BLAST/PSIBLAST alignment of GI: 254780822 and GI: 17988305 at iteration 1
>gi|17988305|ref|NP_540939.1| thioredoxin C-1 [Brucella melitensis bv. 1 str. 16M] Length = 107
>gi|23502953|ref|NP_699080.1| thioredoxin [Brucella suis 1330] Length = 107
>gi|62290947|ref|YP_222740.1| thioredoxin [Brucella abortus bv. 1 str. 9-941] Length = 107
>gi|82700858|ref|YP_415432.1| thioredoxin domain-containing protein [Brucella melitensis biovar Abortus 2308] Length = 107
>gi|148560068|ref|YP_001259905.1| thioredoxin [Brucella ovis ATCC 25840] Length = 107
>gi|161620016|ref|YP_001593903.1| thioredoxin [Brucella canis ATCC 23365] Length = 107
>gi|163844121|ref|YP_001628525.1| thioredoxin [Brucella suis ATCC 23445] Length = 107
>gi|189025158|ref|YP_001935926.1| Thioredoxin [Brucella abortus S19] Length = 107
>gi|225626479|ref|ZP_03784518.1| thioredoxin [Brucella ceti str. Cudo] Length = 107
>gi|225853532|ref|YP_002733765.1| thioredoxin [Brucella melitensis ATCC 23457] Length = 107
>gi|237816451|ref|ZP_04595444.1| thioredoxin [Brucella abortus str. 2308 A] Length = 107
>gi|254690237|ref|ZP_05153491.1| thioredoxin [Brucella abortus bv. 6 str. 870] Length = 107
>gi|254694725|ref|ZP_05156553.1| thioredoxin [Brucella abortus bv. 3 str. Tulya] Length = 107
>gi|254696354|ref|ZP_05158182.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59] Length = 107
>gi|254700734|ref|ZP_05162562.1| thioredoxin [Brucella suis bv. 5 str. 513] Length = 107
>gi|254707378|ref|ZP_05169206.1| thioredoxin [Brucella pinnipedialis M163/99/10] Length = 107
>gi|254709080|ref|ZP_05170891.1| thioredoxin [Brucella pinnipedialis B2/94] Length = 107
>gi|254713493|ref|ZP_05175304.1| thioredoxin [Brucella ceti M644/93/1] Length = 107
>gi|254716151|ref|ZP_05177962.1| thioredoxin [Brucella ceti M13/05/1] Length = 107
>gi|254718136|ref|ZP_05179947.1| thioredoxin [Brucella sp. 83/13] Length = 107
>gi|254731268|ref|ZP_05189846.1| thioredoxin [Brucella abortus bv. 4 str. 292] Length = 107
>gi|256030605|ref|ZP_05444219.1| thioredoxin [Brucella pinnipedialis M292/94/1] Length = 107
>gi|256045707|ref|ZP_05448585.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1] Length = 107
>gi|256060067|ref|ZP_05450249.1| thioredoxin [Brucella neotomae 5K33] Length = 107
>gi|256112428|ref|ZP_05453349.1| thioredoxin [Brucella melitensis bv. 3 str. Ether] Length = 107
>gi|256158604|ref|ZP_05456491.1| thioredoxin [Brucella ceti M490/95/1] Length = 107
>gi|256254012|ref|ZP_05459548.1| thioredoxin [Brucella ceti B1/94] Length = 107
>gi|256258490|ref|ZP_05464026.1| thioredoxin [Brucella abortus bv. 9 str. C68] Length = 107
>gi|256262984|ref|ZP_05465516.1| thioredoxin [Brucella melitensis bv. 2 str. 63/9] Length = 107
>gi|256370503|ref|YP_003108014.1| thioredoxin [Brucella microti CCM 4915] Length = 107
>gi|260169511|ref|ZP_05756322.1| thioredoxin [Brucella sp. F5/99] Length = 107
>gi|260546209|ref|ZP_05821949.1| thioredoxin [Brucella abortus NCTC 8038] Length = 107
