~~~v~~~--~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~--i~~~~vd~d~~~~l~~----~~~v~-- 72 (107) +.+++.+|-.+ +.++ ++.-++.|.+..-+.-.++...++++|+.+.++ +.++.||-++++.+.. .++|. T Consensus 228 v~e~~~e~~~~-~~~~~i~g~hi~~F~~e~~~d~~~f~e~lK~vA~~~~~~~~l~ii~iD~ddf~~i~~y~~~~~~i~L~ 306 (350) T pfam01216 228 LRKLRPESMYE-TWEDDLNGIHIVAFAEESDPDGYEFLEILKQVARDNTDNPDLSIIWIDPDDFPLLVPYWEKTFKIDLS 306 (350) T ss_pred EEECCCCCHHH-HHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHCCCCCC T ss_conf 78635033777-64122467549999548886499999999999998368985489996726513688999985377877 Q ss_pred --CCCEEEEEECCEEEEEEE---CCCCCHHHHHHHHHH Q ss_conf --688799997998985887---489998999999984 Q gi|254780822|r 73 --SIPTLILFKDGKVIDRMM---PGASSQSDIIEWILS 105 (107) Q Consensus 73 --~~Pt~~~~~~g~~~~~~~---~g~~~~~~l~~~i~~ 105 (107) .+|.+-+-..... ...+ ....+.+.|.+||+. T Consensus 307 ~~qi~vv~v~d~~~~-~~~~~~~~d~~tae~l~~wied 343 (350) T pfam01216 307 KPQIGVVNVTDADSV-WMEMDDEEDLPTAEELEDWIED 343 (350) T ss_pred CCCCCEEEEECCHHC-CCCCCCHHCCCCHHHHHHHHHH T ss_conf 554775642232210-0358870004789999999999 No 156 >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein Probab=95.89 E-value=0.03 Score=34.10 Aligned_cols=63 Identities=22% Similarity=0.437 Sum_probs=41.2 Q ss_pred HHHCCCCEEEEEE----CCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHH----HHCCCCCCEEEEEECCEEE Q ss_conf 9848994999987----6997022213466665421000123332267232657777----6231568879999799898 Q gi|254780822|r 15 VLECSNPVVVDFW----ASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST----RYQISSIPTLILFKDGKVI 86 (107) Q Consensus 15 v~~~~~~vlv~f~----a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~----~~~v~~~Pt~~~~~~g~~~ 86 (107) +++++ +++|+-- +|+|++|++....|+++. +.|..+|+++++++-+ .-+-..+|.+++ +|+-+ T Consensus 4 ~i~~~-~vvvF~Kgt~~~P~C~f~~~a~~lL~~~~------v~~~~~dv~~d~~~r~~l~~~s~~~TvPqifi--~g~~I 74 (90) T cd03028 4 LIKEN-PVVLFMKGTPEEPRCGFSRKVVQILNQLG------VDFGTFDILEDEEVRQGLKEYSNWPTFPQLYV--NGELV 74 (90) T ss_pred HHHCC-CEEEEECCCCCCCCCHHHHHHHHHHHHHC------CCCEECCHHCCHHHHHHHHHHCCCCCCCCEEE--CCEEE T ss_conf 67209-88999579889988877999999999968------99741330058999999999716898883779--99878 No 157 >TIGR00412 redox_disulf_2 redox-active disulfide protein 2; InterPro: IPR005243 This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archaeoglobus fulgidus, and Methanobacterium thermoautotrophicum (strain Marburg / DSM 2133)) as well as in Anabaena. It is homologous to thioredoxins, glutaredoxins, and protein disulphide isomerases, and shares with them a redox-active disulphide. The redox active disulphide region CXXC motif resembles neither thioredoxin nor glutaredoxin. . Probab=95.25 E-value=0.086 Score=31.47 Aligned_cols=76 Identities=22% Similarity=0.419 Sum_probs=57.7 Q ss_pred EEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECC-CCCHHHHH Q ss_conf 99998769970222134666654210001233322672326577776231568879999799898588748-99989999 Q gi|254780822|r 22 VVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPG-ASSQSDII 100 (107) Q Consensus 22 vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g-~~~~~~l~ 100 (107) +.+..|-|.|+.|++.....+++.++.+=.+-|.+|- +-.++ -.+|+.++|.+.+ ||+.+- .| -.+.++|. T Consensus 2 vkI~i~GtGCa~C~~~~~nvkkaVeelGiDaE~ekv~--d~nei-~E~Gv~a~Pgvav--Dg~~vi---~Gkips~eEIk 73 (78) T TIGR00412 2 VKIKIYGTGCAKCKATYENVKKAVEELGIDAELEKVT--DMNEI-LELGVVATPGVAV--DGKVVI---EGKIPSKEEIK 73 (78) T ss_pred EEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEC--CHHHH-HHHHHHHCCEEEE--CCEEEE---EEECCCHHHHH T ss_conf 2788852999560016899999998628845775322--47788-7533442470555--787888---21118878888 Q ss_pred HHHHH Q ss_conf 99984 Q gi|254780822|r 101 EWILS 105 (107) Q Consensus 101 ~~i~~ 105 (107) +.|.+ T Consensus 74 eilk~ 78 (78) T TIGR00412 74 EILKK 78 (78) T ss_pred HHHCC T ss_conf 86339 No 158 >cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity. The TRX-like b domain of PDIR is critical for its chaperone activity. Probab=95.15 E-value=0.096 Score=31.19 Aligned_cols=96 Identities=20% Similarity=0.343 Sum_probs=69.6 Q ss_pred CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC--CHHHHHHHCCC----CCC-EEEE Q ss_conf 7677999998489949999876997022213466665421000123332267232--65777762315----688-7999 Q gi|254780822|r 7 DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE--SSEISTRYQIS----SIP-TLIL 79 (107) Q Consensus 7 ~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~--~~~l~~~~~v~----~~P-t~~~ 79 (107) +-.+|.++ +.....+||.|..+ -..-......+.++|.+..|.-.++.|||.+ .+.||+++.+. --| .+.- T Consensus 8 d~KdfKKL-LRT~~NVLvLy~~s-~k~a~~~Lk~~~~~A~~ikG~GT~~~vDC~d~e~kKLCKKlKv~~~~kp~p~~LkH 85 (112) T cd03067 8 DHKDFKKL-LRTRNNVLVLYSKS-AKSAEALLKLLSDVAQAVKGQGTIAWIDCGDSESRKLCKKLKVDPSSKPKPVELKH 85 (112) T ss_pred CHHHHHHH-HHHCCCEEEEEECC-HHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHCCCCCCCCCEEEEE T ss_conf 57899999-81157479999558-77878899999999998447216999973760778888887058666999605642 Q ss_pred EECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 97998985887489998999999984 Q gi|254780822|r 80 FKDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 80 ~~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) |++|+--. -|.-..+...|..|+.. T Consensus 86 YKdG~fhk-dYdR~~t~kSmv~FmrD 110 (112) T cd03067 86 YKDGDFHT-EYNRQLTFKSMVAFLRD 110 (112) T ss_pred CCCCCCCC-CCCHHHHHHHHHHHHHC T ss_conf 13787542-00134459999998518 No 159 >PRK10824 hypothetical protein; Provisional Probab=94.99 E-value=0.07 Score=31.96 Aligned_cols=65 Identities=15% Similarity=0.366 Sum_probs=42.1 Q ss_pred HHHCCCCEEEEEEC-----CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCC-CCCCEEE-EEECCEEEE Q ss_conf 98489949999876-----9970222134666654210001233322672326577776231-5688799-997998985 Q gi|254780822|r 15 VLECSNPVVVDFWA-----SWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQI-SSIPTLI-LFKDGKVID 87 (107) Q Consensus 15 v~~~~~~vlv~f~a-----~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v-~~~Pt~~-~~~~g~~~~ 87 (107) +++++ +|++ |.. |+||+|.+....|..+. +.|..+|+.+++++.+.... +.-||+= +|-+|+-+. T Consensus 11 ~v~~~-~Vvl-FMKGtp~~P~CGFS~~~v~iL~~~g------v~f~~vnVl~d~~ir~~lk~~s~WPT~PQlyi~Ge~IG 82 (115) T PRK10824 11 QIAEN-PILL-YMKGSPKLPSCGFSAQAVQALSACG------ERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVG 82 (115) T ss_pred HHHCC-CEEE-EECCCCCCCCCCCHHHHHHHHHHHC------CCEEEEECCCCHHHHHHHHHHCCCCCCCCEEECCEEEC T ss_conf 98439-8899-9488999997802899999999929------98068867889889999899819975561118897664 No 160 >PRK10329 glutaredoxin-like protein; Provisional Probab=94.47 E-value=0.062 Score=32.27 Aligned_cols=66 Identities=11% Similarity=0.207 Sum_probs=46.7 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHH---HHCCCCCCEEEEEECCEEEEEEECCCCCHHHH Q ss_conf 999876997022213466665421000123332267232657777---62315688799997998985887489998999 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST---RYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~---~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l 99 (107) +..|..|+|+.|.+-+..|++- .+.|-.||++++++..+ ..|-++.|.++. ++. ..+|.++ +.| T Consensus 3 ITVYTkp~C~qC~aTKr~L~~~------gI~y~~vdi~~dpea~~~vk~~G~~q~PVV~~--~~~----~wsGFRP-D~i 69 (81) T PRK10329 3 ITIYTRNDCVQCHATKRAMESR------GFDFEMINVDRVPEAADTLRAQGFRQLPVVIA--GDL----SWSGFRP-DMI 69 (81) T ss_pred EEEECCCCCCCHHHHHHHHHHC------CCCEEEEECCCCHHHHHHHHHCCCCCCCEEEE--CCC----EECCCCH-HHH T ss_conf 9997699982479899999987------99429985899999999999769855998996--995----4436098-999 Q ss_pred HH Q ss_conf 99 Q gi|254780822|r 100 IE 101 (107) Q Consensus 100 ~~ 101 (107) .+ T Consensus 70 ~~ 71 (81) T PRK10329 70 NR 71 (81) T ss_pred HH T ss_conf 98 No 161 >PTZ00062 glutaredoxin; Provisional Probab=94.35 E-value=0.21 Score=29.17 Aligned_cols=36 Identities=11% Similarity=0.265 Sum_probs=15.5 Q ss_pred CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHC Q ss_conf 997022213466665421000123332267232657777623 Q gi|254780822|r 29 SWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70 (107) Q Consensus 29 ~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~ 70 (107) |.|+.+++....++.+. +.|..+|+-+++++.+... T Consensus 140 PqCGFS~~vv~iL~~~~------v~f~~~nVL~D~~vR~~LK 175 (219) T PTZ00062 140 PQCKFSNAVVFMLNSSK------VKYETYNILDDPDLREELK 175 (219) T ss_pred CCCCCHHHHHHHHHHCC------CCCCEEECCCCHHHHHHHH T ss_conf 98834799999999819------9966053579889997335 No 162 >TIGR02183 GRXA Glutaredoxin, GrxA family; InterPro: IPR011902 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This entry includes the Escherichia coli glyutaredoxin GrxA which appears to have primary responsibility for the reduction of ribonucleotide reductase .; GO: 0009055 electron carrier activity, 0015035 protein disulfide oxidoreductase activity, 0045454 cell redox homeostasis. Probab=93.76 E-value=0.065 Score=32.16 Aligned_cols=60 Identities=27% Similarity=0.536 Sum_probs=44.7 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC----HHHHHHHC--CCCCCEEEEEECCEE Q ss_conf 9998769970222134666654210001233322672326----57777623--156887999979989 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES----SEISTRYQ--ISSIPTLILFKDGKV 85 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~----~~l~~~~~--v~~~Pt~~~~~~g~~ 85 (107) ++-|..|.|++|.+...-=++|+.+..| +.|-.||+... .+|...-| |..+|.+++ +.+. T Consensus 2 v~IfGr~gC~YCVRA~~LaEkl~~~~~D-F~fry~Di~AEGI~K~DL~~~VGKpVeTVPQIF~--D~~~ 67 (86) T TIGR02183 2 VVIFGRPGCPYCVRAKQLAEKLAEELAD-FEFRYIDIHAEGISKADLEKTVGKPVETVPQIFV--DEKH 67 (86) T ss_pred EEEECCCCCCHHHHHHHHHHHHHHHCCC-CCCEEEEEEECCCCHHHHCCCCCCCCCCCCCEEE--ECCC T ss_conf 5773279984023368889998864035-5620588874588712210337884156674154--0777 No 163 >PTZ00056 glutathione peroxidase; Provisional Probab=93.22 E-value=0.46 Score=27.29 Aligned_cols=89 Identities=12% Similarity=0.188 Sum_probs=57.6 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCC-----------HHHHHHHCCC------------- Q ss_conf 8994999987699702221346666542100012-33322672326-----------5777762315------------- Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEES-----------SEISTRYQIS------------- 72 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d~~-----------~~l~~~~~v~------------- 72 (107) .++.+||.=.|+-||.....-..|++|.++|+++ +.++.+=|++. .+.++.+++. T Consensus 38 kGkv~LIVNvAS~CG~T~q~y~~L~~L~~~y~~~gl~ILaFPcnqF~~QE~~~~~eI~~f~~~~~v~Fpvf~Ki~VnG~~ 117 (180) T PTZ00056 38 KNKVLMITNSASKCGLTKSHVKQMNRLHSVFNPRGLEILAFPTSQFLGQEFENTKDIRKFNEKNKIKYNLFSPIEVNGPN 117 (180) T ss_pred CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCCHHHHHHHHHCCCCCCCEEEEEECCCCC T ss_conf 99889999815777886667999999999862289789998780105789997899999985049875402478525998 Q ss_pred ---------------------------CCCEEEEEECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf ---------------------------68879999799898588748999899999998419 Q gi|254780822|r 73 ---------------------------SIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 73 ---------------------------~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) .+--+++=++|+++.| |....++.+|.+-|++-| T Consensus 118 ahPlyk~Lk~~~~~~~~~~g~~~~I~WNF~KFLId~~G~vv~r-f~p~~~P~~l~~~Ie~LL 178 (180) T PTZ00056 118 THELFKKLKRNCDSMHDENGTLSAIGWNFGKFLVDKNGKVVAY-FSPRTNPLDLEKKIAELL 178 (180) T ss_pred CCHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEE-ECCCCCHHHHHHHHHHHH T ss_conf 8889999986087766656766877753079999899979988-899999899999999985 No 164 >COG3019 Predicted metal-binding protein [General function prediction only] Probab=93.16 E-value=0.46 Score=27.25 Aligned_cols=75 Identities=13% Similarity=0.280 Sum_probs=51.5 Q ss_pred CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCC----CCCEEEEEECCEEEEEEECCCCC Q ss_conf 94999987699702221346666542100012333226723265777762315----68879999799898588748999 Q gi|254780822|r 20 NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS----SIPTLILFKDGKVIDRMMPGASS 95 (107) Q Consensus 20 ~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~----~~Pt~~~~~~g~~~~~~~~g~~~ 95 (107) ..-++.|++|.|+-|..-...++. +.+.+-.+..++...+-++|+|. +--|.++ +|.. +.|..+ T Consensus 25 ~~~~~vyksPnCGCC~~w~~~mk~------~Gf~Vk~~~~~d~~alK~~~gIp~e~~SCHT~VI--~Gy~----vEGHVP 92 (149) T COG3019 25 ATEMVVYKSPNCGCCDEWAQHMKA------NGFEVKVVETDDFLALKRRLGIPYEMQSCHTAVI--NGYY----VEGHVP 92 (149) T ss_pred EEEEEEEECCCCCCHHHHHHHHHH------CCCEEEEEECCCHHHHHHHCCCCHHHCCCCEEEE--CCEE----EECCCC T ss_conf 035788738898617999999986------7957898525728999886099844466527998--6899----854487 Q ss_pred HHHHHHHHHHC Q ss_conf 89999999841 Q gi|254780822|r 96 QSDIIEWILSR 106 (107) Q Consensus 96 ~~~l~~~i~~~ 106 (107) .+.|..++.+. T Consensus 93 a~aI~~ll~~~ 103 (149) T COG3019 93 AEAIARLLAEK 103 (149) T ss_pred HHHHHHHHHCC T ss_conf 99999998279 No 165 >cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides. AhpF contains an NTD forming two contiguous TRX-fold subdomain similar to Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). It also contains a catalytic core similar to TRX reductase containing FAD and NADH binding domains with an active site disulfide. The proposed mechanism of action of AhpF is similar to a TRX/TRX reductase system. The flow of reducing equivalents goes from NADH - catalytic core of AhpF - NTD of AhpF - AhpC - peroxide substrates. The N-terminal TRX-fold subdomain of AhpF NTD is redox inactive, but is proposed to contain an important residue that aids in the catalytic function of the redox-active CXXC motif contained in the C-terminal TRX- Probab=93.15 E-value=0.78 Score=25.95 Aligned_cols=76 Identities=16% Similarity=0.242 Sum_probs=59.1 Q ss_pred CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHH Q ss_conf 99499998769970222134666654210001233322672326577776231568879999799898588748999899 Q gi|254780822|r 19 SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSD 98 (107) Q Consensus 19 ~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~ 98 (107) ..++.+..+...|+.|.++..-+++++.- .+++.+-.-+.+ ...|++.+.++|+...-.|.|-..-.+ T Consensus 18 ~~~V~l~~~~~~~~~s~el~~~l~eiasl-SdkI~~~~~~~~-----------~~~Psf~i~~~g~~tgI~F~GIP~GHE 85 (94) T cd02974 18 ENPVELVASLDDSEKSAELLELLEEIASL-SDKITLEEDNDD-----------ERKPSFSINRPGEDTGIRFAGIPMGHE 85 (94) T ss_pred CCCEEEEEEECCCHHHHHHHHHHHHHHHH-CCCEEEEECCCC-----------CCCCEEEEECCCCCCCEEEEECCCCCH T ss_conf 89889999948972169999999999962-895799985798-----------888789994599886669973688601 Q ss_pred HHHHHHHC Q ss_conf 99999841 Q gi|254780822|r 99 IIEWILSR 106 (107) Q Consensus 99 l~~~i~~~ 106 (107) +..+|..- T Consensus 86 F~SliLAl 93 (94) T cd02974 86 FTSLVLAL 93 (94) T ss_pred HHHHHHHH T ss_conf 88999976 No 166 >TIGR02181 GRX_bact glutaredoxin 3; InterPro: IPR011900 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulphides .; GO: 0006118 electron transport, 0045454 cell redox homeostasis. Probab=92.66 E-value=0.14 Score=30.28 Aligned_cols=65 Identities=12% Similarity=0.372 Sum_probs=42.7 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCC-CCCCCCCCCCH-HHH----HHH-CCCCCCEEEEEECCEEEEEEECCCCC Q ss_conf 999876997022213466665421000123-33226723265-777----762-31568879999799898588748999 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKV-KITKLDIEESS-EIS----TRY-QISSIPTLILFKDGKVIDRMMPGASS 95 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i-~~~~vd~d~~~-~l~----~~~-~v~~~Pt~~~~~~g~~~~~~~~g~~~ 95 (107) ++.+..+.||+|.+.+.-|++- .+ .|-.|++|.++ ..- ++= |=+++|.+++ ++. +++|-.+ T Consensus 1 V~iYT~~~CPYC~rAK~LL~~k------Gv~~~~Ei~vd~dpD~~r~eM~~Rs~Gr~TVPQIFI--g~~----HVGGcDD 68 (82) T TIGR02181 1 VTIYTKPYCPYCSRAKALLESK------GVGTFTEIRVDGDPDALRDEMMQRSGGRRTVPQIFI--GDV----HVGGCDD 68 (82) T ss_pred CEEECCCCCCCCHHHHHHHHHC------CCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCEEEE--CCC----CCCCCHH T ss_conf 9463159988026889999856------988630344579810688999998289940433762--990----2454379 Q ss_pred HHHH Q ss_conf 8999 Q gi|254780822|r 96 QSDI 99 (107) Q Consensus 96 ~~~l 99 (107) .-.| T Consensus 69 L~~L 72 (82) T TIGR02181 69 LYAL 72 (82) T ss_pred HHHH T ss_conf 9998 No 167 >COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Probab=92.55 E-value=0.82 Score=25.81 Aligned_cols=87 Identities=15% Similarity=0.300 Sum_probs=56.9 Q ss_pred CCCCEEEEEEC-CCCHHHHHHHHHHHHHHHHCCC-CCCCCCCC---------------------CCCCHHHHHHHCCCC- Q ss_conf 89949999876-9970222134666654210001-23332267---------------------232657777623156- Q gi|254780822|r 18 CSNPVVVDFWA-SWCRPCVKLSPIIDDIADELAD-KVKITKLD---------------------IEESSEISTRYQISS- 73 (107) Q Consensus 18 ~~~~vlv~f~a-~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd---------------------~d~~~~l~~~~~v~~- 73 (107) .+++++++||- .+++-|...+-.|+....++.. .+.++-|- .|.+.++++.|||-. T Consensus 29 ~Gk~VVLyFYPk~~TpgCT~Ea~~Frd~~~ef~~~~a~V~GIS~Ds~~~~~~F~~k~~L~f~LLSD~~~~v~~~ygv~~~ 108 (157) T COG1225 29 RGKPVVLYFYPKDFTPGCTTEACDFRDLLEEFEKLGAVVLGISPDSPKSHKKFAEKHGLTFPLLSDEDGEVAEAYGVWGE 108 (157) T ss_pred CCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHCCCCEEEECCCHHHHHHHCCCCC T ss_conf 69828999878899985169999999989999867978999808998999999998299855667973789998486631 Q ss_pred -----------CCEEEEE-ECCEEEEEEECCCC---CHHHHHHHHHH Q ss_conf -----------8879999-79989858874899---98999999984 Q gi|254780822|r 74 -----------IPTLILF-KDGKVIDRMMPGAS---SQSDIIEWILS 105 (107) Q Consensus 74 -----------~Pt~~~~-~~g~~~~~~~~g~~---~~~~l~~~i~~ 105 (107) .++.+++ ++|...... .... ..+++.+.+.