HHsearch alignment for GI: 254780822 and conserved domain: pfam00085

>pfam00085 Thioredoxin Thioredoxin. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. Some members with only the active site are not separated from the noise.
Probab=99.95  E-value=1.5e-27  Score=179.79  Aligned_cols=103  Identities=34%  Similarity=0.751  Sum_probs=98.5

Q ss_pred             EEEECHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEC
Q ss_conf             17757677999998489949999876997022213466665421000123332267232657777623156887999979
Q gi|254780822|r    3 ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKD   82 (107)
Q Consensus         3 ~i~i~~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~~p~~~~l~~~~~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~   82 (107)
T Consensus         2 v~~l~~~~F~~~v~~~~k~vlv~F~a~wC~~C~~~~~~~~~~a~~~~~~~~~~~vd~d~~~~~~~~~~i~~~Pti~~~~~   81 (104)
T pfam00085         2 VKVLTDENFDEEVAKSDKPVLVDFYAPWCGPCKALAPEYEKLAQEYKDDVKFAKVDADENPDLASEYGVRGFPTIKFFKN   81 (104)
T ss_pred             EEECCHHHHHHHHHHCCCCEEEEEECCCCHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEEC
T ss_conf             79856676899986089949999989998504510704444222221101220014654853532479625090899989


Q ss_pred             CEEEEEEECCCCCHHHHHHHHHHC
Q ss_conf             989858874899989999999841
Q gi|254780822|r   83 GKVIDRMMPGASSQSDIIEWILSR  106 (107)
Q Consensus        83 g~~~~~~~~g~~~~~~l~~~i~~~  106 (107)
T Consensus        82 G~~v~~-~~G~~~~e~l~~~i~~~  104 (104)
T pfam00085        82 GKKVSD-YVGARTKDDLVAFIKKH  104 (104)
T ss_pred             CEEEEE-EECCCCHHHHHHHHHHC
T ss_conf             959888-87899999999999739