>gi|260563009|ref|ZP_05833495.1| thioredoxin [Brucella melitensis bv. 1 str. 16M] Length = 107
>gi|260567424|ref|ZP_05837894.1| thioredoxin [Brucella suis bv. 4 str. 40] Length = 107
>gi|260755778|ref|ZP_05868126.1| thioredoxin [Brucella abortus bv. 6 str. 870] Length = 107
>gi|260759001|ref|ZP_05871349.1| thioredoxin [Brucella abortus bv. 4 str. 292] Length = 107
>gi|260760726|ref|ZP_05873069.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59] Length = 107
>gi|260884802|ref|ZP_05896416.1| thioredoxin [Brucella abortus bv. 9 str. C68] Length = 107
>gi|261215054|ref|ZP_05929335.1| thioredoxin [Brucella abortus bv. 3 str. Tulya] Length = 107
>gi|261217924|ref|ZP_05932205.1| thioredoxin [Brucella ceti M13/05/1] Length = 107
>gi|261221153|ref|ZP_05935434.1| thioredoxin [Brucella ceti B1/94] Length = 107
>gi|261314861|ref|ZP_05954058.1| thioredoxin [Brucella pinnipedialis M163/99/10] Length = 107
>gi|261316581|ref|ZP_05955778.1| thioredoxin [Brucella pinnipedialis B2/94] Length = 107
>gi|261321226|ref|ZP_05960423.1| thioredoxin [Brucella ceti M644/93/1] Length = 107
>gi|261324044|ref|ZP_05963241.1| thioredoxin [Brucella neotomae 5K33] Length = 107
>gi|261751246|ref|ZP_05994955.1| thioredoxin [Brucella suis bv. 5 str. 513] Length = 107
>gi|261759039|ref|ZP_06002748.1| thioredoxin [Brucella sp. F5/99] Length = 107
>gi|265983089|ref|ZP_06095824.1| thioredoxin [Brucella sp. 83/13] Length = 107
>gi|265987653|ref|ZP_06100210.1| thioredoxin [Brucella pinnipedialis M292/94/1] Length = 107
>gi|265992128|ref|ZP_06104685.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1] Length = 107
>gi|265993866|ref|ZP_06106423.1| thioredoxin [Brucella melitensis bv. 3 str. Ether] Length = 107
>gi|265997113|ref|ZP_06109670.1| thioredoxin [Brucella ceti M490/95/1] Length = 107
>gi|294851331|ref|ZP_06792004.1| thioredoxin [Brucella sp. NVSL 07-0026] Length = 107
>gi|297247331|ref|ZP_06931049.1| thioredoxin [Brucella abortus bv. 5 str. B3196] Length = 107
>gi|306837650|ref|ZP_07470519.1| thioredoxin [Brucella sp. NF 2653] Length = 107
>gi|306842784|ref|ZP_07475425.1| thioredoxin [Brucella sp. BO2] Length = 107
>gi|306843522|ref|ZP_07476123.1| thioredoxin [Brucella sp. BO1] Length = 107
>gi|17984078|gb|AAL53203.1| thioredoxin c-1 [Brucella melitensis bv. 1 str. 16M] Length = 107
>gi|23348988|gb|AAN30995.1| thioredoxin [Brucella suis 1330] Length = 107
>gi|62197079|gb|AAX75379.1| Trx-1, thioredoxin [Brucella abortus bv. 1 str. 9-941] Length = 107
>gi|82616959|emb|CAJ12063.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2 [Brucella melitensis biovar Abortus 2308] Length = 107
>gi|148371325|gb|ABQ61304.1| thioredoxin [Brucella ovis ATCC 25840] Length = 107
>gi|161336827|gb|ABX63132.1| thioredoxin [Brucella canis ATCC 23365] Length = 107
>gi|163674844|gb|ABY38955.1| thioredoxin [Brucella suis ATCC 23445] Length = 107
>gi|189020730|gb|ACD73452.1| Thioredoxin [Brucella abortus S19] Length = 107