+ T Consensus 109 k~~~gk~~~~~~R~TfvId~dG~I~~~~-~~v~~~~h~~~vl~~l~~ 154 (157) T COG1225 109 KKMYGKEYMGIERSTFVIDPDGKIRYVW-RKVKVKGHADEVLAALKK 154 (157) T ss_pred CCCCCCCCCCCCCEEEEECCCCEEEEEE-CCCCCCCCHHHHHHHHHH T ss_conf 3457642332233489989998699996-589976619999999997 No 168 >cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins. Probab=92.08 E-value=0.22 Score=29.16 Aligned_cols=38 Identities=18% Similarity=0.381 Sum_probs=29.9 Q ss_pred CHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHH Q ss_conf 6577776231568879999799898588748999899999998 Q gi|254780822|r 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 62 ~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~ 104 (107) +.+.+.+.||.|+||+++ ||+. .+.|..+.+.+.+.|+ T Consensus 164 ~~~~A~~~Gv~GvPtfvv--~g~~---~~~Gaq~~~~~~~~~~ 201 (201) T cd03024 164 DEARARQLGISGVPFFVF--NGKY---AVSGAQPPEVFLQALR 201 (201) T ss_pred HHHHHHHCCCCCCCEEEE--CCEE---EEECCCCHHHHHHHHC T ss_conf 999999869912377999--9988---8758999999999869 No 169 >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Probab=91.81 E-value=0.6 Score=26.60 Aligned_cols=82 Identities=16% Similarity=0.246 Sum_probs=64.6 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHH Q ss_conf 89949999876997022213466665421000123332267232657777623156887999979989858874899989 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~ 97 (107) .+..-+=-|++-.|..|-...+.++-++-- ..++.-..||..-.++=.+.-+|+++||+++ ||+.. -+|-++.+ T Consensus 115 ~g~~~FETy~SltC~nCPDVVQALN~msvl-Np~I~H~~IdGa~Fq~Evear~IMaVPtvfl--nGe~f---g~GRmtle 188 (520) T COG3634 115 DGDFHFETYFSLTCHNCPDVVQALNLMSVL-NPRIKHTAIDGALFQDEVEARNIMAVPTVFL--NGEEF---GQGRMTLE 188 (520) T ss_pred CCCEEEEEEEEEECCCCHHHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHCCCEECCEEEE--CCHHH---CCCCEEHH T ss_conf 886048899986326886899998788760-8873367752166676787545100444888--51121---46510599 Q ss_pred HHHHHHHH Q ss_conf 99999984 Q gi|254780822|r 98 DIIEWILS 105 (107) Q Consensus 98 ~l~~~i~~ 105 (107) +|.+-|.. T Consensus 189 eilaki~~ 196 (520) T COG3634 189 EILAKIDT 196 (520) T ss_pred HHHHHHCC T ss_conf 99997437 No 170 >pfam07689 KaiB KaiB domain. The cyanobacterial clock proteins KaiA and KaiB are proposed as regulators of the circadian rhythm in cyanobacteria. Mutations in both proteins have been reported to alter or abolish circadian rhythmicity. KaiB adopts an alpha-beta meander motif and is found to be a dimer. Probab=91.60 E-value=0.21 Score=29.21 Aligned_cols=76 Identities=17% Similarity=0.252 Sum_probs=56.1 Q ss_pred EECCCCHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 87699702221346666542100-0123332267232657777623156887999979989858874899989999999 Q gi|254780822|r 26 FWASWCRPCVKLSPIIDDIADEL-ADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 26 f~a~wC~~C~~~~p~~~~l~~~~-~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) |-|..-+........++.+.+++ ++.+.+--||+.++|++++.++|.++||++-... .+.-+ ..|..+-.+..-|. T Consensus 3 yVag~~~~s~~a~~nl~~l~~~~l~~~y~LeVIDv~~qPelaE~~~IvATPtLiK~~P-~P~rr-iiGdls~~~~vl~~ 79 (82) T pfam07689 3 YVAGRPLSSEDALKNLKYLEEEDLGFPYELQVIDVLEQPELAEEDRLVATPTLIKLLP-EPRQR-LAGDLSNTQLVLWG 79 (82) T ss_pred EECCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHCCEEEECHHHHCCC-CCCEE-EECCCCHHHHHHHC T ss_conf 5789897899999999999970279958999986121975784588677036664079-97168-86477577776302 No 171 >PRK09301 circadian clock protein KaiB; Provisional Probab=91.13 E-value=0.55 Score=26.84 Aligned_cols=80 Identities=13% Similarity=0.220 Sum_probs=58.4 Q ss_pred CCEEEEEECCCCHHHHHHHHHHHHHHHH-CCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCC-HH Q ss_conf 9499998769970222134666654210-001233322672326577776231568879999799898588748999-89 Q gi|254780822|r 20 NPVVVDFWASWCRPCVKLSPIIDDIADE-LADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASS-QS 97 (107) Q Consensus 20 ~~vlv~f~a~wC~~C~~~~p~~~~l~~~-~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~-~~ 97 (107) ..++-.|-|-.-+.+.+....++++-++ +++...+--||+-++|++|+..+|.++||++=. -..++-|.. |..+ .+ T Consensus 6 ~yvLrLYVaG~tp~S~~Ai~nl~~ice~~L~g~Y~LeVIDv~~~Pe~Ae~~~IlAtPTLvk~-~P~P~RriI-GDLSd~e 83 (103) T PRK09301 6 TYILKLYVAGNTPNSMRALKTLKNILETEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKI-LPPPVRRII-GDLSDRE 83 (103) T ss_pred CEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCEEEECHHHHH-CCCCCEEEE-CCCCCHH T ss_conf 18999997389978999999999999986599636999981269857726886784310020-698620575-0577478 Q ss_pred HHHH Q ss_conf 9999 Q gi|254780822|r 98 DIIE 101 (107) Q Consensus 98 ~l~~ 101 (107) .+.. T Consensus 84 kVL~ 87 (103) T PRK09301 84 KVLI 87 (103) T ss_pred HHHH T ss_conf 9998 No 172 >COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Probab=90.77 E-value=0.43 Score=27.41 Aligned_cols=38 Identities=21% Similarity=0.370 Sum_probs=29.9 Q ss_pred HHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHHHC Q ss_conf 7777623156887999979989858874899989999999841 Q gi|254780822|r 64 EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106 (107) Q Consensus 64 ~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~ 106 (107) ..++++||+++|||++ +|+. .+.|..+.+.+...|.+- T Consensus 175 ~~A~e~gI~gVP~fv~--d~~~---~V~Gaq~~~v~~~al~~~ 212 (225) T COG2761 175 AAAQEMGIRGVPTFVF--DGKY---AVSGAQPYDVLEDALRQL 212 (225) T ss_pred HHHHHCCCCCCCEEEE--CCCE---EECCCCCHHHHHHHHHHH T ss_conf 9999779866866997--1757---653888789999999999 No 173 >cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA. KaiB is an essential protein in maintaining circadian rhythm. It was originally discovered from the cyanobacterium Synechococcus as part of the circadian clock gene cluster, kaiABC. KaiB attenuates KaiA-enhanced KaiC autokinase activity by interacting with KaiA-KaiC complexes in a circadian fashion. KaiB is membrane-associated as well as cytosolic. The amount of membrane-associated protein peaks in the evening (at circadian time (CT) 12-16) while the cytosolic form peaks later (at CT 20). The rhythmic localization of KaiB may function in regulating the formation of Kai complexes. SasA is a sensory histidine kinase which associates with KaiC. Although it is not an essential oscillator component, it is important in enhancing kaiABC expression and is important in metabolic growth control under day/night cycle conditions. SasA contains an N-terminal sensor Probab=90.50 E-value=0.27 Score=28.57 Aligned_cols=60 Identities=17% Similarity=0.243 Sum_probs=46.9 Q ss_pred EEEEEECCCCHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE Q ss_conf 999987699702221346666542100-012333226723265777762315688799997 Q gi|254780822|r 22 VVVDFWASWCRPCVKLSPIIDDIADEL-ADKVKITKLDIEESSEISTRYQISSIPTLILFK 81 (107) Q Consensus 22 vlv~f~a~wC~~C~~~~p~~~~l~~~~-~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~ 81 (107) ++-.|-|..-+.+.+....+.++-+++ ++...+--||+.++|++++.++|.++||++-.. T Consensus 3 ~L~LyVaG~tp~S~~ai~nl~~i~e~~l~~~y~LeVIDv~~~P~lAe~~~IvAtPtLvk~~ 63 (72) T cd02978 3 VLRLYVAGRTPKSERALQNLKRILEELLGGPYELEVIDVLKQPQLAEEDKIVATPTLVKVL 63 (72) T ss_pred EEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCEEEECHHHHCC T ss_conf 8999985999789999999999999747996689998833497477268878844300037 No 174 >PTZ00256 glutathione peroxidase; Provisional Probab=90.48 E-value=1.2 Score=24.83 Aligned_cols=89 Identities=12% Similarity=0.176 Sum_probs=55.2 Q ss_pred CCCCEEE-EEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCC--------HHHHH----HHCCC----------- Q ss_conf 8994999-987699702221346666542100012-33322672326--------57777----62315----------- Q gi|254780822|r 18 CSNPVVV-DFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEES--------SEIST----RYQIS----------- 72 (107) Q Consensus 18 ~~~~vlv-~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d~~--------~~l~~----~~~v~----------- 72 (107) .++.++| .=.|+.||...+.-..|++|.++|+++ +.++.+=|++. .++.+ .|++. T Consensus 39 ~Gk~vlivVNvAS~CG~T~q~Y~~L~~L~~~y~~~Gl~IL~FPcNqF~~QEpg~~~eI~~f~~~~ygv~Fp~f~Ki~VnG 118 (183) T PTZ00256 39 QGKKAYICVNVACSCGLTSSNYSELVELYKQYSAQGLEILGFPCNQFMNQESKPEPEIKEFVIQKYGVSFPLFQKIEVNG 118 (183) T ss_pred CCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEEECCC T ss_conf 99879999981567789836189999999998508988998666442556999889999999857898536667673579 Q ss_pred -------------------------CC----CEEEEEECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf -------------------------68----879999799898588748999899999998419 Q gi|254780822|r 73 -------------------------SI----PTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 73 -------------------------~~----Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) .+ --+++=++|+++.| |.-..++++|.+.|++.| T Consensus 119 ~~~hPly~~LK~~~~~~~~~~~~~~~I~WNF~KFLId~~G~vv~r-f~p~t~P~~l~~~Ie~lL 181 (183) T PTZ00256 119 QNTHEIYRYLRLNSELLKVNKNEAKEVPWNFGKFLLDSQGNVVNF-YCPDQKPNEMMQDIEKLL 181 (183) T ss_pred CCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEECCCCCEEEE-ECCCCCHHHHHHHHHHHH T ss_conf 987868999985365555675679977866577999999829989-798999999999999997 No 175 >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properti Probab=90.45 E-value=0.48 Score=27.14 Aligned_cols=42 Identities=21% Similarity=0.373 Sum_probs=31.6 Q ss_pred CCCCEEEEEECCCCHH-HHHHHHHHHHHHHHCCC----CCCC--CCCCC Q ss_conf 8994999987699702-22134666654210001----2333--22672 Q gi|254780822|r 18 CSNPVVVDFWASWCRP-CVKLSPIIDDIADELAD----KVKI--TKLDI 59 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~-C~~~~p~~~~l~~~~~~----~i~~--~~vd~ 59 (107) .+++++|.|.-++|+. |-.+...+.++.++++. ++.+ +.+|- T Consensus 21 ~gk~~lv~F~yt~Cp~~Cp~~~~~l~~~~~~l~~~~~~~v~~v~ISvDP 69 (142) T cd02968 21 KGKPVLVYFGYTHCPDVCPTTLANLAQALKQLGADGGDDVQVVFISVDP 69 (142) T ss_pred CCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEECC T ss_conf 9988999987467999348999999999998644325857999999088 No 176 >cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds. It also displays chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp72 contains three redox-active TRX (a) domains and two redox inactive TRX-like (b) domains. Its molecular structure is a"abb'a', compared to the abb'a' structure of PDI. ERp72 associates with several ER chaperones and folding factors to form complexes in the ER that bind nascent proteins. Similar to PDI, the b domain of ERp72 is likely involved in binding to substrates. Probab=90.27 E-value=1.7 Score=24.03 Aligned_cols=95 Identities=15% Similarity=0.284 Sum_probs=65.2 Q ss_pred EE-CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC Q ss_conf 75-76779999984899499998769970222134666654210001233322672326577776231568879999799 Q gi|254780822|r 5 KV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG 83 (107) Q Consensus 5 ~i-~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g 83 (107) +| +-+.+++.+..+++.++|=|++.--.+ ....+.++|+.+.++++|+.-. +.++.+.|++.. ..+++|+.. T Consensus 4 el~s~~~~~~fl~d~ddv~VVGfF~~~ds~---~~~~FlkaA~~lRe~~~F~HT~---~~~v~kk~~~~~-~~iVlfrP~ 76 (107) T cd03068 4 QLQTLKQVQEFLRDGDDVIIIGVFSGEEDP---AYQLYQDAANSLREDYKFHHTF---DSEIFKSLKVSP-GQLVVFQPE 76 (107) T ss_pred HHHHHHHHHHHHCCCCCEEEEEEECCCCCH---HHHHHHHHHHHCCCCEEEEEEC---HHHHHHHHCCCC-CCEEEEECH T ss_conf 220099999985378870899998689977---8999999998550563899857---599999808998-829999776 Q ss_pred E------EEEEEEC--CCCCHHHHHHHHHHC Q ss_conf 8------9858874--899989999999841 Q gi|254780822|r 84 K------VIDRMMP--GASSQSDIIEWILSR 106 (107) Q Consensus 84 ~------~~~~~~~--g~~~~~~l~~~i~~~ 106 (107) . +-...|. |..+...|.+||.+| T Consensus 77 ~l~nKfE~~~~~y~~~~~t~~~~ik~Fi~~n 107 (107) T cd03068 77 KFQSKYEPKSHVLNKKDSTSEDELKDFFKEH 107 (107) T ss_pred HHHHCCCCCCEEECCCCCCCHHHHHHHHHCC T ss_conf 8851158861467567885589999998529 No 177 >cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE. FrnE is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins. Probab=90.10 E-value=0.24 Score=28.93 Aligned_cols=34 Identities=21% Similarity=0.294 Sum_probs=24.3 Q ss_pred CHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCH Q ss_conf 65777762315688799997998985887489998 Q gi|254780822|r 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96 (107) Q Consensus 62 ~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~ 96 (107) ..+.++++||+|+||+++..++.... ..+|..+. T Consensus 158 d~~~a~~~Gi~gVPt~Vi~d~~~~~~-~~~g~~~~ 191 (193) T cd03025 158 DQKLARELGINGFPTLVLEDDNGEGI-LLTGYYPY 191 (193) T ss_pred HHHHHHHCCCCCCCEEEEEECCCEEE-EECCCCCC T ss_conf 99999987998524699997897179-83257228 No 178 >KOG2507 consensus Probab=89.35 E-value=1.9 Score=23.72 Aligned_cols=87 Identities=16% Similarity=0.273 Sum_probs=60.6 Q ss_pred CCCCEEEEEECCCCHHHHHHHH-HHHH--HHHHCCCCCCCCCCCCC--CCHHHHHHHCCCCCCEEEEEE-CCEEEEEEEC Q ss_conf 8994999987699702221346-6665--42100012333226723--265777762315688799997-9989858874 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSP-IIDD--IADELADKVKITKLDIE--ESSEISTRYQISSIPTLILFK-DGKVIDRMMP 91 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p-~~~~--l~~~~~~~i~~~~vd~d--~~~~l~~~~~v~~~Pt~~~~~-~g~~~~~~~~ 91 (107) .++.++|.|-+.--.-...|.. .|.. +++.....+.-++|+.. .....+..|.+..+|+++++. .|.++.+. . T Consensus 17 ~kkalfVVyI~gddE~s~kl~r~~w~d~~vs~~ls~~fVaIkiqags~aa~qFs~IYp~v~vPs~ffIg~sGtpLevi-t 95 (506) T KOG2507 17 GKKALFVVYISGDDEESDKLNRLTWTDASVSDSLSKYFVAIKIQAGSVAATQFSAIYPYVSVPSIFFIGFSGTPLEVI-T 95 (506) T ss_pred CCCEEEEEEEECCCHHHHHHHHCCCHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHCCCCCCCCEEEECCCCCEEEEE-E T ss_conf 378089999825716777876413035444443204458999535844666566535666545224554789656885-0 Q ss_pred CCCCHHHHHHHHHH Q ss_conf 89998999999984 Q gi|254780822|r 92 GASSQSDIIEWILS 105 (107) Q Consensus 92 g~~~~~~l~~~i~~ 105 (107) |..+.++|.+-|++ T Consensus 96 g~v~adeL~~~i~K 109 (506) T KOG2507 96 GFVTADELASSIEK 109 (506) T ss_pred CCCCHHHHHHHHHH T ss_conf 54407888778899 No 179 >pfam01323 DSBA DSBA-like thioredoxin domain. This family contains a diverse set of proteins with a thioredoxin-like structure pfam00085. This family also includes 2-hydroxychromene-2-carboxylate (HCCA) isomerase enzymes catalyse one step in prokaryotic polyaromatic hydrocarbon (PAH) catabolic pathways. This family also contains members with functions other than HCCA isomerisation, such as Kappa family GSTs, whose similarity to HCCA isomerases was not previously recognized. One member from Pseudomonas putida has been annotated as a dioxygenase but is almost certainly an HCCA isomerase enzyme. Similarly, a member from Pseudomonas stutzeri has been annotated as a dehydrogenase, but is most probably also an HCCA isomerase enzyme. In addition, a member from Rhizobium leguminosarum has been annotated as a putative glycerol-3-phosphate transfer protein, but is also most likely to be an HCCA isomerase enzyme. Probab=89.20 E-value=0.56 Score=26.78 Aligned_cols=35 Identities=20% Similarity=0.429 Sum_probs=27.9 Q ss_pred HHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 57777623156887999979989858874899989999999 Q gi|254780822|r 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 63 ~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) .+.+...||.|+||+++ +|+ .+.|....+.+.++| T Consensus 156 ~~~a~~~gv~GvPtfvi--~~~----~~~G~d~~e~~~~~L 190 (191) T pfam01323 156 TAAAISLGVFGVPTFVV--GGK----MVFGADRLDTLADAL 190 (191) T ss_pred HHHHHHCCCEECCEEEE--CCE----EEECCCCHHHHHHHH T ss_conf 99999859903687999--999----884899899999975 No 180 >pfam09673 TrbC_Ftype Type-F conjugative transfer system pilin assembly protein. This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins is heterogeneous. Probab=88.99 E-value=2.1 Score=23.46 Aligned_cols=87 Identities=20% Similarity=0.281 Sum_probs=47.1 Q ss_pred CHHHHHHHHHH---CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC Q ss_conf 76779999984---899499998769970222134666654210001233322672326577776231568879999799 Q gi|254780822|r 7 DTKSFDSEVLE---CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG 83 (107) Q Consensus 7 ~~~~f~~~v~~---~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g 83 (107) -++.+.+.+.+ .+.++++.=+-+. .+.+....+.+-..+.-.. .++.-+|.+.++|+|+.+|++++.+++ T Consensus 9 P~~sLk~l~~~a~~~g~~~VlRG~~~~-----~~~~T~~~i~~l~~~~~~~--~~v~IdP~lF~~f~I~~VPa~V~~~~~ 81 (113) T pfam09673 9 PDESLKQLLRQAARAGVPVVLRGFVNG-----SLKETAAAIQELVKKGDRD--AGVQIDPTLFRRYNITSVPAFVVVKDS 81 (113) T ss_pred CHHHHHHHHHHHHHHCCEEEEECCCCC-----CHHHHHHHHHHHHHCCCCC--CCEEECHHHHHHCCCEECCEEEEECCC T ss_conf 999999999999981977999678899-----8899999999998617878--865799799966696163689998377 Q ss_pred ------------EEEEEEECCCCCHHHHHH Q ss_conf ------------898588748999899999 Q gi|254780822|r 84 ------------KVIDRMMPGASSQSDIIE 101 (107) Q Consensus 84 ------------~~~~~~~~g~~~~~~l~~ 101 (107) +.-.+. .|..+.+.-.+ T Consensus 82 ~~~~~~~~~~~~~~~d~i-~Gdvsl~~aLe 110 (113) T pfam09673 82 PLVCLSEGCCPPEDYDVI-YGDLSLDYALE 110 (113) T ss_pred CCCCCCCCCCCCCCEEEE-EECCCHHHHHH T ss_conf 655655677888875699-82578999999 No 181 >COG3531 Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Probab=88.29 E-value=0.9 Score=25.59 Aligned_cols=44 Identities=20% Similarity=0.335 Sum_probs=34.6 Q ss_pred HHHHHHHCCCCCCEEEEEECCEEEEEEECC--CCCHHHHHHHHHHCC Q ss_conf 577776231568879999799898588748--999899999998419 Q gi|254780822|r 63 SEISTRYQISSIPTLILFKDGKVIDRMMPG--ASSQSDIIEWILSRV 107 (107) Q Consensus 63 ~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g--~~~~~~l~~~i~~~l 107 (107) ..+++++++.|+||+++-.||+.-. .-.| ..+.+.+..++.+.