HHsearch alignment for GI: 254780822 and conserved domain: pfam07689

>pfam07689 KaiB KaiB domain. The cyanobacterial clock proteins KaiA and KaiB are proposed as regulators of the circadian rhythm in cyanobacteria. Mutations in both proteins have been reported to alter or abolish circadian rhythmicity. KaiB adopts an alpha-beta meander motif and is found to be a dimer.
Probab=91.60  E-value=0.21  Score=29.21  Aligned_cols=76  Identities=17%  Similarity=0.252  Sum_probs=56.1

Q ss_pred             EECCCCHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCEEEEEEECCCCCHHHHHHHH
Q ss_conf             87699702221346666542100-0123332267232657777623156887999979989858874899989999999
Q gi|254780822|r   26 FWASWCRPCVKLSPIIDDIADEL-ADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI  103 (107)
Q Consensus        26 f~a~wC~~C~~~~p~~~~l~~~~-~~~i~~~~vd~d~~~~l~~~~~v~~~Pt~~~~~~g~~~~~~~~g~~~~~~l~~~i  103 (107)
T Consensus         3 yVag~~~~s~~a~~nl~~l~~~~l~~~y~LeVIDv~~qPelaE~~~IvATPtLiK~~P-~P~rr-iiGdls~~~~vl~~   79 (82)
T pfam07689         3 YVAGRPLSSEDALKNLKYLEEEDLGFPYELQVIDVLEQPELAEEDRLVATPTLIKLLP-EPRQR-LAGDLSNTQLVLWG   79 (82)
T ss_pred             EECCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHCCEEEECHHHHCCC-CCCEE-EECCCCHHHHHHHC
T ss_conf             5789897899999999999970279958999986121975784588677036664079-97168-86477577776302