>gi|225618136|gb|EEH15179.1| thioredoxin [Brucella ceti str. Cudo] Length = 107
>gi|225641897|gb|ACO01811.1| thioredoxin [Brucella melitensis ATCC 23457] Length = 107
>gi|237788518|gb|EEP62733.1| thioredoxin [Brucella abortus str. 2308 A] Length = 107
>gi|256000666|gb|ACU49065.1| thioredoxin [Brucella microti CCM 4915] Length = 107
>gi|260096316|gb|EEW80192.1| thioredoxin [Brucella abortus NCTC 8038] Length = 107
>gi|260153025|gb|EEW88117.1| thioredoxin [Brucella melitensis bv. 1 str. 16M] Length = 107
>gi|260156942|gb|EEW92022.1| thioredoxin [Brucella suis bv. 4 str. 40] Length = 107
>gi|260669319|gb|EEX56259.1| thioredoxin [Brucella abortus bv. 4 str. 292] Length = 107
>gi|260671158|gb|EEX57979.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59] Length = 107
>gi|260675886|gb|EEX62707.1| thioredoxin [Brucella abortus bv. 6 str. 870] Length = 107
>gi|260874330|gb|EEX81399.1| thioredoxin [Brucella abortus bv. 9 str. C68] Length = 107
>gi|260916661|gb|EEX83522.1| thioredoxin [Brucella abortus bv. 3 str. Tulya] Length = 107
>gi|260919737|gb|EEX86390.1| thioredoxin [Brucella ceti B1/94] Length = 107
>gi|260923013|gb|EEX89581.1| thioredoxin [Brucella ceti M13/05/1] Length = 107
>gi|261293916|gb|EEX97412.1| thioredoxin [Brucella ceti M644/93/1] Length = 107
>gi|261295804|gb|EEX99300.1| thioredoxin [Brucella pinnipedialis B2/94] Length = 107
>gi|261300024|gb|EEY03521.1| thioredoxin [Brucella neotomae 5K33] Length = 107
>gi|261303887|gb|EEY07384.1| thioredoxin [Brucella pinnipedialis M163/99/10] Length = 107
>gi|261739023|gb|EEY27019.1| thioredoxin [Brucella sp. F5/99] Length = 107
>gi|261740999|gb|EEY28925.1| thioredoxin [Brucella suis bv. 5 str. 513] Length = 107
>gi|262551581|gb|EEZ07571.1| thioredoxin [Brucella ceti M490/95/1] Length = 107
>gi|262764847|gb|EEZ10768.1| thioredoxin [Brucella melitensis bv. 3 str. Ether] Length = 107
>gi|263003194|gb|EEZ15487.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1] Length = 107
>gi|263092857|gb|EEZ17032.1| thioredoxin [Brucella melitensis bv. 2 str. 63/9] Length = 107
>gi|264659850|gb|EEZ30111.1| thioredoxin [Brucella pinnipedialis M292/94/1] Length = 107
>gi|264661681|gb|EEZ31942.1| thioredoxin [Brucella sp. 83/13] Length = 107
>gi|294819920|gb|EFG36919.1| thioredoxin [Brucella sp. NVSL 07-0026] Length = 107
>gi|297174500|gb|EFH33847.1| thioredoxin [Brucella abortus bv. 5 str. B3196] Length = 107
>gi|306276213|gb|EFM57913.1| thioredoxin [Brucella sp. BO1] Length = 107
>gi|306287057|gb|EFM58565.1| thioredoxin [Brucella sp. BO2] Length = 107
>gi|306407208|gb|EFM63418.1| thioredoxin [Brucella sp. NF 2653] Length = 107
>gi|326410101|gb|ADZ67166.1| Thioredoxin [Brucella melitensis M28] Length = 107
>gi|326539818|gb|ADZ88033.1| thioredoxin [Brucella melitensis M5-90] Length = 107
 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 1   MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI
Sbjct: 61  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWI 102