+ T Consensus 164 r~l~~rlg~~GfPTl~le~ng~~~~-l~~g~y~~~~~~~~arl~~~~ 209 (212) T COG3531 164 RRLMQRLGAAGFPTLALERNGTMYV-LGTGAYFGSPDAWLARLAQRL 209 (212) T ss_pred HHHHHHHCCCCCCEEEEEECCCEEE-CCCCCCCCCCHHHHHHHHHHH T ss_conf 9999994558887110005894675-158765588099999999987 No 182 >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx). Tpx is a bacterial periplasmic peroxidase which differs from other PRXs in that it shows substrate specificity toward alkyl hydroperoxides over hydrogen peroxide. As with all other PRXs, the peroxidatic cysteine (N-terminal) of Tpx is oxidized into a sulfenic acid intermediate upon reaction with peroxides. Tpx is able to resolve this intermediate by forming an intramolecular disulfide bond with a conserved C-terminal cysteine (the resolving cysteine), which can then be reduced by thioredoxin. This differs from the typical 2-cys PRX which resolves the oxidized cysteine by forming an intermolecular disulfide bond with the resolving cysteine from the other subunit of the homodimer. Atypical 2-cys PRX homodimers have a loop-based Probab=87.57 E-value=0.91 Score=25.57 Aligned_cols=71 Identities=13% Similarity=0.264 Sum_probs=43.0 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-----------------------CCHHHHHHHCCC- Q ss_conf 8994999987-699702221346666542100012333226723-----------------------265777762315- Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELADKVKITKLDIE-----------------------ESSEISTRYQIS- 72 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d-----------------------~~~~l~~~~~v~- 72 (107) .+|.+++.|| +.+++.|......+++...++.+ +.++-|-+| ....+++.||+. T Consensus 25 ~Gk~~Vl~fyP~~~T~vC~~e~~~f~~~~~~f~~-~~v~gIS~Ds~~s~~~f~~~~~l~~~~lLSD~~~~~~~~~yGv~~ 103 (143) T cd03014 25 AGKVKVISVFPSIDTPVCATQTKRFNKEAAKLDN-TVVLTISADLPFAQKRWCGAEGVDNVTTLSDFRDHSFGKAYGVLI 103 (143) T ss_pred CCCEEEEEEEECCCCCCCCCHHHHHHHHHHHCCC-CEEEEEECCCHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHCCEE T ss_conf 9986999998078998453159999999873589-689999789999999999876998964846499973678729055 Q ss_pred ---CC--CEEEEE-ECCEEEEEE Q ss_conf ---68--879999-799898588 Q gi|254780822|r 73 ---SI--PTLILF-KDGKVIDRM 89 (107) Q Consensus 73 ---~~--Pt~~~~-~~g~~~~~~ 89 (107) ++ .+.+++ .+|+..... T Consensus 104 ~~~g~~~R~tfiID~~G~I~~~e 126 (143) T cd03014 104 KDLGLLARAVFVIDENGKVIYVE 126 (143) T ss_pred CCCCCEEEEEEEECCCCEEEEEE T ss_conf 01794221899999999899999 No 183 >pfam00837 T4_deiodinase Iodothyronine deiodinase. Iodothyronine deiodinase converts thyroxine (T4) to 3,5,3'-triiodothyronine (T3). Probab=86.65 E-value=0.61 Score=26.57 Aligned_cols=100 Identities=13% Similarity=0.324 Sum_probs=64.6 Q ss_pred CEEEECHHHHHHH--HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC------------------ Q ss_conf 5177576779999--98489949999876997022213466665421000123332267232------------------ Q gi|254780822|r 2 SALKVDTKSFDSE--VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE------------------ 61 (107) Q Consensus 2 ~~i~i~~~~f~~~--v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~------------------ 61 (107) +++.++....-.+ -..++.|.++.|.+-.|||=..-.+.+.++.++|.+-++|.-|=+++ T Consensus 83 ~vV~l~g~~~~~ildf~~g~RPLVlnFGScTCPpFm~~l~~F~rlv~~f~dvADFl~VYIeEAHpsDGW~~~~n~~~I~~ 162 (237) T pfam00837 83 EVVRLSGQRGCHILDFAQGNRPLVLNFGSCTUPPFMARLDAFQRLVEDFCSTADFLIIYIEEAHPSDGWAFTDNSYNIPT 162 (237) T ss_pred CEEEECCCCCEEHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHEEEEEEECCCCCCCCCCCCCCCCCCC T ss_conf 63854574300066660589875886267678558888999999999976033446665311367776101698432577 Q ss_pred CHH------HH----------------------HHHCCCCCCE-EEEEECCEEEEEEECCC-----CCHHHHHHHHHHC Q ss_conf 657------77----------------------7623156887-99997998985887489-----9989999999841 Q gi|254780822|r 62 SSE------IS----------------------TRYQISSIPT-LILFKDGKVIDRMMPGA-----SSQSDIIEWILSR 106 (107) Q Consensus 62 ~~~------l~----------------------~~~~v~~~Pt-~~~~~~g~~~~~~~~g~-----~~~~~l~~~i~~~ 106 (107) ++. .+ ..| -++|. +.++.+|+.+. .|. ...+++++|+++. T Consensus 163 Hr~ledRl~AA~~l~~~~p~cpvvvDtMdN~an~aY--gA~peRLYIiq~gkV~Y---~Gg~GP~~Y~~~Evr~wLeky 236 (237) T pfam00837 163 HQTLQDRLQAARLLLQRAPGCRVVADTMRNQSSQAY--GAYFERLYVIQEGKILY---QGGRGPWGYHPEEVRAWLEKY 236 (237) T ss_pred CCCHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHH--CCCCCEEEEEECCEEEE---CCCCCCCCCCHHHHHHHHHHH T ss_conf 678799999999999509999889861467667873--66734489997487997---278898878989999999974 No 184 >TIGR02742 TrbC_Ftype type-F conjugative transfer system pilin assembly protein TrbC; InterPro: IPR014113 This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA , . The N-terminal portion of these proteins is heterogeneous. . Probab=86.37 E-value=0.41 Score=27.53 Aligned_cols=74 Identities=15% Similarity=0.231 Sum_probs=41.9 Q ss_pred CHHHHHHHHHH---CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECC Q ss_conf 76779999984---899499998769970222134666654210001233322672326577776231568879999799 Q gi|254780822|r 7 DTKSFDSEVLE---CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDG 83 (107) Q Consensus 7 ~~~~f~~~v~~---~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g 83 (107) -++.+.+.+.+ .+-|+++.=..+ -+. ++-...+..|.+.-..+....-+-+ +|++.++|+|+.+||++++++| T Consensus 10 P~~~L~~l~~q~~~~g~p~VlRG~~~-~~f-~~T~~~i~~L~~~~~~~~i~~G~~I--dP~~F~~f~I~~VPA~V~~k~~ 85 (139) T TIGR02742 10 PEPLLKQLLDQAEKLGAPLVLRGLLD-NGF-KATVTAIQSLIKKGGKKPINSGVQI--DPQLFKQFDITAVPALVVVKDG 85 (139) T ss_pred CHHHHHHHHHHHHHCCCCEEEECCCC-CCH-HHHHHHHHHHHHCCCCCEEECCEEE--CHHHHCCCCCCCCCEEEEECCC T ss_conf 97899999999997189789706689-888-8999999999734587455446156--7444210686304548887699 Q ss_pred E Q ss_conf 8 Q gi|254780822|r 84 K 84 (107) Q Consensus 84 ~ 84 (107) . T Consensus 86 ~ 86 (139) T TIGR02742 86 A 86 (139) T ss_pred C T ss_conf 8 No 185 >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes. Probab=85.53 E-value=0.96 Score=25.42 Aligned_cols=43 Identities=9% Similarity=0.095 Sum_probs=31.7 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCC Q ss_conf 8994999987699702221346666542100012-3332267232 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEE 61 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d~ 61 (107) .++.+||.-.|+||+... .-..|++|.++|+++ +.++.+=|++ T Consensus 21 ~GkvvLiVNvAS~Cg~t~-qy~~L~~L~~ky~~~gl~Il~fPcnq 64 (152) T cd00340 21 KGKVLLIVNVASKCGFTP-QYEGLEALYEKYKDRGLVVLGFPCNQ 64 (152) T ss_pred CCCEEEEEECCCCCCCCC-CHHHHHHHHHHHCCCCEEEEEEEHHH T ss_conf 997899996677888872-48899999998412884999636688 No 186 >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH; InterPro: IPR011909 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterised by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase .; GO: 0006118 electron transport, 0045454 cell redox homeostasis. Probab=85.37 E-value=1.3 Score=24.70 Aligned_cols=64 Identities=13% Similarity=0.341 Sum_probs=46.8 Q ss_pred EEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHH---HHCCCCCCEEEEEECCEEEEEEECCCCCHHHHH Q ss_conf 9876997022213466665421000123332267232657777---623156887999979989858874899989999 Q gi|254780822|r 25 DFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST---RYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100 (107) Q Consensus 25 ~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~---~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~ 100 (107) .|..+-|-.|++-...|++- .+.|=.||+|.+|+... .+|=+++|.+.. +|.. .++|.+| +.|. T Consensus 3 vysKNnCvQCkmTKk~L~~~------~i~Fe~inid~~pea~d~vk~lGF~~~PVi~~--~g~~---~~SGFrP-D~lk 69 (72) T TIGR02194 3 VYSKNNCVQCKMTKKALEEH------GIAFEEINIDEQPEAVDYVKALGFRQVPVIVA--EGDE---SWSGFRP-DKLK 69 (72) T ss_pred EECCCCCCCCCHHHHHHHHC------CCCEEEEECCCCHHHHHHHHHCCCEECCEEEE--CCCE---EEECCCH-HHHC T ss_conf 53179850521577667637------99615763588843789998748630762676--7970---0213385-8740 No 187 >TIGR01355 cyt_deam_dimer cytidine deaminase; InterPro: IPR006263 Cytidine deaminase is a homodimeric zinc metalloprotein found in Arabidopis and some Proteobacteria. A related, homotetrameric form with a much smaller subunit is found most bacteria and in animals, IPR006262 from INTERPRO. Both types may act on deoxycytidine as well as cytidine. ; GO: 0004126 cytidine deaminase activity, 0046087 cytidine metabolic process. Probab=85.25 E-value=0.34 Score=28.00 Aligned_cols=20 Identities=25% Similarity=0.403 Sum_probs=15.8 Q ss_pred EEEECCCCHHHHHHHHHHHHH Q ss_conf 998769970222134666654 Q gi|254780822|r 24 VDFWASWCRPCVKLSPIIDDI 44 (107) Q Consensus 24 v~f~a~wC~~C~~~~p~~~~l 44 (107) ..|++| ||+|+++..++... T Consensus 103 ~~F~~P-CghCrQFl~E~~~A 122 (311) T TIGR01355 103 SVFAAP-CGHCRQFLNEIRNA 122 (311) T ss_pred EECCCC-CCCHHHHHHHHCCH T ss_conf 344887-85177899860583 No 188 >TIGR02190 GlrX-dom Glutaredoxin-family domain; InterPro: IPR011906 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This C-terminal domain with homology to glutaredoxin is fused to an N-terminal peroxiredoxin-like domain.. Probab=85.25 E-value=1.2 Score=24.97 Aligned_cols=60 Identities=15% Similarity=0.364 Sum_probs=39.9 Q ss_pred CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC---HHHHHHHCCCCCCEEEEEECCEEEE Q ss_conf 9499998769970222134666654210001233322672326---5777762315688799997998985 Q gi|254780822|r 20 NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES---SEISTRYQISSIPTLILFKDGKVID 87 (107) Q Consensus 20 ~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~---~~l~~~~~v~~~Pt~~~~~~g~~~~ 87 (107) +..++.|.-|.||+|.+-+..|.+-. +.|..|=.++. .-|..--|-+..|.+++ +|+-+. T Consensus 7 ~~~V~vfTKpGCPFC~~AK~~L~~~G------~~~~Ei~Lg~~~~~~slrAvtG~~TvPQVFI--~G~lIG 69 (79) T TIGR02190 7 PESVSVFTKPGCPFCAKAKAVLKEKG------YDYEEIPLGKDITTRSLRAVTGATTVPQVFI--NGKLIG 69 (79) T ss_pred CCEEEEEECCCCCHHHHHHHHHHHCC------CCEEEEECCCCCEEEEEEEECCCCCCCEEEE--CCEEEC T ss_conf 77048984598964466788988389------8648886399600688744518985783764--985632 No 189 >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Probab=84.79 E-value=3.4 Score=22.27 Aligned_cols=73 Identities=8% Similarity=0.184 Sum_probs=44.6 Q ss_pred EEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHH Q ss_conf 98769970222134666654210001233322672326577776231568879999799898588748999899999998 Q gi|254780822|r 25 DFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 25 ~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~ 104 (107) .|.-+.||+|+.....+.++.-.+. +.-+.-+-..-.++.+.-|-..+|.++ ..+..+. .+ ..++|++++. T Consensus 4 LY~~e~cPfC~kVR~~L~~L~L~~~--~~~~~~~~~~r~~l~~~gG~~qVP~L~--D~ntgv~-my----ES~dIi~YL~ 74 (77) T cd03041 4 LYEFEGSPFCRLVREVLTELELDVI--LYPCPKGSPKRDKFLEKGGKVQVPYLV--DPNTGVQ-MF----ESADIVKYLF 74 (77) T ss_pred EECCCCCCCHHHHHHHHHHCCCCEE--EEECCCCCHHHHHHHHHCCCCCCCEEE--ECCCCEE-EE----CHHHHHHHHH T ss_conf 8716999524999999998699779--998999966689999848996773799--6899848-77----7999999999 Q ss_pred HC Q ss_conf 41 Q gi|254780822|r 105 SR 106 (107) Q Consensus 105 ~~ 106 (107) ++ T Consensus 75 ~~ 76 (77) T cd03041 75 KT 76 (77) T ss_pred HH T ss_conf 65 No 190 >TIGR00612 ispG_gcpE 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli. It has now been characterised as 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase, which converts 2C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-2,4CPP) into 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate in the sixth step of nonmevalonate terpenoid biosynthesis. The family is restricted to bacteria, where it is widely but not universally distributed. No homology can be detected between this family and other proteins.; GO: 0016114 terpenoid biosynthetic process. Probab=83.76 E-value=1.3 Score=24.76 Aligned_cols=74 Identities=24% Similarity=0.454 Sum_probs=43.5 Q ss_pred CCHHHHHHHHHHHHHHHH----------------CCC--CCCCCCCCCCCC---HHHHHHHCCC----CC-CEEEEEECC Q ss_conf 970222134666654210----------------001--233322672326---5777762315----68-879999799 Q gi|254780822|r 30 WCRPCVKLSPIIDDIADE----------------LAD--KVKITKLDIEES---SEISTRYQIS----SI-PTLILFKDG 83 (107) Q Consensus 30 wC~~C~~~~p~~~~l~~~----------------~~~--~i~~~~vd~d~~---~~l~~~~~v~----~~-Pt~~~~~~g 83 (107) .||.|-+..-.+.++..+ |++ +++++-+=|--| ...-..+|+. |. ||..+|++| T Consensus 533 aCP~CGR~~fdv~~~v~~~~~~~~~~~~pvWrekyPGvenL~vAvMGCvVNGPGE~~~AD~G~~g~~~G~tPt~~lf~~g 612 (633) T TIGR00612 533 ACPSCGRTGFDVEKVVKEVQERLAHLKTPVWREKYPGVENLKVAVMGCVVNGPGEAKDADIGISGGGAGATPTIILFKKG 612 (633) T ss_pred ECCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCHHHCCCCCCCCCCCCCCCEEEECCC T ss_conf 78889873226899999999986368888343558885422188997675686211230512336889886535454087 Q ss_pred EEEEEEECCCCCHHHHHHHH Q ss_conf 89858874899989999999 Q gi|254780822|r 84 KVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 84 ~~~~~~~~g~~~~~~l~~~i 103 (107) +++.+......-.+++.+.| T Consensus 613 k~v~~~~~~~~~~~el~~li 632 (633) T TIGR00612 613 KPVKRKVPEEDMVDELIKLI 632 (633) T ss_pred EEEEEECCCCHHHHHHHHHC T ss_conf 26877317002799999861 No 191 >pfam08806 Sep15_SelM Sep15/SelM redox domain. Sep15 and SelM are eukaryotic selenoproteins that have a thioredoxin-like domain and a surface accessible active site redox motif. This suggests that they function as thiol-disulphide isomerases involved in disulphide bond formation in the endoplasmic reticulum. Probab=82.61 E-value=1.3 Score=24.63 Aligned_cols=68 Identities=21% Similarity=0.398 Sum_probs=43.6 Q ss_pred CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEE-CCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 702221346666542100012333226723265777762315688799997-99898588748999899999998419 Q gi|254780822|r 31 CRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK-DGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 31 C~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~-~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) |.-|+... |+.--.|++-|....+.+--+|-=-+-|.++++. +|+.+.+.--...+.+++.+|+.++. T Consensus 7 ~c~CkL~~---------~PevkaFi~~d~~~y~nl~vk~v~Ga~P~L~L~D~~g~~~E~i~Iekw~~d~i~~fL~ekg 75 (77) T pfam08806 7 CCGCKLNR---------LPEVKAFIREDIPLFPNLEIKYVPGADPELVLLDDNGQEVERLSIDKWKRDEINEFLLEKG 75 (77) T ss_pred ECCCCCCC---------CHHHHHHHHCCCCCCCCCEEEEECCCCCEEEEECCCCCEEEEEECCCCCHHHHHHHHHHCC T ss_conf 53521023---------7888998852511279816998569898899975899898897214287999999999718 No 192 >cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI. They exhibit both disulfide oxidase and reductase functions, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides and acting as isomerases to correct any non-native disulfide bonds. They also display chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp57 contains two redox-active TRX (a) domains and two redox inactive TRX-like (b) domains. It shares the same domain arrangement of abb'a' as PDI, but lacks the C-terminal acid-rich region (c domain) that is present in PDI. ERp72 contains one additional redox-active TRX (a) domain at the N-terminus with a molecular structure of a"abb'a'. ERp57 interacts with the lectin chaperones, calnexin and calreticulin, and specifically promotes the oxidative folding of glycoprotei Probab=79.56 E-value=5.8 Score=20.92 Aligned_cols=95 Identities=16% Similarity=0.249 Sum_probs=59.5 Q ss_pred CHHHHHHHHHHCCCCEEEEEEC-CCCHHHHH---HHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCC----CCEE Q ss_conf 7677999998489949999876-99702221---34666654210001-23332267232657777623156----8879 Q gi|254780822|r 7 DTKSFDSEVLECSNPVVVDFWA-SWCRPCVK---LSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISS----IPTL 77 (107) Q Consensus 7 ~~~~f~~~v~~~~~~vlv~f~a-~wC~~C~~---~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~----~Pt~ 77 (107) |.+|-.+ . ..+|.+|.||. +|-..-+. -.--+-++|+++.+ ++.|+.-|-++...-...||+.. -|.+ T Consensus 5 t~dN~~~--f-~~~pLvvvYy~VDy~~n~kgtnYwRNRVlkVAk~f~~~~l~FAia~~~dF~~eL~e~Gl~~~~~~~p~V 81 (111) T cd03073 5 TKDNRAQ--F-TKKPLVVAYYNVDYSKNPKGTNYWRNRVLKVAKDFPDRKLNFAVADKEDFSHELEEFGLDFSGGEKPVV 81 (111) T ss_pred CCCHHHH--C-CCCCEEEEEEECCEEECCCCCHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHCCCCCCCCCCCEE T ss_conf 6211655--4-679879999601330178502899999999998587762699983679989999982877677887579 Q ss_pred EEEE-CCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 9997-998985887489998999999984 Q gi|254780822|r 78 ILFK-DGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 78 ~~~~-~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) .++. +|++- +.-.-..+.+.|.+|+++ T Consensus 82 ~i~~~~g~Ky-~M~~ef~~~~~l~~Fl~~ 109 (111) T cd03073 82 AIRTAKGKKY-VMEEEFSDVDALEEFLED 109 (111) T ss_pred EEECCCCCEE-CCCCCCCCHHHHHHHHHH T ss_conf 9985899762-079753688999999997 No 193 >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Probab=79.29 E-value=3.2 Score=22.39 Aligned_cols=59 Identities=24% Similarity=0.433 Sum_probs=39.7 Q ss_pred CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC--------------CH--HHHHHHCCCCCCEEEEEEC Q ss_conf 9949999876997022213466665421000123332267232--------------65--7777623156887999979 Q gi|254780822|r 19 SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE--------------SS--EISTRYQISSIPTLILFKD 82 (107) Q Consensus 19 ~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~--------------~~--~l~~~~~v~~~Pt~~~~~~ 82 (107) .+| +.|+|.-||.|......++++--.|. .||+.. .+ +-++..|--|+|.+++ .+ T Consensus 2 skp--~lfgsn~Cpdca~a~eyl~rl~v~yd------~VeIt~Sm~NlKrFl~lRDs~~~Fd~vk~~gyiGIPall~-~d 72 (85) T COG4545 2 SKP--KLFGSNLCPDCAPAVEYLERLNVDYD------FVEITESMANLKRFLHLRDSRPEFDEVKSNGYIGIPALLT-DD 72 (85) T ss_pred CCC--EEECCCCCCCHHHHHHHHHHCCCCCE------EEEHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCEEEEE-CC T ss_conf 975--46213568643889999998189822------4325324663998886611546677542068216427871-79 Q ss_pred CEEE Q ss_conf 9898 Q gi|254780822|r 83 GKVI 86 (107) Q Consensus 83 g~~~ 86 (107) |+.+ T Consensus 73 ~~vV 76 (85) T COG4545 73 GKVV 76 (85) T ss_pred CCEE T ss_conf 8688 No 194 >PRK13730 conjugal transfer pilus assembly protein TrbC; Provisional Probab=77.89 E-value=3.8 Score=22.00 Aligned_cols=43 Identities=21% Similarity=0.420 Sum_probs=30.6 Q ss_pred CCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 232657777623156887999979989858874899989999999 Q gi|254780822|r 59 IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 59 ~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) +.-+|.+.++|+|+++|+++..-+ +..... .|..+.++-.+.+ T Consensus 145 vqIdP~lF~qf~I~~VPAlVV~c~-~~~DvI-~Gnl~l~qALekv 187 (209) T PRK13730 145 VQIDPTLFSQYGIRSVPALVVFCS-QGYDII-RGNLRVGQALEKV 187 (209) T ss_pred CEECCHHHHHCCCCCCCEEEEECC-CCCCEE-EECCCHHHHHHHH T ss_conf 136818898759742547899837-875577-5051099999999 No 195 >cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. Through the formation of reversible mixed disulfides, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. ERp44 also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol. Similar to PDI, the b' domain of ERp44 is likely involved in substrate recognition and may be the primary binding site. Probab=71.85 E-value=9.4 Score=19.71 Aligned_cols=99 Identities=6% Similarity=0.053 Sum_probs=59.5 Q ss_pred EECHHHHHHHHHHCCCCEEEEEECCCCHHH-HHHHHHHHH-HHHHCCCCCCCCCCCCCCCHHHHHHHC--CCCCCEEEEE Q ss_conf 757677999998489949999876997022-213466665-421000123332267232657777623--1568879999 Q gi|254780822|r 5 KVDTKSFDSEVLECSNPVVVDFWASWCRPC-VKLSPIIDD-IADELADKVKITKLDIEESSEISTRYQ--ISSIPTLILF 80 (107) Q Consensus 5 ~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C-~~~~p~~~~-l~~~~~~~i~~~~vd~d~~~~l~~~~~--v~~~Pt~~~~ 80 (107) |||=+|-++ +.+.+.|.+|.||.|.--.. +.+...++. +.+ ..+++.|+..|+.....-...+| ..-+|-+.+- T Consensus 3 EiTFeNaEE-ltEeglPfliLF~~pdD~~svk~F~~~V~~~L~~-~~~~vNfltadG~~F~Hpl~HlgKs~~DLP~IaID 80 (111) T cd03072 3 EITFENAEE-LTEEGLPFLILFHDKDDLESLKEFKQAVARQLIS-EKGAINFLTADGDKFRHPLLHLGKTPADLPVIAID 80 (111) T ss_pred EEECCCHHH-HHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHH-HCCCEEEEECCCCHHCCHHHHHCCCHHCCCEEEEE T ss_conf 550233888-7405785699986654001799999999999998-53745589627300125688858981009688765 Q ss_pred ECCEEEEE-EECCCCCHHHHHHHHHH Q ss_conf 79989858-87489998999999984 Q gi|254780822|r 81 KDGKVIDR-MMPGASSQSDIIEWILS 105 (107) Q Consensus 81 ~~g~~~~~-~~~g~~~~~~l~~~i~~ 105 (107) .-...-.. .+.....+..|.+|+.. T Consensus 81 sf~hMY~fp~f~di~~pGkLkqFi~d 106 (111) T cd03072 81 SFRHMYLFPDFEDVYVPGKLKQFVLD 106 (111) T ss_pred ECCEEEECCCCCCCCCCCHHHHHHHH T ss_conf 03212577991223587539999999 No 196 >pfam06053 DUF929 Domain of unknown function (DUF929). Family of proteins from the archaeon Sulfolobus, with undetermined function. Probab=70.21 E-value=9.3 Score=19.74 Aligned_cols=61 Identities=15% Similarity=0.042 Sum_probs=35.8 Q ss_pred HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 98489949999876997022213466665421000123332267232657777623156887999979 Q gi|254780822|r 15 VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 15 v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) ....+++.++...+.||+.|..-+=.+-..-..|++ +.+.-...| . .+.+ ..+|+++|... T Consensus 54 ~~~ngk~~V~fvsw~GCP~gA~~sW~Ly~ALs~yGn-~s~~~~~S~-~---~~~~--~n~PgLiF~n~ 114 (249) T pfam06053 54 LASNGKVAVYFVSWEGCPYGAADSWPLYIALSRYGN-FNLEYHYSD-P---SDVY--PNIPGLIFLNY 114 (249) T ss_pred CCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHCCC-EEEEEECCC-C---CCCC--CCCCEEEEECC T ss_conf 578992699998613687763236899999985696-477884177-3---5478--99975898436 No 197 >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins. They are auto-inserting, self-assembling intracellular anion channels involved in a wide variety of functions including regulated secretion, cell division and apoptosis. They can exist in both water-soluble and membrane-bound states, and are found in various vesicles and membranes. Biochemical studies of the C. elegans homolog, EXC-4, show that the membrane localization domain is present in the N-terminal part of the protein. The structure of soluble human CLIC1 reveals that it is monomeric and it adopts a fold similar to GSTs, containing an N-terminal domain with a TRX fold and a C-terminal alpha helical domain. Upon oxidation, the N-terminal domain of CLIC1 undergoes a structural change to form a non-covalent dimer stabilized by the formation of an intramolecular disulfide bond between two cysteines that are far apart in the reduced form. The CLI Probab=69.82 E-value=10 Score=19.45 Aligned_cols=66 Identities=18% Similarity=0.345 Sum_probs=43.7 Q ss_pred CCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 9970222134666654210001-233322672326577776231568879999799898588748999899999998419 Q gi|254780822|r 29 SWCRPCVKLSPIIDDIADELAD-KVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 29 ~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) -+|+.|++..-++.. ++ .+.+..||..+-++......-.+-|-++++ +|+.+. +...|.++|++.+ T Consensus 20 G~CPF~QR~~mvL~~-----Kgv~f~vt~VDl~~kPe~f~~~~p~~~~PvL~~-~g~~~~-------ds~~I~e~lEe~~ 86 (91) T cd03061 20 GNCPFCQRLFMVLWL-----KGVVFNVTTVDMKRKPEDLKDLAPGTQPPFLLY-NGEVKT-------DNNKIEEFLEETL 86 (91) T ss_pred CCCHHHHHHHHHHHH-----CCCCCEEEEEECCCCHHHHHHHCCCCCCCEEEE-CCEEEE-------CHHHHHHHHHHHC T ss_conf 577778999999997-----499745898554669299996598999999988-999963-------3899999998544 No 198 >pfam04134 DUF393 Protein of unknown function, DUF393. Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown. Probab=68.09 E-value=10 Score=19.48 Aligned_cols=58 Identities=10% Similarity=0.337 Sum_probs=39.9 Q ss_pred EECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCC--CCCEEEEEECCEE Q ss_conf 87699702221346666542100012333226723265777762315--6887999979989 Q gi|254780822|r 26 FWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS--SIPTLILFKDGKV 85 (107) Q Consensus 26 f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~--~~Pt~~~~~~g~~ 85 (107) ||...|+-|......+.+... .+.+.|..++..+..++.+.+++. ...+.+.+.++.. T Consensus 2 ~YDg~C~lC~~~v~~~~~~d~--~~~i~f~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~ 61 (113) T pfam04134 2 LYDGECPLCNREVRFLERRDR--GGRIRFVDIQSAEGQALLEAFGIDPEDLDSRLHIEDGGD 61 (113) T ss_pred EECCCCHHHHHHHHHHHHHCC--CCCEEEEECCCHHHHHHHHHCCCCHHHHCCEEEEECCCE T ss_conf 779978879999999996587--998689858784657888757969799621799964990 No 199 >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Probab=66.33 E-value=8 Score=20.14 Aligned_cols=64 Identities=23% Similarity=0.354 Sum_probs=39.7 Q ss_pred CCCEEEEE-E---CCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCC-CCCCEEE-EEECCEEEE Q ss_conf 99499998-7---69970222134666654210001233322672326577776231-5688799-997998985 Q gi|254780822|r 19 SNPVVVDF-W---ASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQI-SSIPTLI-LFKDGKVID 87 (107) Q Consensus 19 ~~~vlv~f-~---a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v-~~~Pt~~-~~~~g~~~~ 87 (107) +.+++++- . .|-||.+.+....+..... +.|..+|+=.++++.+...- +.-||+= +|-+|+-+. T Consensus 14 ~n~VvLFMKGtp~~P~CGFS~~~vqiL~~~g~-----v~~~~vnVL~d~eiR~~lk~~s~WPT~PQLyi~GEfvG 83 (105) T COG0278 14 ENPVVLFMKGTPEFPQCGFSAQAVQILSACGV-----VDFAYVDVLQDPEIRQGLKEYSNWPTFPQLYVNGEFVG 83 (105) T ss_pred CCCEEEEECCCCCCCCCCCCHHHHHHHHHCCC-----CCEEEEEECCCHHHHHCCHHHCCCCCCCEEEECCEEEC T ss_conf 39569995489999877863999999997498-----63367642169989852464459998641458778764 No 200 >cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle. It stores calcium ions in sufficient quantities (up to 20 mM) to allow repetitive contractions and is essential to maintain movement, respiration and heart beat. A missense mutation in human cardiac calsequestrin is associated with catecholamine-induced polymorphic ventricular tachycardia (CPVT), a rare disease characterized by seizures or sudden death in response to physiologic or emotional stress. Calsequestrin is a highly acidic protein with up to 50 calcium binding sites formed simply by the clustering of two or more acidic residues. The monomer contains three redox inactive TRX-fold domains. Calsequestrin is condensed as a linear polymer in the SR lumen and is membrane-anchored through binding with intra-membrane proteins triadin, junctin and ryanodine receptor (RyR) Ca Probab=66.19 E-value=10 Score=19.46 Aligned_cols=77 Identities=9% Similarity=0.291 Sum_probs=53.5 Q ss_pred CCEEEEEECCC-CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC--CEEEEEEECC-CCC Q ss_conf 94999987699-7022213466665421000123332267232657777623156887999979--9898588748-999 Q gi|254780822|r 20 NPVVVDFWASW-CRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD--GKVIDRMMPG-ASS 95 (107) Q Consensus 20 ~~vlv~f~a~w-C~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~--g~~~~~~~~g-~~~ 95 (107) ..-||=|+.+- ..+-+ .++++|.++..-+.|.++= ++.+|++++.. +-.+-+|.. .+++ ...| ..+ T Consensus 20 diklIGyFk~~~S~hy~----~F~eAAe~F~P~IkFfAtf---~~kvAk~L~LK-~neVdfyePFmeePv--~iP~kp~~ 89 (102) T cd03066 20 DIKLIGYFKSEDSEHYK----AFEEAAEEFHPYIKFFATF---DSKVAKKLGLK-MNEVDFYEPFMEEPV--TIPDKPYS 89 (102) T ss_pred CEEEEEEECCCCCHHHH----HHHHHHHHCCCCEEEEEEE---CHHHHHHHCCC-CCCEEEECCCCCCCC--CCCCCCCC T ss_conf 15788874489866899----9999998636623566564---58899883760-041530046343885--37999886 Q ss_pred HHHHHHHHHHC Q ss_conf 89999999841 Q gi|254780822|r 96 QSDIIEWILSR 106 (107) Q Consensus 96 ~~~l~~~i~~~ 106 (107) .++|++||++| T Consensus 90 e~e~v~fv~~h 100 (102) T cd03066 90 EEELVDFVEEH 100 (102) T ss_pred HHHHHHHHHHC T ss_conf 79999999970 No 201 >cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK). Probab=65.38 E-value=7.4 Score=20.31 Aligned_cols=36 Identities=19% Similarity=0.348 Sum_probs=24.9 Q ss_pred CHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 657777623156887999979989858874899989999999 Q gi|254780822|r 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 62 ~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) +.+-+.+.||.|+||+++ +|+. +-|....+.|.++| T Consensus 156 ~~~~A~~~Gi~GvPtfvi--~~e~----f~G~Drl~~l~~~l 191 (192) T cd03022 156 NTEEAIARGVFGVPTFVV--DGEM----FWGQDRLDMLEEAL 191 (192) T ss_pred HHHHHHHCCCEECCEEEE--CCEE----EEEHHHHHHHHHHH T ss_conf 999999879947778999--9998----75052099999985 No 202 >PRK09027 cytidine deaminase; Provisional Probab=63.93 E-value=4.1 Score=21.80 Aligned_cols=23 Identities=9% Similarity=0.381 Sum_probs=15.7 Q ss_pred CCEEEEE-ECCCCHHHHHHHHHHHH Q ss_conf 9499998-76997022213466665 Q gi|254780822|r 20 NPVVVDF-WASWCRPCVKLSPIIDD 43 (107) Q Consensus 20 ~~vlv~f-~a~wC~~C~~~~p~~~~ 43 (107) +..-+.. |+| ||||+++..++.. T Consensus 118 ~l~~iaVn~~P-CGHCRQFmnEL~~ 141 (295) T PRK09027 118 GIADITVNYTP-CGHCRQFMNELNS 141 (295) T ss_pred CCEEEEEECCC-CHHHHHHHHHCCC T ss_conf 53068850577-4578999986378 No 203 >pfam02630 SCO1-SenC SCO1/SenC. This family is involved in biogenesis of respiratory and photosynthetic systems. SCO1 is required for a post-translational step in the accumulation of subunits COXI and COXII of cytochrome c oxidase. SenC is required for optimal cytochrome c oxidase activity and maximal induction of genes encoding the light-harvesting and reaction centre complexes of R. capsulatus. Probab=63.41 E-value=7.4 Score=20.33 Aligned_cols=61 Identities=23% Similarity=0.327 Sum_probs=36.0 Q ss_pred HHHHHHHHHHCCCCEEEEEECCCCHH-HHHHHHHHHHHHHHCCC---C--CCCCCCCCCC-CHHHHHHH Q ss_conf 67799999848994999987699702-22134666654210001---2--3332267232-65777762 Q gi|254780822|r 8 TKSFDSEVLECSNPVVVDFWASWCRP-CVKLSPIIDDIADELAD---K--VKITKLDIEE-SSEISTRY 69 (107) Q Consensus 8 ~~~f~~~v~~~~~~vlv~f~a~wC~~-C~~~~p~~~~l~~~~~~---~--i~~~~vd~d~-~~~l~~~~ 69 (107) .+.|...-+ .+|+++|.|.=+.|+. |-.+...+.++.+.++. + +.++.||-+. .++..+.| T Consensus 27 G~~~t~~~l-~Gk~~lv~FgfT~CpdiCP~~~~~l~~~~~~l~~~~~~v~~v~iTvDPerDTpe~L~~Y 94 (159) T pfam02630 27 GKNFTSENL-KGKLSLIYFGFTNCPDICPPALDRLTDIIKKLKAENIDVQPVFISVDPERDTPKVLKEY 94 (159) T ss_pred CCEECHHHH-CCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHH T ss_conf 999767995-99889999988899964589999999999985304775599999962488999999999 No 204 >pfam00255 GSHPx Glutathione peroxidase. Probab=60.94 E-value=16 Score=18.44 Aligned_cols=79 Identities=14% Similarity=0.186 Sum_probs=48.5 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCC--------CHHHHHHHCCCCCCEEEEEECCEEEEE Q ss_conf 8994999987699702221346666542100012-3332267232--------657777623156887999979989858 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEE--------SSEISTRYQISSIPTLILFKDGKVIDR 88 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d~--------~~~l~~~~~v~~~Pt~~~~~~g~~~~~ 88 (107) .++.+||.=.|++|+...+ -..|++|.++|+++ +.++.+=|++ +.++..-.....-+++-++.. + T Consensus 20 kGkv~LIVNvAS~Cg~t~q-y~~L~~L~~ky~~~gl~IlaFPcnqF~~QEp~~~~eI~~f~~~~y~v~F~~~~K---i-- 93 (108) T pfam00255 20 RGKVLLIVNVASKCGLTPQ-YTELNELQERYKDRGLVILGFPCNQFGKQEPGSNEEIKYFRPGGYGVTFPIFSK---I-- 93 (108) T ss_pred CCCEEEEEEECCCCCCCCC-HHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEE---E-- T ss_conf 9988999995577889707-999999999723188399986656646679899899999998647998404767---8-- Q ss_pred EECCCCCHHHHHHHH Q ss_conf 874899989999999 Q gi|254780822|r 89 MMPGASSQSDIIEWI 103 (107) Q Consensus 89 ~~~g~~~~~~l~~~i 103 (107) .+.|. +...+-+|+ T Consensus 94 ~VnG~-~~hPlfk~L 107 (108) T pfam00255 94 DVNGE-NAHPLYKFL 107 (108) T ss_pred EECCC-CCCHHHHHH T ss_conf 73499-977888974 No 205 >TIGR00365 TIGR00365 glutaredoxin homolog; InterPro: IPR004480 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This family groups a number of hypothetical proteins from different organisms which are related to glutaredoxin proteins.. Probab=57.62 E-value=13 Score=18.83 Aligned_cols=69 Identities=20% Similarity=0.341 Sum_probs=41.9 Q ss_pred HHHHHHHCCCCEEEEE-EC---CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCC----CCCEEEEEEC Q ss_conf 9999984899499998-76---99702221346666542100012333226723265777762315----6887999979 Q gi|254780822|r 11 FDSEVLECSNPVVVDF-WA---SWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS----SIPTLILFKD 82 (107) Q Consensus 11 f~~~v~~~~~~vlv~f-~a---~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~----~~Pt~~~~~~ 82 (107) ..+.| + .-||+|+= .+ |.||.+++....|....-. -.+|..+|+=+++++.+...-. .+|.+.+ | T Consensus 5 i~~~i-~-~nPv~lfMKGsP~~P~CGFS~~~v~~L~~~~~~---PakF~~~DiL~d~~iR~~lk~ysnWPT~PQLyV--n 77 (103) T TIGR00365 5 IEKLI-E-ANPVLLFMKGSPKLPKCGFSRQAVGILRECGIR---PAKFAYVDILQDPEIRQGLKEYSNWPTFPQLYV--N 77 (103) T ss_pred HHHHH-H-HCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCC---CCCCCCCCCCCCCHHHHHCHHCCCCCCCCCEEE--C T ss_conf 88899-7-598268436889988998817899999854898---211320002478133220100035799983566--5 Q ss_pred CEEE Q ss_conf 9898 Q gi|254780822|r 83 GKVI 86 (107) Q Consensus 83 g~~~ 86 (107) |+-+ T Consensus 78 GEf~ 81 (103) T TIGR00365 78 GEFV 81 (103) T ss_pred CEEE T ss_conf 5355 No 206 >PTZ00137 2-Cys peroxiredoxin; Provisional Probab=56.14 E-value=19 Score=17.96 Aligned_cols=88 Identities=16% Similarity=0.213 Sum_probs=51.8 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCC----------------------------CCCCHHHHH Q ss_conf 8994999987-69970222134666654210001-23332267----------------------------232657777 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLD----------------------------IEESSEIST 67 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd----------------------------~d~~~~l~~ 67 (107) .++.+++.|| +++-+.|-.-...+.+..+++.. ++.++.+- .|.+.++++ T Consensus 32 g~kwvvLffyP~dFT~VCttEl~~~~~~~~eF~~~~~~v~giS~Ds~~sH~aW~~~~~~~~gi~~i~fPllaD~~~~ia~ 111 (194) T PTZ00137 32 GDSYVLLVFYPLDFTFVCPSELLGFSKRLDEFEERNVKVLGCSVDSKFSHLAWKKTDLRKGGVGNLKHPLFSDITRSISK 111 (194) T ss_pred CCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCHHHHCCCCCCCCCEEECCCCHHHH T ss_conf 99679999803778875508999999999999975988999967838889999623486588677334456367335899 Q ss_pred HHCCC---C--CCEEEEE-ECCEEEEEEECC---CCCHHHHHHHHHH Q ss_conf 62315---6--8879999-799898588748---9998999999984 Q gi|254780822|r 68 RYQIS---S--IPTLILF-KDGKVIDRMMPG---ASSQSDIIEWILS 105 (107) Q Consensus 68 ~~~v~---~--~Pt~~~~-~~g~~~~~~~~g---~~~~~~l~~~i~~ 105 (107) .||+- | ....+++ .+|......+.. .|+.+++..-++. T Consensus 112 ~yGvl~~~G~a~RatFiIDp~g~Ir~~~v~~~~vGRnv~EiLR~l~A 158 (194) T PTZ00137 112 SFGLLRDDGFSLRASVLIDKAGVVQHLAVNDLGIGRSVDETLRIFDA 158 (194) T ss_pred HCCCCCCCCCEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 76986368821678999999997999997798768498999999998 No 207 >pfam04551 GcpE GcpE protein. In a variety of organisms, including plants and several eubacteria, isoprenoids are synthesized by the mevalonate-independent 2-C-methyl-D-erythritol 4-phosphate (MEP) pathway. Although different enzymes of this pathway have been described, the terminal biosynthetic steps of the MEP pathway have not been fully elucidated. GcpE gene of Escherichia coli is involved in this pathway. Probab=54.03 E-value=21 Score=17.75 Aligned_cols=76 Identities=18% Similarity=0.267 Sum_probs=38.8 Q ss_pred CCHHHHHHHHHHHHHHH-------HCCCCCCCCCCCCCCC-H--HHHHHHCCCCC-CEEEEEECCEEEEEEECCCCCHHH Q ss_conf 97022213466665421-------0001233322672326-5--77776231568-879999799898588748999899 Q gi|254780822|r 30 WCRPCVKLSPIIDDIAD-------ELADKVKITKLDIEES-S--EISTRYQISSI-PTLILFKDGKVIDRMMPGASSQSD 98 (107) Q Consensus 30 wC~~C~~~~p~~~~l~~-------~~~~~i~~~~vd~d~~-~--~l~~~~~v~~~-Pt~~~~~~g~~~~~~~~g~~~~~~ 98 (107) .||.|-+..-.+.++++ .++..++++-+-|--| | .--..+||.+- ....+|++|+.+.+ +.+..=.++ T Consensus 258 SCPtCGR~~~dl~~~a~~ve~~l~~~~~~l~vAVMGCvVNGPGEak~ADiGiagg~g~~~lf~~G~~v~~-v~~~~iv~~ 336 (345) T pfam04551 258 SCPTCGRTLFDLIKVAKEVEERLSHLKKPLKVAVMGCVVNGPGEAKEADLGIAGGKGKGILFKKGEIVKK-VPEEELVDE 336 (345) T ss_pred ECCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECEEECCCCCCCCCCEEEECCCCCEEEEECCEEEEE-CCHHHHHHH T ss_conf 5887466115599999999999737998988999780431876444476757258896679999999676-388899999 Q ss_pred HHHHHHHC Q ss_conf 99999841 Q gi|254780822|r 99 IIEWILSR 106 (107) Q Consensus 99 l~~~i~~~ 106 (107) |.+-|++. T Consensus 337 l~~~I~~~ 344 (345) T pfam04551 337 LKEEIDEH 344 (345) T ss_pred HHHHHHHC T ss_conf 99999862 No 208 >PRK13189 peroxiredoxin; Provisional Probab=53.51 E-value=21 Score=17.71 Aligned_cols=88 Identities=13% Similarity=0.180 Sum_probs=53.6 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCC---------------------------CCCHHHHHH Q ss_conf 8994999987-69970222134666654210001-233322672---------------------------326577776 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDI---------------------------EESSEISTR 68 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~---------------------------d~~~~l~~~ 68 (107) .++.+++.|| +++-+.|-.-...+.+...++.. ++.++.+.+ |.+.++++. T Consensus 27 ~gkwvvLffyP~DFT~VCttEl~~~~~~~~eF~~~~~~vigiS~Ds~~sH~aW~~~~~~~~G~~i~fPliaD~~~~Is~~ 106 (215) T PRK13189 27 KGKWFVLFSHPADFTPVCTTEFVAFQKRYDEFRKLNTELIGLSIDQVFSHIKWVEWIKEKLGVEIEFPIIADDDGEIAKK 106 (215) T ss_pred CCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHCHHHHCCCCEEEEEEECCCCHHHHH T ss_conf 99889999787778986845999999999999871977999946858689998518787469650344786672648897 Q ss_pred HCCC----C-C--CEEEEE-ECCEEEEEEEC---CCCCHHHHHHHHHH Q ss_conf 2315----6-8--879999-79989858874---89998999999984 Q gi|254780822|r 69 YQIS----S-I--PTLILF-KDGKVIDRMMP---GASSQSDIIEWILS 105 (107) Q Consensus 69 ~~v~----~-~--Pt~~~~-~~g~~~~~~~~---g~~~~~~l~~~i~~ 105 (107) ||+- + . -.++++ .+|......+. -.|+.+++...|++ T Consensus 107 yGvl~~~~~~~a~R~~FIIDp~g~Ir~~~v~~~~vGRnvdEiLR~ldA 154 (215) T PRK13189 107 LGMIHPGKGTNTVRAVFVVDPKGIIRAILYYPQEVGRNMDEILRLVKA 154 (215) T ss_pred CCCCCCCCCCCEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 498025888746747999999986999998388865589999999999 No 209 >TIGR03137 AhpC peroxiredoxin. This gene contains two invariant cysteine residues, one near the N-terminus and one near the C-terminus, each followed immediately by a proline residue. Probab=52.96 E-value=21 Score=17.65 Aligned_cols=87 Identities=13% Similarity=0.206 Sum_probs=53.3 Q ss_pred CCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCC-------------------------CCCHHHHHHHCC Q ss_conf 994999987-69970222134666654210001-233322672-------------------------326577776231 Q gi|254780822|r 19 SNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDI-------------------------EESSEISTRYQI 71 (107) Q Consensus 19 ~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~-------------------------d~~~~l~~~~~v 71 (107) ++.+++.|| +++-+-|-.-...+.+..+++.. ++.++.+-+ |.+.++++.||+ T Consensus 31 Gkw~VLffyP~DFTpVCttEl~~~~~~~~eF~~~n~~vlgiS~Ds~~sH~aW~~~~~~~g~i~fPllaD~~~~vs~~yGv 110 (187) T TIGR03137 31 GKWSVFFFYPADFTFVCPTELEDLADKYAELKKLGVEVYSVSTDTHFVHKAWHDTSEAIGKITYPMLGDPTGVLTRNFGV 110 (187) T ss_pred CCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCCEECCCCCHHHHHCCC T ss_conf 97599999506888877089999999999999779979998559889999997427642772330442886258998297 Q ss_pred C----CCC--EEEEE-ECCEEEEEEEC---CCCCHHHHHHHHHH Q ss_conf 5----688--79999-79989858874---89998999999984 Q gi|254780822|r 72 S----SIP--TLILF-KDGKVIDRMMP---GASSQSDIIEWILS 105 (107) Q Consensus 72 ~----~~P--t~~~~-~~g~~~~~~~~---g~~~~~~l~~~i~~ 105 (107) - +++ .++++ .+|........ -.|+.+++..-+++ T Consensus 111 l~~~~g~a~Ra~FIIDp~g~Ir~~~~~~~~vGRn~~EiLR~l~A 154 (187) T TIGR03137 111 LIEEAGLADRGTFVIDPEGVIQAVEITDNGIGRDASELLRKIKA 154 (187) T ss_pred CCCCCCCCEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 53788861468999999990999997899878599999999998 No 210 >PRK00522 tpx thiol peroxidase; Provisional Probab=50.12 E-value=24 Score=17.39 Aligned_cols=86 Identities=13% Similarity=0.221 Sum_probs=53.8 Q ss_pred CCCCEEEEE-ECCCCHHHHHHHHHHHHHHHHCCCCCCCCCC--CC---------------------CCCHHHHHHHCCC- Q ss_conf 899499998-7699702221346666542100012333226--72---------------------3265777762315- Q gi|254780822|r 18 CSNPVVVDF-WASWCRPCVKLSPIIDDIADELADKVKITKL--DI---------------------EESSEISTRYQIS- 72 (107) Q Consensus 18 ~~~~vlv~f-~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~v--d~---------------------d~~~~l~~~~~v~- 72 (107) .++++++.| -+.+-+.|......+.+...++.+ +.++-| |. +.+.++++.|||. T Consensus 44 ~Gk~vVL~f~P~~~TpvC~~e~~~f~~~~~~~~~-~~v~gIS~D~~~a~~~f~~~~~~~~~~~lsd~~~~~~~~~yGvl~ 122 (168) T PRK00522 44 AGKRKVLNIFPSIDTGVCAASVRKFNQLAAELDN-TVVLCVSADLPFAQSRFCGAEGLENVITLSTFRDAEFGQDYGVAI 122 (168) T ss_pred CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCC-CEEEEEECCCHHHHHHHHHHCCCCCCEECCCCCCCHHHHHCCCEE T ss_conf 9985999997368886527789889999986359-749999689989999999864998866704167763899709575 Q ss_pred ------CC--CEEEEE-ECCEEEEEEEC----CCCCHHHHHHHHH Q ss_conf ------68--879999-79989858874----8999899999998 Q gi|254780822|r 73 ------SI--PTLILF-KDGKVIDRMMP----GASSQSDIIEWIL 104 (107) Q Consensus 73 ------~~--Pt~~~~-~~g~~~~~~~~----g~~~~~~l~~~i~ 104 (107) ++ .+++++ ++|......+. ...+.+++.+.++ T Consensus 123 ~~~~~~g~~~Ra~FVID~~G~I~y~e~v~~~~~~pdyd~~l~alk 167 (168) T PRK00522 123 ADGPLKGLLARAVVVLDEDDNVIYSELVDEITTEPDYDAALAALK 167 (168) T ss_pred CCCCCCCCEEEEEEEECCCCEEEEEEECCCCCCCCCHHHHHHHHC T ss_conf 146225947518999999997999998788888989999999861 No 211 >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Probab=49.77 E-value=24 Score=17.35 Aligned_cols=88 Identities=14% Similarity=0.208 Sum_probs=53.8 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCCC-------------------------CCCHHHHHHHC Q ss_conf 8994999987-69970222134666654210001-233322672-------------------------32657777623 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLDI-------------------------EESSEISTRYQ 70 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd~-------------------------d~~~~l~~~~~ 70 (107) .++.+++.|| +++-+.|-.-...+.++.+++.. ++.++.+.+ |.+.+++++|| T Consensus 30 ~Gkw~VLffyP~DFT~VCtTEl~~~~~~~~eF~~~n~~vigiS~Ds~~sH~aW~~~~~~~~~i~fPlisD~~~~is~~yg 109 (187) T PRK10382 30 EGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGALTRNFD 109 (187) T ss_pred CCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCCCCEEECCCCHHHHHCC T ss_conf 99879999827998985989999999889999974997999925988999999864533158788657888657999829 Q ss_pred CC----CCC--EEEEE-ECCEEEEEEECC---CCCHHHHHHHHHH Q ss_conf 15----688--79999-799898588748---9998999999984 Q gi|254780822|r 71 IS----SIP--TLILF-KDGKVIDRMMPG---ASSQSDIIEWILS 105 (107) Q Consensus 71 v~----~~P--t~~~~-~~g~~~~~~~~g---~~~~~~l~~~i~~ 105 (107) +- +++ ..+++ .+|......+.- .|+.+++...+++ T Consensus 110 vl~~~~g~a~Ra~FIIDp~g~Ir~~~~~~~~vGRn~~EiLR~l~A 154 (187) T PRK10382 110 NMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKA 154 (187) T ss_pred CCCCCCCEEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 966788805778999889984999997899988699999999998 No 212 >KOG2792 consensus Probab=49.36 E-value=25 Score=17.32 Aligned_cols=88 Identities=17% Similarity=0.380 Sum_probs=58.2 Q ss_pred CCCEEEEEECCCCHH-H----HHHHHHHHHHHHHCCCC--CCCCCCCCCC--------------------------CHHH Q ss_conf 994999987699702-2----21346666542100012--3332267232--------------------------6577 Q gi|254780822|r 19 SNPVVVDFWASWCRP-C----VKLSPIIDDIADELADK--VKITKLDIEE--------------------------SSEI 65 (107) Q Consensus 19 ~~~vlv~f~a~wC~~-C----~~~~p~~~~l~~~~~~~--i~~~~vd~d~--------------------------~~~l 65 (107) +|.+|++|.=+.||. | .+|...++++..+.+-. -.|+.+|-++ -+++ T Consensus 139 Gkw~LiYFGFThCPDICPdELeKm~~~Vd~i~~~~~~~~~PlFIsvDPeRD~~~~~~eY~~eF~pkllGLTGT~eqvk~v 218 (280) T KOG2792 139 GKWSLIYFGFTHCPDICPDELEKMSAVVDEIEAKPGLPPVPLFISVDPERDSVEVVAEYVSEFHPKLLGLTGTTEQVKQV 218 (280) T ss_pred CCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCHHHHCCCCCHHHHHHH T ss_conf 51699995256899769699999999999985258998622599847664879999999985086650566889999999 Q ss_pred HHHHCCCCCC-------------EEEEE---ECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 7762315688-------------79999---799898588748999899999998419 Q gi|254780822|r 66 STRYQISSIP-------------TLILF---KDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 66 ~~~~~v~~~P-------------t~~~~---~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) |+.|+|.--+ ++++| .+|+-+. .|+-.++++++.+-|.+|+ T Consensus 219 ak~yRVYfs~gp~d~~~DYlVDHSi~mYLidPeg~Fvd-~~GrN~~~~~~~~~I~~~v 275 (280) T KOG2792 219 AKKYRVYFSTGPKDEDQDYLVDHSIFMYLIDPEGEFVD-YYGRNYDADELADSILKHV 275 (280) T ss_pred HHHHEEEECCCCCCCCCCEEEEEEEEEEEECCCCCEEH-HHCCCCCHHHHHHHHHHHH T ss_conf 98807861468987788856541589999889863006-5346688889999999998 No 213 >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits this transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L. lactis functionally complements an Escherichia coli proU mutant. The complementing locus is similar to a opuA locus in Bacillus subtlis. This clarifies the differences in nomenclature.; GO: 0005524 ATP binding, 0015171 amino acid transmembrane transporter activity, 0006865 amino acid transport, 0016020 membrane. Probab=48.82 E-value=11 Score=19.39 Aligned_cols=45 Identities=18% Similarity=0.440 Sum_probs=37.0 Q ss_pred HHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEE Q ss_conf 21346666542100012333226723265777762315688799997998985 Q gi|254780822|r 35 VKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVID 87 (107) Q Consensus 35 ~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~ 87 (107) +.|-..|.+|.+.+...+.|+..|.|+.-.++.| +++.++|+.+- T Consensus 167 ~~lQdEl~kLq~~~~kTIvFitHDlDEA~rigDR--------Ivilk~GeiVQ 211 (372) T TIGR01186 167 DSLQDELKKLQATLQKTIVFITHDLDEALRIGDR--------IVILKAGEIVQ 211 (372) T ss_pred HHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHH--------HHHEECCCEEE T ss_conf 6788999999986098089994176788767513--------20110686788 No 214 >pfam06953 ArsD Arsenical resistance operon trans-acting repressor ArsD. This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins. ArsD is a trans-acting repressor of the arsRDABC operon that confers resistance to arsenicals and antimonials in Escherichia coli. It possesses two-pairs of vicinal cysteine residues, Cys(12)-Cys(13) and Cys(112)-Cys(113), that potentially form separate binding sites for the metalloids that trigger dissociation of ArsD from the operon. However, as a homodimer it has four vicinal cysteine pairs. Probab=48.66 E-value=25 Score=17.25 Aligned_cols=68 Identities=13% Similarity=0.404 Sum_probs=44.9 Q ss_pred CCHHH-----HHHHHHHHHHHHHCCCCCCCCCCCCCCCH----------HHHHHHCCCCCCEEEEEECCEEEEEEECCCC Q ss_conf 97022-----21346666542100012333226723265----------7777623156887999979989858874899 Q gi|254780822|r 30 WCRPC-----VKLSPIIDDIADELADKVKITKLDIEESS----------EISTRYQISSIPTLILFKDGKVIDRMMPGAS 94 (107) Q Consensus 30 wC~~C-----~~~~p~~~~l~~~~~~~i~~~~vd~d~~~----------~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~ 94 (107) -||+. .+++..++.+.+ ..+.+.+.|...+| ++.+..|..++|-+++ ||+.+.. +... T Consensus 17 VCG~~VD~~L~~~aa~~~~lk~---~gv~v~R~NL~~~P~~F~~N~~V~~~L~~~G~e~LPitlV--DGeIv~~--G~YP 89 (119) T pfam06953 17 VCGPDVDPELVRFAADLDWLKQ---NGVEVERYNLAQQPMAFAENAVVKAFLETSGAEGLPLTLV--DGEIVKT--GRYP 89 (119) T ss_pred CCCCCCCHHHHHHHHHHHHHHH---CCCEEEECCCCCCHHHHHHCHHHHHHHHHCCCCCCCEEEE--CCEEEEE--CCCC T ss_conf 8389879899999999999996---7947997166328799972799999999749654888999--8999881--5699 Q ss_pred CHHHHHHHHH Q ss_conf 9899999998 Q gi|254780822|r 95 SQSDIIEWIL 104 (107) Q Consensus 95 ~~~~l~~~i~ 104 (107) +.++|.+|+. T Consensus 90 t~eEla~w~g 99 (119) T pfam06953 90 TREELARWAG 99 (119) T ss_pred CHHHHHHHHC T ss_conf 9999999969 No 215 >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes an Probab=47.33 E-value=26 Score=17.13 Aligned_cols=88 Identities=13% Similarity=0.147 Sum_probs=51.8 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCC---------------------------CCCCHHHHHH Q ss_conf 8994999987-69970222134666654210001-23332267---------------------------2326577776 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLD---------------------------IEESSEISTR 68 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd---------------------------~d~~~~l~~~ 68 (107) .++.+++.|| +++-+-|..-...+.+..+++.. ++.++.+- .|...+++++ T Consensus 24 G~k~vvlffyP~dfT~vCttEl~~~~~~~~eF~~~~~~vlgiS~Ds~~sH~aW~~~~~~~~g~~v~fPllaD~~~~ia~~ 103 (203) T cd03016 24 GDSWGILFSHPADFTPVCTTELGAFAKLAPEFKKRNVKLIGLSVDSVESHIKWIEDIEEYTGVEIPFPIIADPDREVAKL 103 (203) T ss_pred CCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCHHHHCCCCCCCCCCCCCCHHHHHH T ss_conf 99789999666668987837899999989999974987999737868878888658897569662314222786258887 Q ss_pred HCCC----CCC----EEEEE-ECCEEEEEEEC---CCCCHHHHHHHHHH Q ss_conf 2315----688----79999-79989858874---89998999999984 Q gi|254780822|r 69 YQIS----SIP----TLILF-KDGKVIDRMMP---GASSQSDIIEWILS 105 (107) Q Consensus 69 ~~v~----~~P----t~~~~-~~g~~~~~~~~---g~~~~~~l~~~i~~ 105 (107) ||+- +.+ ..+++ .+|......+. -.|+.+++..-|++ T Consensus 104 yGvl~~~~g~~~a~R~~FIIDp~g~Ir~~~v~~~~vGRnvdEiLR~ldA 152 (203) T cd03016 104 LGMIDPDAGSTLTVRAVFIIDPDKKIRLILYYPATTGRNFDEILRVVDA 152 (203) T ss_pred HCCCCCCCCCCCEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 3443713488633678999899983999997587766688999999999 No 216 >pfam06491 DUF1094 Protein of unknown function (DUF1094). This family consists of several hypothetical bacterial proteins of unknown function. Probab=46.18 E-value=28 Score=17.03 Aligned_cols=53 Identities=25% Similarity=0.369 Sum_probs=32.5 Q ss_pred CCCCCCCCCCCHHHHHHHCC---CCCCEEEEEECCEEEE---EEECCCCCHHHHHHHHHH Q ss_conf 33322672326577776231---5688799997998985---887489998999999984 Q gi|254780822|r 52 VKITKLDIEESSEISTRYQI---SSIPTLILFKDGKVID---RMMPGASSQSDIIEWILS 105 (107) Q Consensus 52 i~~~~vd~d~~~~l~~~~~v---~~~Pt~~~~~~g~~~~---~~~~g~~~~~~l~~~i~~ 105 (107) -.|+-.|.+.-. -++.|=. -+-|++.+||+|+.+. |...-.++.+.|.+-|.+ T Consensus 34 TVFAG~D~eAt~-~aR~y~~~~pPSSPs~ALfKdGelvh~ieRh~IEGr~ae~Ia~~L~~ 92 (96) T pfam06491 34 TVFAGQDKEATA-KAREYFEGYPPSSPSMALFKDGELVHMIERHHIEGREAEEIAENLTE 92 (96) T ss_pred EECCCCCHHHHH-HHHHHCCCCCCCCCCEEEEECCEEEEEEEHHHCCCCCHHHHHHHHHH T ss_conf 865788889999-99986589898995014564898899875120079899999999999 No 217 >PTZ00253 tryparedoxin peroxidase; Provisional Probab=44.44 E-value=29 Score=16.87 Aligned_cols=88 Identities=10% Similarity=0.230 Sum_probs=52.7 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCC----------------------------CCCCHHHHH Q ss_conf 8994999987-69970222134666654210001-23332267----------------------------232657777 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLD----------------------------IEESSEIST 67 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd----------------------------~d~~~~l~~ 67 (107) .++.+++.|| +++-+.|-.-...+.+..+++.. ++.++.+- .|.+.++++ T Consensus 35 ~GkwvvL~fyP~dfT~vCttEl~~~~~~~~eF~~~~~~vigiS~Ds~~sH~aW~~~~~~~~g~~~i~fPliaD~~~~is~ 114 (199) T PTZ00253 35 KGKWVVLFFYPLDFTFVCPTEIIQFSDSVKRFNELNCEVLACSMDSEYAHLQWTLQERKKGGLGTMAIPMLADKTKSIAR 114 (199) T ss_pred CCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCHHHHCCCCCCEEEEEECCCCHHHH T ss_conf 99859999810667886727999999999999777978999978838789988407075588576012157578656889 Q ss_pred HHCCC----CCC--EEEEE-ECCEEEEEEECC---CCCHHHHHHHHHH Q ss_conf 62315----688--79999-799898588748---9998999999984 Q gi|254780822|r 68 RYQIS----SIP--TLILF-KDGKVIDRMMPG---ASSQSDIIEWILS 105 (107) Q Consensus 68 ~~~v~----~~P--t~~~~-~~g~~~~~~~~g---~~~~~~l~~~i~~ 105 (107) .||+- +++ .++++ .+|......+.. .|+.+++...++. T Consensus 115 ~yGvl~e~~G~a~Ra~FIIDp~giIr~~~v~~~~vGRnv~EiLR~l~A 162 (199) T PTZ00253 115 SYGVLEEEQGVAYRGLFIIDPKGMLRQITVNDMPVGRNVEEVLRLLEA 162 (199) T ss_pred HCCCCCCCCCCEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 719602668952678999889984999997798768599999999998 No 218 >PRK13599 putative peroxiredoxin; Provisional Probab=43.54 E-value=30 Score=16.78 Aligned_cols=88 Identities=9% Similarity=0.148 Sum_probs=52.5 Q ss_pred CCCCEEEEEEC-CCCHHHHHHHHHHHHHHHHCCC-CCCCCCCC---------------------------CCCCHHHHHH Q ss_conf 89949999876-9970222134666654210001-23332267---------------------------2326577776 Q gi|254780822|r 18 CSNPVVVDFWA-SWCRPCVKLSPIIDDIADELAD-KVKITKLD---------------------------IEESSEISTR 68 (107) Q Consensus 18 ~~~~vlv~f~a-~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd---------------------------~d~~~~l~~~ 68 (107) .++.+++.||- ++-+-|..-.-.+.+...++.. ++.++.+- .|.+.++++. T Consensus 27 ~Gkw~VLffyP~DfTpvCttEl~~f~~~~~eF~~~n~~vigiS~Ds~~sH~~W~~~i~~~~g~~i~FPiiaD~~~~ia~~ 106 (215) T PRK13599 27 AGKWFVLFSHPADFTPVCTTEFVEFARKANDFKELNTELIGLSVDQVFSHIKWVEWIKDNTNIAIPFPVIADDLGKVSNQ 106 (215) T ss_pred CCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHH T ss_conf 99889999820799985668899999999999975988999847878899999853887569775122551540659998 Q ss_pred HCCC----CC---CEEEEEE-CCEEEEEEEC---CCCCHHHHHHHHHH Q ss_conf 2315----68---8799997-9989858874---89998999999984 Q gi|254780822|r 69 YQIS----SI---PTLILFK-DGKVIDRMMP---GASSQSDIIEWILS 105 (107) Q Consensus 69 ~~v~----~~---Pt~~~~~-~g~~~~~~~~---g~~~~~~l~~~i~~ 105 (107) ||+- +. =.++++. +|......+. -.|+.+++...|++ T Consensus 107 yGml~~~~g~~t~R~~FiIDp~~~ir~~~~yp~~vGRnvdEiLR~ldA 154 (215) T PRK13599 107 LGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKA 154 (215) T ss_pred HCCCCCCCCCCEEEEEEEECCCCCEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 498267888757758999899994899997898778699999999999 No 219 >PRK09303 adaptive-response sensory kinase; Validated Probab=42.41 E-value=32 Score=16.68 Aligned_cols=80 Identities=11% Similarity=0.185 Sum_probs=52.5 Q ss_pred CCCEEEEEECCCCHHHHHHHHH----HHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCC Q ss_conf 9949999876997022213466----665421000123332267232657777623156887999979989858874899 Q gi|254780822|r 19 SNPVVVDFWASWCRPCVKLSPI----IDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGAS 94 (107) Q Consensus 19 ~~~vlv~f~a~wC~~C~~~~p~----~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~ 94 (107) ...-++.|++.. +-++..... ++.+...|+ +.+--+|+.++|.+++.|...++|+++=... ++. ..+.|.. T Consensus 13 ~~l~lll~~~~r-~~~~~~~~~~~~~l~~~~~~~~--~~l~~~~~~~qp~l~e~~~lva~p~l~k~~p-~p~-q~lag~~ 87 (378) T PRK09303 13 QPLQLLLFADRR-PLSREDIRRIIAYLESLDCGFP--ISLQIIDPSEQPELLELHRLVATPALIKISP-EPR-QVLAGSN 87 (378) T ss_pred CCCEEEEEECCC-CCCHHHHHHHHHHHHHCCCCCC--EEEEECCCCCCHHHHHHHHHHCCCHHHHCCC-CCH-HHCCCCC T ss_conf 551799997588-7769999999999983578997--4799747220779999888743613564089-834-3206886 Q ss_pred CHHHHHHHH Q ss_conf 989999999 Q gi|254780822|r 95 SQSDIIEWI 103 (107) Q Consensus 95 ~~~~l~~~i 103 (107) =..++.+|. T Consensus 88 ~~~~l~~w~ 96 (378) T PRK09303 88 IFQQLKNWW 96 (378) T ss_pred HHHHHHHHH T ss_conf 889988762 No 220 >KOG2244 consensus Probab=42.11 E-value=26 Score=17.19 Aligned_cols=72 Identities=17% Similarity=0.329 Sum_probs=46.5 Q ss_pred HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH-HH--HHHHHHCCCCCCCCCCCCCCCHHHHHHH--------CCCCCCE Q ss_conf 67799999848994999987699702221346-66--6542100012333226723265777762--------3156887 Q gi|254780822|r 8 TKSFDSEVLECSNPVVVDFWASWCRPCVKLSP-II--DDIADELADKVKITKLDIEESSEISTRY--------QISSIPT 76 (107) Q Consensus 8 ~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p-~~--~~l~~~~~~~i~~~~vd~d~~~~l~~~~--------~v~~~Pt 76 (107) .+-|++. ...+||+++-..-..|-.|..|+. .| ++.++.+.+++.-++||-++-|++-+-| +--|-|- T Consensus 102 qeaf~ka-r~enkpifLsvgystchwchvmekesfeneet~~ilnenfv~ikVDREERPDVDK~YM~Fv~assg~GGWPm 180 (786) T KOG2244 102 QEAFNKA-RAENKPIFLSVGYSTCHWCHVMEKESFENEETGEILNENFVKIKVDREERPDVDKLYMAFVVASSGGGGWPM 180 (786) T ss_pred HHHHHHH-HHCCCCEEEECCCCCCHHEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHCCCHHHHHHHHHHHCCCCCCCCE T ss_conf 9999988-851898799756664300144301145688889988654453035721067647888999874047898723 Q ss_pred EEEE Q ss_conf 9999 Q gi|254780822|r 77 LILF 80 (107) Q Consensus 77 ~~~~ 80 (107) -++. T Consensus 181 sV~L 184 (786) T KOG2244 181 SVFL 184 (786) T ss_pred EEEE T ss_conf 4775 No 221 >KOG1364 consensus Probab=42.11 E-value=18 Score=18.15 Aligned_cols=53 Identities=21% Similarity=0.333 Sum_probs=38.7 Q ss_pred CCCCCCCCCCCHHHHHHHCCCCCCEEEEEE--CCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 333226723265777762315688799997--998985887489998999999984 Q gi|254780822|r 52 VKITKLDIEESSEISTRYQISSIPTLILFK--DGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 52 i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~--~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) ...+..|..+...+..-|.+.++|.+.++. -|+.+.+. .|..+++++.+-+++ T Consensus 133 wllV~~Dtseg~~~~~Fy~~~~~P~i~iiDp~Tge~v~~w-s~vi~~~~fl~~l~~ 187 (356) T KOG1364 133 WLLVLDDTSEGQPFSAFYHISSLPHIAIIDPITGERVKRW-SGVIEPEQFLSDLNE 187 (356) T ss_pred EEEEEECCCCCCCHHHHEECCCCCEEEEECCCHHHHHHHH-CCCCCHHHHHHHHHH T ss_conf 8998305677776144030467854799778602666543-166688999999999 No 222 >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC. It is encoded by an ORF present in a gene cluster associated with nitrogen fixation that also encodes dinitrogenase reductase ADP-ribosyltransferase (DRAT) and dinitrogenase reductase activating glycohydrolase (DRAG). ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via glutaredoxin, through a single catalytic cysteine. Probab=41.75 E-value=23 Score=17.53 Aligned_cols=27 Identities=7% Similarity=0.271 Sum_probs=19.5 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCC Q ss_conf 999876997022213466665421000 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELA 49 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~ 49 (107) +..|+-|.|..|++...-+++-.-+|. T Consensus 2 it~Y~~P~C~t~rka~~~Le~~gi~~~ 28 (113) T cd03033 2 IIFYEKPGCANNARQKALLEAAGHEVE 28 (113) T ss_pred EEEEECCCCHHHHHHHHHHHHCCCCCE T ss_conf 799978998757999999998799947 No 223 >PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Probab=40.02 E-value=35 Score=16.46 Aligned_cols=54 Identities=15% Similarity=0.161 Sum_probs=29.0 Q ss_pred CCCCCCCCCCCCCC-H--HHHHHHCCCC-CCEEEEEECCEEEEEEECCCCCHHHHHHHH Q ss_conf 01233322672326-5--7777623156-887999979989858874899989999999 Q gi|254780822|r 49 ADKVKITKLDIEES-S--EISTRYQISS-IPTLILFKDGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 49 ~~~i~~~~vd~d~~-~--~l~~~~~v~~-~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i 103 (107) +..++++-+-|--| | .--..+||.+ -|..++|++|+.+.+ +.+..=.++|.+-| T Consensus 295 ~~~i~vAVMGCvVNGPGEak~ADiGiagg~~~~~lf~~G~~~~~-v~~~~iv~~l~~~I 352 (367) T PRK00366 295 KMPLDVAVMGCVVNGPGEAKHADIGIAGGNGKGPVFVDGEKIKT-LPEENIVEELEEEI 352 (367) T ss_pred CCCCEEEEECCEECCCCHHHHCCEEEECCCCCEEEEECCEEEEE-CCHHHHHHHHHHHH T ss_conf 99867999794311765022177726569883579989998134-48889999999999 No 224 >COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Probab=37.86 E-value=31 Score=16.74 Aligned_cols=76 Identities=14% Similarity=0.228 Sum_probs=44.7 Q ss_pred CCHHHHHHHHHHHHHHHH----CCC---CCCCCCCCCCCC-H--HHHHHHCCCC--CCEEEEEECCEEEEEEECCCCCHH Q ss_conf 970222134666654210----001---233322672326-5--7777623156--887999979989858874899989 Q gi|254780822|r 30 WCRPCVKLSPIIDDIADE----LAD---KVKITKLDIEES-S--EISTRYQISS--IPTLILFKDGKVIDRMMPGASSQS 97 (107) Q Consensus 30 wC~~C~~~~p~~~~l~~~----~~~---~i~~~~vd~d~~-~--~l~~~~~v~~--~Pt~~~~~~g~~~~~~~~g~~~~~ 97 (107) .||.|-+..-.+.+..++ +.. .++++-+-|--| | ..-..+||.+ -|...+|.+|+.+.+ ..+..=.+ T Consensus 263 aCP~CGR~~~dv~~~~~~~~~~~~~~~~pl~VAVMGCVVNGPGEak~AdiGia~~~~~~~~~f~~g~~~~~-~~~~~i~e 341 (361) T COG0821 263 ACPTCGRTEFDVIQTLNEVEQRLEHLKTPLKVAVMGCVVNGPGEAKHADIGIAGGGKGSGPVFVKGEIIKK-LPEEDIVE 341 (361) T ss_pred ECCCCCCEEEHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCCCCCCCCEEEECCCCCEEEEEECCEEEEE-CCHHHHHH T ss_conf 89987762256999999999986446877349999757407850001652166489980579976768886-37256899 Q ss_pred HHHHHHHHC Q ss_conf 999999841 Q gi|254780822|r 98 DIIEWILSR 106 (107) Q Consensus 98 ~l~~~i~~~ 106 (107) ++...+++. T Consensus 342 el~~~i~~~ 350 (361) T COG0821 342 ELEALIEAY 350 (361) T ss_pred HHHHHHHHH T ss_conf 999999999 No 225 >pfam11539 DUF3228 Protein of unknown function (DUF3228). This family of proteins has no known function. Probab=37.69 E-value=20 Score=17.88 Aligned_cols=32 Identities=22% Similarity=0.344 Sum_probs=24.1 Q ss_pred EEEECHHHHHHHHHH---CCCCEEEEEECCCCHHH Q ss_conf 177576779999984---89949999876997022 Q gi|254780822|r 3 ALKVDTKSFDSEVLE---CSNPVVVDFWASWCRPC 34 (107) Q Consensus 3 ~i~i~~~~f~~~v~~---~~~~vlv~f~a~wC~~C 34 (107) .|..+.+.|.+.+.+ .++.-++.=|||.|.|- T Consensus 22 ~I~~t~e~F~~~vne~~~~~~~~lvdGYAPFCKH~ 56 (196) T pfam11539 22 YIPCTKEEFVRKVNELIKVGPLKLVDGYAPFCKHL 56 (196) T ss_pred EECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCEEE T ss_conf 74229999999999998518862046656401045 No 226 >COG4752 Uncharacterized protein conserved in bacteria [Function unknown] Probab=37.15 E-value=37 Score=16.29 Aligned_cols=31 Identities=19% Similarity=0.316 Sum_probs=21.2 Q ss_pred HHHHHHHHHHCCCCEEEEEECCCCHHHHHHH Q ss_conf 6779999984899499998769970222134 Q gi|254780822|r 8 TKSFDSEVLECSNPVVVDFWASWCRPCVKLS 38 (107) Q Consensus 8 ~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~ 38 (107) -++..+.+.+.++|+++.|.+-|--|-..|. T Consensus 122 y~~lr~~I~e~dkp~LilfGTGwGlpde~m~ 152 (190) T COG4752 122 YSWLRNEIQERDKPWLILFGTGWGLPDELMN 152 (190) T ss_pred HHHHHHHHHHCCCCEEEEECCCCCCCHHHHH T ss_conf 8888878763378679996378899879987 No 227 >PRK13191 putative peroxiredoxin; Provisional Probab=37.08 E-value=39 Score=16.19 Aligned_cols=88 Identities=10% Similarity=0.126 Sum_probs=51.7 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCC---------------------------CCCCHHHHHH Q ss_conf 8994999987-69970222134666654210001-23332267---------------------------2326577776 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLD---------------------------IEESSEISTR 68 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd---------------------------~d~~~~l~~~ 68 (107) .++.+++.|| +++-+.|-.-.-.+.+...++.. ++.++.+- .|.+.+++++ T Consensus 33 ~gkw~VLffyP~DFTpVCtTEl~~f~~~~~eF~k~n~~vlg~S~Ds~~sH~aW~~~i~~~~g~~i~fPiiaD~~~~ia~~ 112 (230) T PRK13191 33 KGKWFVLFSHPGDFTPVCTTEFYSFAKRYEDFKKLNTELIGLSVDSNISHIEWVNWIEKNLKVEIPFPIIADPMGNVAKR 112 (230) T ss_pred CCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHH T ss_conf 99889999788988995979999999889999975998999978968889999876898359775302665686779998 Q ss_pred HCCC-------CCCEEEEEE-CCEEEEEEEC---CCCCHHHHHHHHHH Q ss_conf 2315-------688799997-9989858874---89998999999984 Q gi|254780822|r 69 YQIS-------SIPTLILFK-DGKVIDRMMP---GASSQSDIIEWILS 105 (107) Q Consensus 69 ~~v~-------~~Pt~~~~~-~g~~~~~~~~---g~~~~~~l~~~i~~ 105 (107) ||+- ++-.++++. +|......+. -.++.+++...|++ T Consensus 113 yGml~~e~~~~tvRavFIIDP~g~Ir~~~~yp~~vGRNvdEiLRvldA 160 (230) T PRK13191 113 LGMIHAESSTSTVRAVFIVDDKGTVRLIMYYPLEIGRNIDEILRAIKA 160 (230) T ss_pred CCCCCCCCCCCEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 598144778643668999999982999996797768598999999999 No 228 >PRK13190 putative peroxiredoxin; Provisional Probab=36.83 E-value=39 Score=16.17 Aligned_cols=88 Identities=11% Similarity=0.123 Sum_probs=51.7 Q ss_pred CCCCEEEEEE-CCCCHHHHHHHHHHHHHHHHCCC-CCCCCCCC---------------------------CCCCHHHHHH Q ss_conf 8994999987-69970222134666654210001-23332267---------------------------2326577776 Q gi|254780822|r 18 CSNPVVVDFW-ASWCRPCVKLSPIIDDIADELAD-KVKITKLD---------------------------IEESSEISTR 68 (107) Q Consensus 18 ~~~~vlv~f~-a~wC~~C~~~~p~~~~l~~~~~~-~i~~~~vd---------------------------~d~~~~l~~~ 68 (107) .++.+++.|| +++-+.|-.....+.++..++.. ++.++.+- .|.+.++++. T Consensus 26 ~Gkw~vlffyP~DfTpvCttEl~~f~~~~~eF~~~~~~vigiS~Ds~~sH~aW~~~~~~~~G~~v~fPliaD~~~~is~~ 105 (202) T PRK13190 26 KGKWVLLFSHPADFTPVCTTEFIAFSRRYEDFKKLGVELVGLSVDSIYSHIAWLRDIEERFGIKIPFPVIADIDKELARE 105 (202) T ss_pred CCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCHHHHCCCCCCCCCCCCCCCHHHHH T ss_conf 99879999953788986717999999989999976988999967539999998568798569331223433895057897 Q ss_pred HCCC----CCC--EEEEE-ECCEEEEEEECC---CCCHHHHHHHHHH Q ss_conf 2315----688--79999-799898588748---9998999999984 Q gi|254780822|r 69 YQIS----SIP--TLILF-KDGKVIDRMMPG---ASSQSDIIEWILS 105 (107) Q Consensus 69 ~~v~----~~P--t~~~~-~~g~~~~~~~~g---~~~~~~l~~~i~~ 105 (107) ||+- +.+ .++++ .+|......+.. .|+.+++...|++ T Consensus 106 yG~l~~~~g~a~R~~FIIDp~g~Ir~~~~~~~~vGRn~~EiLR~ldA 152 (202) T PRK13190 106 YNLIDENSGATVRGVFIIDPNQIVRWMIYYPAETGRNIDEIIRITKA 152 (202) T ss_pred CCCEECCCCCEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHH T ss_conf 49800788965779999999984999997588960278999999998 No 229 >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Probab=36.66 E-value=39 Score=16.15 Aligned_cols=55 Identities=11% Similarity=0.259 Sum_probs=33.3 Q ss_pred EECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHH------------HCCCCCCEEEEEECCEEEEE Q ss_conf 8769970222134666654210001233322672326577776------------23156887999979989858 Q gi|254780822|r 26 FWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR------------YQISSIPTLILFKDGKVIDR 88 (107) Q Consensus 26 f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~------------~~v~~~Pt~~~~~~g~~~~~ 88 (107) +..+.|+.|.....-+++.. +.+.++-+|++.+-+.- =++.++|.+++ ||+-++. T Consensus 7 ~sk~~c~~c~~a~~~~~~~~------~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~t~pqifi--d~~~ig~ 73 (410) T PRK12759 7 YTKTNCPFCDLAKSWFGAND------IPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFV--GDVHIGG 73 (410) T ss_pred EECCCCCHHHHHHHHHHHCC------CCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEE--CCEEECC T ss_conf 80599965899999999749------9723421277798999998765555651577787861778--8834247 No 230 >pfam11287 DUF3088 Protein of unknown function (DUF3088). This family of proteins with unknown function appears to be restricted to Proteobacteria. Probab=35.76 E-value=41 Score=16.07 Aligned_cols=74 Identities=18% Similarity=0.476 Sum_probs=45.0 Q ss_pred CCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH-HHHHHHC--CCCCCEEEEEECCEEEE---EEECC---CCCHHHHH Q ss_conf 9702221346666542100012333226723265-7777623--15688799997998985---88748---99989999 Q gi|254780822|r 30 WCRPCVKLSPIIDDIADELADKVKITKLDIEESS-EISTRYQ--ISSIPTLILFKDGKVID---RMMPG---ASSQSDII 100 (107) Q Consensus 30 wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~-~l~~~~~--v~~~Pt~~~~~~g~~~~---~~~~g---~~~~~~l~ 100 (107) .|++|..++-.+... .....++.+.+|+..+=+ .+.+..| =++.|++++ .+|.... ..++| ..+.+.|. T Consensus 22 ~Cp~c~~iEGlLa~~-P~l~~~ldV~rV~f~RPR~~vv~llGe~~Qs~PvLVL-~~~~~~~~~~~~~~g~rfi~d~~~I~ 99 (111) T pfam11287 22 YCPDCAAIEGLLASF-PALAERLDVERVDFPRPRAAVVALLGEENQSLPVLVL-ADGDPAPDDAATAGGRRFITDPRAIL 99 (111) T ss_pred ECCCHHHHHHHHHHC-CCHHHCCCEEEECCCCCHHHHHHHHCCCCCCCCEEEE-CCCCCCCCCCCCCCCCEECCCHHHHH T ss_conf 677537666087628-1025311179817888649999874800159988996-89998842122458807708989999 Q ss_pred HHHHH Q ss_conf 99984 Q gi|254780822|r 101 EWILS 105 (107) Q Consensus 101 ~~i~~ 105 (107) .++.+ T Consensus 100 ~~La~ 104 (111) T pfam11287 100 RYLAE 104 (111) T ss_pred HHHHH T ss_conf 99999 No 231 >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine. Probab=35.60 E-value=22 Score=17.58 Aligned_cols=76 Identities=22% Similarity=0.303 Sum_probs=39.7 Q ss_pred EEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC----HHHHHHHCCCCCCEEEEEECCEEEEEEE-----CCCCC Q ss_conf 98769970222134666654210001233322672326----5777762315688799997998985887-----48999 Q gi|254780822|r 25 DFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES----SEISTRYQISSIPTLILFKDGKVIDRMM-----PGASS 95 (107) Q Consensus 25 ~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~----~~l~~~~~v~~~Pt~~~~~~g~~~~~~~-----~g~~~ 95 (107) .|+.|.|..|+....-|++-. +.+-.+|.-++ .+|..-++..+.+.--+++......+.. ....+ T Consensus 3 iY~~~~C~t~rka~~~L~~~~------i~~~~id~~k~plt~~eL~~~l~~~g~~~~~lin~r~~~~k~l~l~~~~~~ls 76 (111) T cd03036 3 FYEYPKCSTCRKAKKWLDEHG------VDYTAIDIVEEPPSKEELKKWLEKSGLPLKKFFNTSGKSYRELGLKDKLPSLS 76 (111) T ss_pred EEECCCCHHHHHHHHHHHHCC------CCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHCCCCCHHHHCCCCCCCCCCC T ss_conf 983799888999999999859------98399961477959999999999949899998605761545559300131389 Q ss_pred HHHHHHHHHHC Q ss_conf 89999999841 Q gi|254780822|r 96 QSDIIEWILSR 106 (107) Q Consensus 96 ~~~l~~~i~~~ 106 (107) .+++.+.|.++ T Consensus 77 ~~e~~~ll~~~ 87 (111) T cd03036 77 EEEALELLSSD 87 (111) T ss_pred HHHHHHHHHHC T ss_conf 99999999859 No 232 >KOG0868 consensus Probab=35.51 E-value=30 Score=16.80 Aligned_cols=67 Identities=24% Similarity=0.487 Sum_probs=42.7 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEE Q ss_conf 8994999987699702221346666542100012333226723265777762315688799997998985 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVID 87 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~ 87 (107) +.||++--+|...|.+=.+++-.++.+-=+|.. +.+.+-.-..+.+..+--....+|++++ +|..+. T Consensus 3 ~~KpiLYSYWrSSCswRVRiALaLK~iDYey~P-vnLlk~~~q~~~ef~~iNPm~kVP~L~i--~g~tl~ 69 (217) T KOG0868 3 AAKPILYSYWRSSCSWRVRIALALKGIDYEYKP-VNLLKEEDQSDSEFKEINPMEKVPTLVI--DGLTLT 69 (217) T ss_pred CCCCHHHHHHCCCCHHHHHHHHHHCCCCCCEEE-HHHHCCHHHHHHHHHHCCCHHHCCEEEE--CCEEEE T ss_conf 666213343034214899999987079852031-1643004441367763492420974788--998741 No 233 >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Probab=35.42 E-value=17 Score=18.30 Aligned_cols=26 Identities=15% Similarity=0.290 Sum_probs=18.6 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHC Q ss_conf 99987699702221346666542100 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADEL 48 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~ 48 (107) +-.|+.|.|+.|+....-+++-.-+| T Consensus 3 itiy~~p~C~t~rka~~~L~~~gi~~ 28 (117) T COG1393 3 ITIYGNPNCSTCRKALAWLEEHGIEY 28 (117) T ss_pred EEEEECCCCHHHHHHHHHHHHCCCCC T ss_conf 89972798758999999999869996 No 234 >TIGR02654 circ_KaiB circadian clock protein KaiB; InterPro: IPR013474 The cyanobacterial circadian clock protein KaiB is encoded in the kaiABC operon that controls circadian rhythms. KaiB has homologues of unknown function in some Archaea and Proteobacteria, and paralogs of unknown function in some Cyanobacteria. KaiB forms homodimers, homotetramers, and multimeric complexes with KaiA and/or KaiC.; GO: 0007623 circadian rhythm. Probab=33.90 E-value=35 Score=16.43 Aligned_cols=62 Identities=16% Similarity=0.189 Sum_probs=45.2 Q ss_pred CEEEEEECCCCHHHHHHHHHHHHHH-HHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC Q ss_conf 4999987699702221346666542-1000123332267232657777623156887999979 Q gi|254780822|r 21 PVVVDFWASWCRPCVKLSPIIDDIA-DELADKVKITKLDIEESSEISTRYQISSIPTLILFKD 82 (107) Q Consensus 21 ~vlv~f~a~wC~~C~~~~p~~~~l~-~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~ 82 (107) +++=.|-|-..+.+.+....+.++- .++.|-.-+--+|+-++|++++.=.|-++||+--+-. T Consensus 4 y~lklyvaGntPns~ral~tl~~ile~~f~Gvyalkvidvl~~P~laeedkilatPtl~k~lP 66 (87) T TIGR02654 4 YVLKLYVAGNTPNSVRALKTLKNILETEFKGVYALKVIDVLKNPQLAEEDKILATPTLSKILP 66 (87) T ss_pred EEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCEECCCCHHHCCC T ss_conf 688886406883368999999998764326303343324551886333131101431010068 No 235 >PRK01655 spxA transcriptional regulator Spx; Reviewed Probab=33.78 E-value=20 Score=17.81 Aligned_cols=22 Identities=18% Similarity=0.388 Sum_probs=15.9 Q ss_pred EEEECCCCHHHHHHHHHHHHHH Q ss_conf 9987699702221346666542 Q gi|254780822|r 24 VDFWASWCRPCVKLSPIIDDIA 45 (107) Q Consensus 24 v~f~a~wC~~C~~~~p~~~~l~ 45 (107) -.|+.|.|..|++...-|++-. T Consensus 3 tiY~~p~Cst~rkA~~wL~~~~ 24 (131) T PRK01655 3 TLFTSPSCTSCRKAKAWLEEHE 24 (131) T ss_pred EEECCCCCHHHHHHHHHHHHCC T ss_conf 8974899878999999999769 No 236 >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX), through a single catalytic cysteine. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases. Spx is a general regulator that exerts negative and positive control over transcription initiation by binding to the C-terminal domain of the alpha subunit of RNA polymerase. Probab=33.71 E-value=13 Score=18.93 Aligned_cols=79 Identities=15% Similarity=0.139 Sum_probs=40.2 Q ss_pred EEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCC--CCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEE----CCCCCHH Q ss_conf 998769970222134666654210001233322--6723265777762315688799997998985887----4899989 Q gi|254780822|r 24 VDFWASWCRPCVKLSPIIDDIADELADKVKITK--LDIEESSEISTRYQISSIPTLILFKDGKVIDRMM----PGASSQS 97 (107) Q Consensus 24 v~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~--vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~----~g~~~~~ 97 (107) ..|+.|.|..|+....-|++-.-+|.- +.+.+ ++.++-.++.+++ +.+.--+++......+.. .-..+.+ T Consensus 2 ~iy~~~~Cs~~rka~~~L~~~~i~~~~-~d~~k~~~s~~eL~~~l~~~---~~~~~~li~~~~~~~k~l~~~~~~~ls~~ 77 (105) T cd02977 2 TIYGNPNCSTSRKALAWLEEHGIEYEF-IDYLKEPPTKEELKELLAKL---GLGVEDLFNTRGTPYRKLGLADKDELSDE 77 (105) T ss_pred EEEECCCCHHHHHHHHHHHHCCCCCEE-EHHHHCCCCHHHHHHHHHHC---CCCHHHHHHHCCHHHHHCCCCCCCCCCHH T ss_conf 897279987899999999857997388-60432269999999999975---99899998633245988498340139999 Q ss_pred HHHHHHHHC Q ss_conf 999999841 Q gi|254780822|r 98 DIIEWILSR 106 (107) Q Consensus 98 ~l~~~i~~~ 106 (107) ++.+.|.++ T Consensus 78 e~~~ll~~~ 86 (105) T cd02977 78 EALELMAEH 86 (105) T ss_pred HHHHHHHHC T ss_conf 999999969 No 237 >KOG1422 consensus Probab=33.24 E-value=45 Score=15.82 Aligned_cols=67 Identities=19% Similarity=0.306 Sum_probs=38.9 Q ss_pred CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 9970222134666654210001233322672326577776231568879999799898588748999899999998419 Q gi|254780822|r 29 SWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 29 ~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) --|+.|+++...+. .+-. .+.+..||..+-++-....--.+=|-++.| +|+- ..+.+.|+++|++.+ T Consensus 19 Gdcpf~qr~~m~L~---~k~~-~f~vttVd~~~kp~~f~~~sp~~~~P~l~~-d~~~-------~tDs~~Ie~~Lee~l 85 (221) T KOG1422 19 GDCPFCQRLFMTLE---LKGV-PFKVTTVDLSRKPEWFLDISPGGKPPVLKF-DEKW-------VTDSDKIEEFLEEKL 85 (221) T ss_pred CCCHHHHHHHHHHH---HCCC-CCEEEEEECCCCCHHHHHHCCCCCCCEEEE-CCCE-------ECCHHHHHHHHHHHC T ss_conf 89744789999999---8188-734898616889699995288889986975-8724-------204899999999856 No 238 >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases. Probab=32.89 E-value=20 Score=17.77 Aligned_cols=25 Identities=8% Similarity=0.186 Sum_probs=18.4 Q ss_pred EEEECCCCHHHHHHHHHHHHHHHHC Q ss_conf 9987699702221346666542100 Q gi|254780822|r 24 VDFWASWCRPCVKLSPIIDDIADEL 48 (107) Q Consensus 24 v~f~a~wC~~C~~~~p~~~~l~~~~ 48 (107) ..|+-|.|+.|+....-+++-.-+| T Consensus 2 ~iY~~p~Cst~rka~~~L~~~~i~~ 26 (112) T cd03034 2 TIYHNPRCSKSRNALALLEEAGIEP 26 (112) T ss_pred EEEECCCCHHHHHHHHHHHHCCCCC T ss_conf 8986799888999999999879984 No 239 >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2. Unlike cytosolic PGE synthase (cPGES) and microsomal PGES Type 1 (mPGES1), mPGES2 does not require glutathione (GSH) for its activity, although its catalytic rate is increased two- to four-fold in the presence of DTT, GSH or other thiol compounds. PGE2 is widely distributed in various tissues and is implicated in the sleep/wake cycle, relaxation/contraction of smooth muscle, excretion of sodium ions, maintenance of body temperature and mediation of inflammation. mPGES2 contains an N-terminal hydrophobic domain which is membrane associated, and a C-terminal soluble domain with a GST-like structure. Probab=32.65 E-value=46 Score=15.77 Aligned_cols=72 Identities=17% Similarity=0.228 Sum_probs=44.7 Q ss_pred EECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 87699702221346666542100012333226723265777762315688799997998985887489998999999984 Q gi|254780822|r 26 FWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 26 f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) |-=..||+|.+....++...-. +..+.+|-..-+++... +-+-+|.+.+=.+|.... . .+...|++.|.+ T Consensus 5 Yqy~~CPFC~KVR~~L~~~~ip----y~~veV~p~~k~ei~~s-~~~KVP~l~i~~~~~~~~-l----~DSs~II~~L~~ 74 (77) T cd03040 5 YQYKTCPFCCKVRAFLDYHGIP----YEVVEVNPVSRKEIKWS-SYKKVPILRVESGGDGQQ-L----VDSSVIISTLKT 74 (77) T ss_pred EEECCCCCHHHHHHHHHHCCCC----CEEEECCCCCCCCCCCC-CCCCCCEEEEECCCCEEE-E----ECHHHHHHHHHH T ss_conf 9867896189999999875997----27998173011413468-977887999972898069-8----602999999986 Q ss_pred CC Q ss_conf 19 Q gi|254780822|r 106 RV 107 (107) Q Consensus 106 ~l 107 (107) +| T Consensus 75 ~l 76 (77) T cd03040 75 YL 76 (77) T ss_pred HC T ss_conf 54 No 240 >COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Probab=32.03 E-value=47 Score=15.71 Aligned_cols=88 Identities=17% Similarity=0.250 Sum_probs=53.2 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCC--------HHHH---H-HHCC------------- Q ss_conf 8994999987699702221346666542100012-33322672326--------5777---7-6231------------- Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEES--------SEIS---T-RYQI------------- 71 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d~~--------~~l~---~-~~~v------------- 71 (107) .++.+||.=.|+-|+.--+.+ .|+.|.++|+++ +.++-.=|++. .+++ + .||| T Consensus 24 ~GkVlLIVNtASkCGfTpQYe-gLe~Ly~ky~~~Gf~VLgFPcNQF~~QEPg~~eEI~~fC~~~YgVtFp~f~Ki~VnG~ 102 (162) T COG0386 24 KGKVLLIVNTASKCGFTPQYE-GLEALYKKYKDKGFEVLGFPCNQFGGQEPGSDEEIAKFCQLNYGVTFPMFSKIDVNGK 102 (162) T ss_pred CCCEEEEEECCCCCCCCHHHH-HHHHHHHHHHHCCCEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEEEECCC T ss_conf 996899997454468867589-9999999986489689931452105579898799999987556964551467762699 Q ss_pred ----------C-------------CCCEEEEEECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf ----------5-------------68879999799898588748999899999998419 Q gi|254780822|r 72 ----------S-------------SIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 72 ----------~-------------~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) . .+--+++=++|+++.|+ +....++++...|++.| T Consensus 103 ~a~PLy~~L~~~~~g~~~~~~IkWNFtKFLvdr~G~VV~Rf-~p~t~P~d~~~~Ie~lL 160 (162) T COG0386 103 NAHPLYKYLKEQKPGKLGGKDIKWNFTKFLVDRDGNVVKRF-SPKTKPEDIELAIEKLL 160 (162) T ss_pred CCCCHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCEEEEE-CCCCCHHHHHHHHHHHH T ss_conf 87807999984278776687643013788786999689850-89998216999999985 No 241 >PRK10606 btuE putative glutathione peroxidase; Provisional Probab=31.11 E-value=49 Score=15.61 Aligned_cols=42 Identities=17% Similarity=0.203 Sum_probs=31.0 Q ss_pred CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCC-CCCCCCCCC Q ss_conf 8994999987699702221346666542100012-333226723 Q gi|254780822|r 18 CSNPVVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIE 60 (107) Q Consensus 18 ~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~-i~~~~vd~d 60 (107) .+|.+||.=.|+-||.-.+ -..|++|.++|+++ +.++.+=|+ T Consensus 24 ~GKvvLIVNvAS~CG~T~q-Y~~L~~L~~~y~~~Gl~ILgFPcN 66 (183) T PRK10606 24 AGNVLLIVNVASKCGLTPQ-YEQLENIQKAWADQGFVVLGFPCN 66 (183) T ss_pred CCCEEEEEECCCCCCCCHH-HHHHHHHHHHHHCCCEEEEEEEHH T ss_conf 9968999977755788077-999999999841188389974206 No 242 >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase; InterPro: IPR010039 This entry describes a small family of highly conserved proteins (>60 0dentity). Two of these, BcbF and EcbF of Pasteurella multocida are believed to be part of the capsule polysaccharide biosynthesis machinery because they are co-transcribed from a locus devoted to that purpose . In P. multocida there are six different variant capsules (A-F), and these proteins are found only in B and E. The other two species in which this gene is (currently) found are both also pathogenic. These proteins are also members of the IIIC subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. All of the characterised enzymes within subfamily III are phosphatases, and all of the active site residues characteristic of HAD-superfamily phosphatases are present in this subfamily.. Probab=31.01 E-value=20 Score=17.80 Aligned_cols=20 Identities=20% Similarity=0.317 Sum_probs=6.4 Q ss_pred CCCCCCCHHHHHHHCCCCCC Q ss_conf 26723265777762315688 Q gi|254780822|r 56 KLDIEESSEISTRYQISSIP 75 (107) Q Consensus 56 ~vd~d~~~~l~~~~~v~~~P 75 (107) +||+-.-|-+..=++=..+| T Consensus 60 ~INI~TLP~I~~WL~~H~VP 79 (126) T TIGR01689 60 KINIHTLPIIIDWLNQHNVP 79 (126) T ss_pred CCHHHHHHHHHHHHHHCCCC T ss_conf 12120212688787506998 No 243 >TIGR02959 SigZ RNA polymerase sigma factor, SigZ family; InterPro: IPR014304 This entry is a group of RNA polymerase sigma factors where one of the members is designated as SigZ in Bacillus subtilis . This group has a very sporadic distribution, B. subtilis, for instance, being the only sequenced strain of Bacilli with a member Dechloromonas aromatica (strain RCB), that appears to have two of these sigma factors. A member of which appears on a plasmid found in Photobacterium profundum SS9 and Vibrio fischeri (strain ATCC 700601 / ES114), where a second one is chromosomally encoded.. Probab=29.37 E-value=24 Score=17.37 Aligned_cols=36 Identities=28% Similarity=0.572 Sum_probs=30.7 Q ss_pred HHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCC Q ss_conf 346666542100012333226723265777762315 Q gi|254780822|r 37 LSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72 (107) Q Consensus 37 ~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~ 72 (107) +.|.+..|.++|..-+..+.++.=..+++|+++|++ T Consensus 94 l~~~i~~LP~~~r~a~~L~el~G~sQ~e~A~kLGlS 129 (170) T TIGR02959 94 LRPMIKELPDEYREAIRLTELEGLSQKEIAEKLGLS 129 (170) T ss_pred HHHHHHHCCHHHHHHHHHHHCCCCCHHHHHHHCCCC T ss_conf 899887569867889888750799827998761753 No 244 >cd03021 DsbA_GSTK DsbA family, Glutathione (GSH) S-transferase Kappa (GSTK) subfamily; GSTK is a member of the GST family of enzymes which catalyzes the transfer of the thiol of GSH to electrophilic substrates. It is specifically located in the mitochondria and peroxisomes, unlike other members of the canonical GST family, which are mainly cytosolic. The biological substrates of GSTK are not yet known. It is presumed to have a protective role during respiration when large amounts of reactive oxygen species are generated. GSTK has the same general fold as DsbA, consisting of a thioredoxin domain interrupted by an alpha-helical domain and its biological unit is a homodimer. GSTK is closely related to the bacterial enzyme, 2-hydroxychromene-2-carboxylate (HCCA) isomerase. It shows little sequence similarity to the other members of the GST family. Probab=28.23 E-value=55 Score=15.32 Aligned_cols=38 Identities=13% Similarity=0.396 Sum_probs=25.1 Q ss_pred HHHHHHCCCCCCEEEEEE-CCEEEEEEECCCCCHHHHHHHH Q ss_conf 777762315688799997-9989858874899989999999 Q gi|254780822|r 64 EISTRYQISSIPTLILFK-DGKVIDRMMPGASSQSDIIEWI 103 (107) Q Consensus 64 ~l~~~~~v~~~Pt~~~~~-~g~~~~~~~~g~~~~~~l~~~i 103 (107) +-+...||-|.||+++-. +|+... ++ |....+.+.++| T Consensus 170 ~~Ai~~GvFGvPtf~v~~~~g~~E~-Fw-GqDRL~~le~~L 208 (209) T cd03021 170 DEALKYGAFGLPWIVVTNDKGKTEM-FF-GSDRFEQVADFL 208 (209) T ss_pred HHHHHCCCCCCCEEEEECCCCCCCE-EE-CCCHHHHHHHHH T ss_conf 9999889862898999789986150-42-641399999971 No 245 >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Class Omega GSTs show little or no GSH-conjugating activity towards standard GST substrates. Instead, they catalyze the GSH dependent reduction of protein disulfides, dehydroascorbate and monomethylarsonate, activities which are more characteristic of glutaredoxins. They contain a conserved cysteine equivalent to the first cysteine in the CXXC motif of glutaredoxins, which is a redox active residue capable of reducing GSH mixed disulfides in a monothiol mechanism. Polymorphisms of the class Omega Probab=28.16 E-value=55 Score=15.31 Aligned_cols=61 Identities=10% Similarity=0.273 Sum_probs=39.1 Q ss_pred EEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHH-HCCCCCCEEEEEECCEEEE Q ss_conf 99998769970222134666654210001233322672326577776-2315688799997998985 Q gi|254780822|r 22 VVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR-YQISSIPTLILFKDGKVID 87 (107) Q Consensus 22 vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~-~~v~~~Pt~~~~~~g~~~~ 87 (107) .+=.|..++|++|++..-.+....- .+.++.||...-++.... ..--.+|++.. .+|+.+. T Consensus 18 ~mkLY~~~~cPfa~rVri~L~eKgi----~~e~v~v~l~~kpe~~l~~NP~gkVP~L~~-d~g~~i~ 79 (89) T cd03055 18 IIRLYSMRFCPYAQRARLVLAAKNI----PHEVININLKDKPDWFLEKNPQGKVPALEI-DEGKVVY 79 (89) T ss_pred EEEEECCCCCHHHHHHHHHHHHCCC----CCEEEEECCCCCCHHHHHHCCCCCCCEEEE-CCCEEEE T ss_conf 4899726999199999999998399----878999578658878897587998666994-7998995 No 246 >PRK13344 spxA transcriptional regulator Spx; Reviewed Probab=27.80 E-value=55 Score=15.29 Aligned_cols=22 Identities=18% Similarity=0.280 Sum_probs=15.4 Q ss_pred EEEECCCCHHHHHHHHHHHHHH Q ss_conf 9987699702221346666542 Q gi|254780822|r 24 VDFWASWCRPCVKLSPIIDDIA 45 (107) Q Consensus 24 v~f~a~wC~~C~~~~p~~~~l~ 45 (107) -.|+.+.|..|+....=|++-. T Consensus 3 ~iY~~~~C~TcrKA~kWL~~~~ 24 (132) T PRK13344 3 KIYTISSCTSCKKAKTWLNAHQ 24 (132) T ss_pred EEECCCCCHHHHHHHHHHHHCC T ss_conf 8966799867899999999879 No 247 >PRK10026 arsenate reductase; Provisional Probab=27.54 E-value=30 Score=16.79 Aligned_cols=80 Identities=10% Similarity=0.154 Sum_probs=37.7 Q ss_pred EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCC--CCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEE---CCCCCHH Q ss_conf 9998769970222134666654210001233322--6723265777762315688799997998985887---4899989 Q gi|254780822|r 23 VVDFWASWCRPCVKLSPIIDDIADELADKVKITK--LDIEESSEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQS 97 (107) Q Consensus 23 lv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~--vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~---~g~~~~~ 97 (107) +..|+-|.|+-|++....+++-..++. -+...+ .+.++-.++..++++ +..-+++.++...... ....+.+ T Consensus 4 itIYHNPrCSKSR~aL~lL~e~g~e~~-vv~YLk~p~s~~eL~~l~~~Lg~---~~~~liRk~e~~~kel~L~~~~lsdd 79 (141) T PRK10026 4 ITIYHNPACGTSRNTLEMIRNSGTEPT-IIYYLETPPTRDELVKLIADMGI---SVRALLRKNVEPYEELGLAEDKFTDD 79 (141) T ss_pred EEEEECCCCHHHHHHHHHHHHCCCCCE-EEHHHCCCCCHHHHHHHHHHCCC---CHHHHHHCCCCHHHHCCCCCCCCCHH T ss_conf 289889897889999999998699958-71562179999999999998599---99999873563588849998899999 Q ss_pred HHHHHHHHC Q ss_conf 999999841 Q gi|254780822|r 98 DIIEWILSR 106 (107) Q Consensus 98 ~l~~~i~~~ 106 (107) ++.+++-+| T Consensus 80 eli~~m~~~ 88 (141) T PRK10026 80 QLIDFMLQH 88 (141) T ss_pred HHHHHHHHC T ss_conf 999999968 No 248 >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. In addition, GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. This family, also referred to as soluble GSTs, is the largest family of GSH transferases and is only distantly related to the mitochondrial GSTs (GSTK subfamily, a member of the DsbA family). Soluble GSTs bear no structural similarity to microsomal GSTs (MAPEG family) and display additional activities unique to their group, such as catalyzing thiolysis, reduction and isomerization of certain compounds. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical doma Probab=27.03 E-value=57 Score=15.20 Aligned_cols=57 Identities=12% Similarity=0.230 Sum_probs=35.2 Q ss_pred EEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC--HHHHHHHCCCCCCEEEEEECCEEEE Q ss_conf 98769970222134666654210001233322672326--5777762315688799997998985 Q gi|254780822|r 25 DFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES--SEISTRYQISSIPTLILFKDGKVID 87 (107) Q Consensus 25 ~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~--~~l~~~~~v~~~Pt~~~~~~g~~~~ 87 (107) .|+.+.|+.|.+..-.++...-.+. ...++..+. .+..+...-..+|++.. +|..+. T Consensus 3 Ly~~~~s~~~~~v~~~l~~~gi~~~----~~~v~~~~~~~~~~~~~~p~~~vP~l~~--~~~~i~ 61 (71) T cd00570 3 LYYFPGSPRSLRVRLALEEKGLPYE----LVPVDLGEGEQEEFLALNPLGKVPVLED--GGLVLT 61 (71) T ss_pred EEECCCCHHHHHHHHHHHHCCCCCE----EEECCCCCCCCHHHHHHCCCCCCCEEEE--CCEEEE T ss_conf 9807999379999999998199856----9873455437899996486667888998--997997 No 249 >pfam09822 ABC_transp_aux ABC-type uncharacterized transport system. This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins. Probab=26.73 E-value=58 Score=15.16 Aligned_cols=100 Identities=16% Similarity=0.145 Sum_probs=50.2 Q ss_pred EECHHHHHHHHHHCCCCEEEEEECCCCHH--HHHHHHHHHHHHHHC----CCCCCCCCCCCCCCHHHHHHH----CCC-- Q ss_conf 75767799999848994999987699702--221346666542100----012333226723265777762----315-- Q gi|254780822|r 5 KVDTKSFDSEVLECSNPVVVDFWASWCRP--CVKLSPIIDDIADEL----ADKVKITKLDIEESSEISTRY----QIS-- 72 (107) Q Consensus 5 ~i~~~~f~~~v~~~~~~vlv~f~a~wC~~--C~~~~p~~~~l~~~~----~~~i~~~~vd~d~~~~l~~~~----~v~-- 72 (107) .|++.+ .+.+.+=++|+-|.+|.+.--+ -....+.+.++-++| ++++.+-.||-+.+++.++++ ++. T Consensus 11 tLS~~T-~~~l~~L~~pv~I~~~~s~~~~~~~~~~~~~i~~lL~eY~~~s~~~i~v~~iDP~~~~~~~~~~~~~~gi~~~ 89 (266) T pfam09822 11 TLSEAT-KKLLKQLDEPVTITVFFSGKLPPELKPLRPRVRDLLEEYAALSPGKIKVEFIDPVEPPSEAEEAAEKYGIQPV 89 (266) T ss_pred ECCHHH-HHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHCCCCCC T ss_conf 338889-9999819998899999878877567889999999999999858996699997999996899999987599873 Q ss_pred -------------CCCEEEEEECCEEEEEEE--CCCCCHHHHHHHHHH Q ss_conf -------------688799997998985887--489998999999984 Q gi|254780822|r 73 -------------SIPTLILFKDGKVIDRMM--PGASSQSDIIEWILS 105 (107) Q Consensus 73 -------------~~Pt~~~~~~g~~~~~~~--~g~~~~~~l~~~i~~ 105 (107) .+|.+++..+++...... ....-+.+|...|.+ T Consensus 90 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~lE~~it~aI~~ 137 (266) T pfam09822 90 LLVVENGKSSVVTIYFGLVVEYGDKREVIPFLDNVQNLEYELTRAIQK 137 (266) T ss_pred EEEEECCCCCEEEEECEEEEEECCEEEEEECCCCCCCHHHHHHHHHHH T ss_conf 256205764305760569999789579940478665759999999999 No 250 >COG3411 Ferredoxin [Energy production and conversion] Probab=26.51 E-value=59 Score=15.14 Aligned_cols=29 Identities=17% Similarity=0.307 Sum_probs=20.5 Q ss_pred CCEEEEEECCEEEEEEECCCCCHHHHHHHHHHCC Q ss_conf 8879999799898588748999899999998419 Q gi|254780822|r 74 IPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107 (107) Q Consensus 74 ~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~~l 107 (107) =|+++.|.+| ..| +..+.+...+++++|| T Consensus 17 gPvl~vYpeg----vWY-~~V~p~~a~rIv~~hl 45 (64) T COG3411 17 GPVLVVYPEG----VWY-TRVDPEDARRIVQSHL 45 (64) T ss_pred CCEEEEECCC----EEE-ECCCHHHHHHHHHHHH T ss_conf 9879993587----468-2169899999999997 No 251 >cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle. It stores calcium ions in sufficient quantities (up to 20 mM) to allow repetitive contractions and is essential to maintain movement, respiration and heart beat. A missense mutation in human cardiac calsequestrin is associated with catecholamine-induced polymorphic ventricular tachycardia (CPVT), a rare disease characterized by seizures or sudden death in response to physiologic or emotional stress. Calsequestrin is a highly acidic protein with up to 50 calcium binding sites formed simply by the clustering of two or more acidic residues. The monomer contains three redox inactive TRX-fold domains. Calsequestrin is condensed as a linear polymer in the SR lumen and is membrane-anchored through binding with intra-membrane proteins triadin, junctin Probab=26.44 E-value=59 Score=15.13 Aligned_cols=103 Identities=14% Similarity=0.202 Sum_probs=69.9 Q ss_pred EECHHHHHHHHHH-CCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHH----HHHCCCC-CCE Q ss_conf 7576779999984-899499998769970222134666654210001--2333226723265777----7623156-887 Q gi|254780822|r 5 KVDTKSFDSEVLE-CSNPVVVDFWASWCRPCVKLSPIIDDIADELAD--KVKITKLDIEESSEIS----TRYQISS-IPT 76 (107) Q Consensus 5 ~i~~~~f~~~v~~-~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~--~i~~~~vd~d~~~~l~----~~~~v~~-~Pt 76 (107) ++..++..+.=-+ -++..++.|-.+--+--.+|.+.++++|+++.+ ++.|+-||-|+.|-+. +.|+|.- -|+ T Consensus 5 Kl~~e~m~e~W~dd~~g~~IvAFaee~d~dG~eFl~ilk~vA~~nt~n~~LsivWIDPD~FPll~~yWektF~IDl~~Pq 84 (120) T cd03074 5 KLKPENMFETWEDDLDGIHIVAFAEEEDPDGYEFLEILKEVARDNTDNPDLSIIWIDPDDFPLLVPYWEKTFGIDLFRPQ 84 (120) T ss_pred HCCHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCCCCCC T ss_conf 20577788864324688279998637892289999999999997276987049988886450478999986587778882 Q ss_pred EEEEE--CCEEEEEEECC---CCCHHHHHHHHHHCC Q ss_conf 99997--99898588748---999899999998419 Q gi|254780822|r 77 LILFK--DGKVIDRMMPG---ASSQSDIIEWILSRV 107 (107) Q Consensus 77 ~~~~~--~g~~~~~~~~g---~~~~~~l~~~i~~~l 107 (107) +=++. +...+-....+ ..+.+++.+||+.-| T Consensus 85 IGVVdv~dadSvW~~~~~~~d~~t~~~Le~WiedVL 120 (120) T cd03074 85 IGVVNVTDADSVWMEMDDDEDLPTAEELEDWIEDVL 120 (120) T ss_pred EEEEECCCCCCEEEECCCCCCCCCHHHHHHHHHHHC T ss_conf 437755667655676577444566899999998629 No 252 >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC. The structure of Yffb and the conservation of the catalytic cysteine suggest that it is likely to function as a glutathione (GSH)-dependent thiol reductase. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from GSH via glutaredoxin, through a single catalytic cysteine. Probab=25.28 E-value=47 Score=15.68 Aligned_cols=76 Identities=16% Similarity=0.129 Sum_probs=39.8 Q ss_pred EEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCC--CCCCCCHHHHHHHCCCCCCEEEEEE-CCEEEEEEE----CCCCCH Q ss_conf 998769970222134666654210001233322--6723265777762315688799997-998985887----489998 Q gi|254780822|r 24 VDFWASWCRPCVKLSPIIDDIADELADKVKITK--LDIEESSEISTRYQISSIPTLILFK-DGKVIDRMM----PGASSQ 96 (107) Q Consensus 24 v~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~--vd~d~~~~l~~~~~v~~~Pt~~~~~-~g~~~~~~~----~g~~~~ 96 (107) ..|+-|.|..|+....-|++-.-+|.- +.+.+ .+.++-.++.+..|+. . ++. .|+ ..|.. ....+. T Consensus 2 ~iY~~~~CstcrkA~k~L~~~~i~~~~-~d~~~~p~~~~el~~~~~~~G~~---~--l~n~r~~-~yr~L~~~~~~~ls~ 74 (105) T cd03035 2 TLYGIKNCDTVKKARKWLEARGVAYTF-HDYRKDGLDAATLERWLAKVGWE---T--LLNKRGT-TWRKLDDAQKAALDA 74 (105) T ss_pred EEECCCCCHHHHHHHHHHHHCCCCCEE-EEEECCCCCHHHHHHHHHHCCHH---H--HHCCCCH-HHHHHHHHHHHCCCH T ss_conf 897179987899999999987998089-97567898999999999867906---7--6433358-999877876607998 Q ss_pred HHHHHHHHHC Q ss_conf 9999999841 Q gi|254780822|r 97 SDIIEWILSR 106 (107) Q Consensus 97 ~~l~~~i~~~ 106 (107) +++.+.|.++ T Consensus 75 ~e~~~ll~~~ 84 (105) T cd03035 75 AKAIALMLEH 84 (105) T ss_pred HHHHHHHHHC T ss_conf 9999999869 No 253 >KOG0833 consensus Probab=25.18 E-value=31 Score=16.76 Aligned_cols=18 Identities=17% Similarity=0.427 Sum_probs=13.7 Q ss_pred EECCCCHHHHHHHHHHHHH Q ss_conf 8769970222134666654 Q gi|254780822|r 26 FWASWCRPCVKLSPIIDDI 44 (107) Q Consensus 26 f~a~wC~~C~~~~p~~~~l 44 (107) |.+| ||.|+++...+.+. T Consensus 101 f~tP-CG~CRQfl~Ef~~~ 118 (173) T KOG0833 101 FTTP-CGVCRQFLREFGNA 118 (173) T ss_pred CCCC-CHHHHHHHHHHHHC T ss_conf 6797-58899999998414 No 254 >TIGR02743 TraW type-F conjugative transfer system protein TraW; InterPro: IPR014114 This entry represents TraW, an essential component of the F-type conjugative transfer system for plasmid DNA transfer that has been shown to be localized to the periplasm , .. Probab=24.78 E-value=30 Score=16.83 Aligned_cols=28 Identities=11% Similarity=0.466 Sum_probs=22.5 Q ss_pred CCCCHHHHHHHCCCCCCEEEEE-ECCEEE Q ss_conf 2326577776231568879999-799898 Q gi|254780822|r 59 IEESSEISTRYQISSIPTLILF-KDGKVI 86 (107) Q Consensus 59 ~d~~~~l~~~~~v~~~Pt~~~~-~~g~~~ 86 (107) -|.+-.|+++|+|..+|+.+.- .+|... T Consensus 184 FDQ~G~L~~~f~I~~VPA~v~~~Q~G~~l 212 (217) T TIGR02743 184 FDQNGKLTRKFGIKHVPARVSRAQEGLRL 212 (217) T ss_pred ECCCCHHHHHCCCCCCCHHEEECCCCCEE T ss_conf 63676344541753232210110388347 No 255 >pfam07511 DUF1525 Protein of unknown function (DUF1525). Probab=24.68 E-value=64 Score=14.94 Aligned_cols=34 Identities=18% Similarity=0.473 Sum_probs=23.2 Q ss_pred HHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHHH Q ss_conf 776231568879999799898588748999899999998 Q gi|254780822|r 66 STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104 (107) Q Consensus 66 ~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~ 104 (107) +..+||..+|.+++ |++-+ .| |..+...-.+-+. T Consensus 76 AwslGi~kiPAVVf--D~r~V--VY-G~~DV~~A~~~~~ 109 (114) T pfam07511 76 AWQLGITKIPAVVF--DGRYV--VY-GTTDVARALALYA 109 (114) T ss_pred HHHCCCCCCCEEEE--CCCEE--EE-CCCCHHHHHHHHH T ss_conf 99717665786997--48528--96-6864999999999 No 256 >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv Probab=24.51 E-value=51 Score=15.49 Aligned_cols=14 Identities=36% Similarity=0.541 Sum_probs=12.3 Q ss_pred CCEEEEEECCEEEE Q ss_conf 88799997998985 Q gi|254780822|r 74 IPTLILFKDGKVID 87 (107) Q Consensus 74 ~Pt~~~~~~g~~~~ 87 (107) .|++-+||||+++. T Consensus 13 ~P~i~W~KdG~~l~ 26 (75) T cd05750 13 SLRFKWFKDGKELN 26 (75) T ss_pred CCEEEEEECCEECC T ss_conf 97599998997988 No 257 >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun Probab=24.42 E-value=42 Score=15.98 Aligned_cols=22 Identities=23% Similarity=0.599 Sum_probs=16.0 Q ss_pred HHHHCCCCC--CEEEEEECCEEEE Q ss_conf 776231568--8799997998985 Q gi|254780822|r 66 STRYQISSI--PTLILFKDGKVID 87 (107) Q Consensus 66 ~~~~~v~~~--Pt~~~~~~g~~~~ 87 (107) |-.|-|+|. |++-+|++|+++. T Consensus 2 ci~f~V~g~P~P~i~W~~nG~~l~ 25 (81) T cd04971 2 CIPFTVRGNPKPTLTWYHNGAVLN 25 (81) T ss_pred CEEEEECCCCCCEEEEEECCEECC T ss_conf 584743557998289998999973 No 258 >PRK13738 conjugal transfer pilus assembly protein TraW; Provisional Probab=24.19 E-value=39 Score=16.17 Aligned_cols=29 Identities=14% Similarity=0.416 Sum_probs=22.8 Q ss_pred CCCCHHHHHHHCCCCCCEEEEE-ECCEEEE Q ss_conf 2326577776231568879999-7998985 Q gi|254780822|r 59 IEESSEISTRYQISSIPTLILF-KDGKVID 87 (107) Q Consensus 59 ~d~~~~l~~~~~v~~~Pt~~~~-~~g~~~~ 87 (107) -|.+..|.++|+|+.+|+++-- .+|+... T Consensus 170 FDQ~G~Lt~rF~I~~VPAvVs~~q~g~~l~ 199 (210) T PRK13738 170 FDQNGVLCQRLGIDQVPARVSAVPGGRFLK 199 (210) T ss_pred EECCCHHHHHCCCEECCEEEEECCCCCEEE T ss_conf 826753766249755266888717896799 No 259 >pfam00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP). Probab=23.57 E-value=67 Score=14.81 Aligned_cols=57 Identities=25% Similarity=0.402 Sum_probs=33.0 Q ss_pred HHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCC-CEEEEEECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 66654210001233322672326577776231568-8799997998985887489998999999984 Q gi|254780822|r 40 IIDDIADELADKVKITKLDIEESSEISTRYQISSI-PTLILFKDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 40 ~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~-Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) .+++++.+.. .+.-|-+..|.+ .|++..- -|+++|..|+.+ ..|..+.+++.+.+.+ T Consensus 20 dL~~la~~~~----~~~Y~Pe~fpgl--i~R~~~pk~t~liF~SGkiv---itGaks~~~~~~a~~~ 77 (86) T pfam00352 20 DLEKIALKLE----NAEYEPEQFPGL--VYRLREPKATALIFSSGKVV---ITGAKSEEDAKKAVRK 77 (86) T ss_pred CHHHHHHHCC----CCEECCCCCCCE--EEECCCCCEEEEEECCCEEE---EECCCCHHHHHHHHHH T ss_conf 7999985489----978995447756--99747885499998388599---9842999999999999 No 260 >PRK00394 transcription factor; Reviewed Probab=23.02 E-value=69 Score=14.75 Aligned_cols=27 Identities=30% Similarity=0.553 Sum_probs=20.8 Q ss_pred EEEEEECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 799997998985887489998999999984 Q gi|254780822|r 76 TLILFKDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 76 t~~~~~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) ++++|..|+.+ .+|.++.+++.+.+++ T Consensus 143 ~~liF~sGkiv---itGaks~~~~~~a~~~ 169 (178) T PRK00394 143 VVLLFGSGKLV---ITGAKSEEDAEKAVEK 169 (178) T ss_pred EEEEECCCEEE---EECCCCHHHHHHHHHH T ss_conf 99997798499---9866999999999999 No 261 >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2. VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells. Probab=21.93 E-value=57 Score=15.22 Aligned_cols=20 Identities=20% Similarity=0.371 Sum_probs=14.6 Q ss_pred CCCCC--CEEEEEECCEEEEEE Q ss_conf 31568--879999799898588 Q gi|254780822|r 70 QISSI--PTLILFKDGKVIDRM 89 (107) Q Consensus 70 ~v~~~--Pt~~~~~~g~~~~~~ 89 (107) ++.++ |.+.+|+||+++... T Consensus 6 Kv~ayP~Pei~W~KnG~pi~~~ 27 (70) T cd05864 6 KYYGYPPPEVKWYKNGQLIVLN 27 (70) T ss_pred EEEECCCCCEEEEECCEECCCC T ss_conf 7617799923997899997665 No 262 >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Probab=21.88 E-value=72 Score=14.61 Aligned_cols=59 Identities=14% Similarity=0.194 Sum_probs=36.9 Q ss_pred EEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-CHHHHHHHCCCCCCEEEEEECCEEE Q ss_conf 9876997022213466665421000123332267232-6577776231568879999799898 Q gi|254780822|r 25 DFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE-SSEISTRYQISSIPTLILFKDGKVI 86 (107) Q Consensus 25 ~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~-~~~l~~~~~v~~~Pt~~~~~~g~~~ 86 (107) .|+++-|+++++..=.+.+..-.. .+.+..++..+ .+++.+.-....+|+++. .+|..+ T Consensus 3 Ly~~~~SP~~rkvri~l~ekgl~~--~~e~v~~~~~~~~~~~~~~NP~gkVP~L~~-ddG~~l 62 (73) T cd03049 3 LLYSPTSPYVRKVRVAAHETGLGD--DVELVLVNPWSDDESLLAVNPLGKIPALVL-DDGEAL 62 (73) T ss_pred EECCCCCCHHHHHHHHHHHHCCCC--CEEEEECCCCCCCHHHHHHCCCCCCCEEEE-CCCCEE T ss_conf 826999918999999999819998--668732477778789998698988996996-899888 No 263 >pfam07315 DUF1462 Protein of unknown function (DUF1462). This family consists of several hypothetical bacterial proteins of around 100 residues in length. The function of this family is unknown. Probab=21.81 E-value=73 Score=14.61 Aligned_cols=71 Identities=23% Similarity=0.424 Sum_probs=42.5 Q ss_pred CCCHHHHHHHH---HHH----HHHHHCCCC-CCCCCCCCCCC------HHHHHHHC--CCCCCEEEEEECCEEEEEEECC Q ss_conf 99702221346---666----542100012-33322672326------57777623--1568879999799898588748 Q gi|254780822|r 29 SWCRPCVKLSP---IID----DIADELADK-VKITKLDIEES------SEISTRYQ--ISSIPTLILFKDGKVIDRMMPG 92 (107) Q Consensus 29 ~wC~~C~~~~p---~~~----~l~~~~~~~-i~~~~vd~d~~------~~l~~~~~--v~~~Pt~~~~~~g~~~~~~~~g 92 (107) --|+.|..+-. .++ .+.++|++. +.|..||+.+- ++++++.. -.-+|-+++ +|+.+.. | T Consensus 7 ~~CASCV~~PsSkeT~EWLqaal~RKyp~~~f~~~YiDi~~p~~~d~~~~~ae~i~ede~FYPlV~i--~~evVaE---G 81 (93) T pfam07315 7 VICASCVNAPSSKDTYEWLQAALKRKYPDQPFEFTYIDIENPPENDHDQEFAERILEDEYFYPLVLI--NDEVVAE---G 81 (93) T ss_pred CCCHHHCCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHCCCEEEEEEE--CCEEEEC---C T ss_conf 5134413898714189999999817589985269998456896427999999998622444127998--9989625---8 Q ss_pred CCCHHHHHHHHH Q ss_conf 999899999998 Q gi|254780822|r 93 ASSQSDIIEWIL 104 (107) Q Consensus 93 ~~~~~~l~~~i~ 104 (107) ......+.++|+ T Consensus 82 np~LK~I~~~ie 93 (93) T pfam07315 82 NPQLKDIYEEME 93 (93) T ss_pred CCCHHHHHHHHC T ss_conf 732888988619 No 264 >cd01283 cytidine_deaminase Cytidine deaminase zinc-binding domain. These enzymes are Zn dependent. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on the substrate. Cytidine deaminases catalyze the deamination of cytidine to uridine and are important in the pyrimadine salvage pathway in many cell types, from bacteria to humans. This family also includes the apoBec proteins, which are a mammal specific expansion of RNA editing enzymes, and the closely related phorbolins, and the AID (activation-induced) enzymes. Probab=21.35 E-value=39 Score=16.19 Aligned_cols=16 Identities=19% Similarity=0.648 Sum_probs=11.2 Q ss_pred ECCCCHHHHHHHHHHHH Q ss_conf 76997022213466665 Q gi|254780822|r 27 WASWCRPCVKLSPIIDD 43 (107) Q Consensus 27 ~a~wC~~C~~~~p~~~~ 43 (107) ++| ||.|++....|.. T Consensus 77 ~sP-CG~CrQ~l~Ef~~ 92 (112) T cd01283 77 WSP-CGACRQVLAEFLP 92 (112) T ss_pred CCC-CHHHHHHHHHHCC T ss_conf 687-3468999998678 No 265 >TIGR02652 TIGR02652 conserved hypothetical protein TIGR02652; InterPro: IPR013472 These conserved hypothetical proteins have so far been found only in the Cyanobacteria. They are about 170 amino acids long and contain a CxxCx(14)CxxH motif near the N-terminus.. Probab=21.26 E-value=30 Score=16.79 Aligned_cols=14 Identities=14% Similarity=0.487 Sum_probs=11.5 Q ss_pred CCCHHHHHHHHHHH Q ss_conf 99702221346666 Q gi|254780822|r 29 SWCRPCVKLSPIID 42 (107) Q Consensus 29 ~wC~~C~~~~p~~~ 42 (107) =.||||++..|.|. T Consensus 11 I~CPHCRQ~i~ALT 24 (172) T TIGR02652 11 IRCPHCRQIIAALT 24 (172) T ss_pred CCCCCCCCCHHHHH T ss_conf 55885434002334 No 266 >cd04518 TBP_archaea archaeal TATA box binding protein (TBP): TBPs are transcription factors present in archaea and eukaryotes, that recognize promoters and initiate transcription. TBP has been shown to be an essential component of three different transcription initiation complexes: SL1, TFIID and TFIIIB, directing transcription by RNA polymerases I, II and III, respectively. TBP binds directly to the TATA box promoter element, where it nucleates polymerase assembly, thus defining the transcription start site. TBP's binding in the minor groove induces a dramatic DNA bending while its own structure barely changes. The conserved core domain of TBP, which binds to the TATA box, has a bipartite structure, with intramolecular symmetry generating a saddle-shaped structure that sits astride the DNA. Probab=21.16 E-value=75 Score=14.53 Aligned_cols=27 Identities=33% Similarity=0.589 Sum_probs=21.0 Q ss_pred EEEEEECCEEEEEEECCCCCHHHHHHHHHH Q ss_conf 799997998985887489998999999984 Q gi|254780822|r 76 TLILFKDGKVIDRMMPGASSQSDIIEWILS 105 (107) Q Consensus 76 t~~~~~~g~~~~~~~~g~~~~~~l~~~i~~ 105 (107) ++++|..|+.+ ..|.++.+++.+.++. T Consensus 140 ~~liF~SGKiv---itGaks~~~~~~a~~~ 166 (174) T cd04518 140 VLLLFSSGKMV---ITGAKSEEDAKRAVEK 166 (174) T ss_pred EEEEECCCEEE---EECCCCHHHHHHHHHH T ss_conf 99998798499---9867999999999999 No 267 >KOG4014 consensus Probab=21.15 E-value=39 Score=16.15 Aligned_cols=43 Identities=19% Similarity=0.343 Sum_probs=34.3 Q ss_pred CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC--HHHHHHHCCCC Q ss_conf 70222134666654210001233322672326--57777623156 Q gi|254780822|r 31 CRPCVKLSPIIDDIADELADKVKITKLDIEES--SEISTRYQISS 73 (107) Q Consensus 31 C~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~--~~l~~~~~v~~ 73 (107) =..|..+...++-+...+...+.+.+-|||+| ++-|-+||... T Consensus 34 Pe~C~lLgdYlEgi~knF~~A~kv~K~nCden~y~kSCyKyG~y~ 78 (248) T KOG4014 34 PESCQLLGDYLEGIQKNFQAAVKVFKKNCDENSYPKSCYKYGMYM 78 (248) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHH T ss_conf 269999999999999879999999984566457747899853253 No 268 >COG3011 Predicted thiol-disulfide oxidoreductase [General function prediction only] Probab=20.38 E-value=78 Score=14.43 Aligned_cols=66 Identities=12% Similarity=0.295 Sum_probs=46.9 Q ss_pred CCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCC--CEEEEEECCEEE Q ss_conf 99499998769970222134666654210001233322672326577776231568--879999799898 Q gi|254780822|r 19 SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI--PTLILFKDGKVI 86 (107) Q Consensus 19 ~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~--Pt~~~~~~g~~~ 86 (107) +++-.|.+|..-|+.|-....-+.+.- .++.+.|+.+..+....+....++.-- =++++.++|+.. T Consensus 6 ~~p~~vvlyDG~C~lC~~~vrfLi~~D--~~~~i~f~~~q~e~g~~~l~~~~l~~~~~~s~~~~~~g~~~ 73 (137) T COG3011 6 KKPDLVVLYDGVCPLCDGWVRFLIRRD--QGGRIRFAALQSEPGQALLEAAGLDPEDVDSVLLVEAGQLL 73 (137) T ss_pred CCCCEEEEECCCCHHHHHHHHHHHHHC--CCCCEEEEECCCCHHHHHHHHCCCCHHHHHEEEEECCCCEE T ss_conf 998789998896624799999999846--58757987634754266786369986452225675179367 Done!