BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780822|ref|YP_003065235.1| thioredoxin [Candidatus
Liberibacter asiaticus str. psy62]
         (107 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780822|ref|YP_003065235.1| thioredoxin [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040499|gb|ACT57295.1| thioredoxin [Candidatus Liberibacter asiaticus str. psy62]
          Length = 107

 Score =  211 bits (537), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE
Sbjct: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV
Sbjct: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107


>gi|315122045|ref|YP_004062534.1| thioredoxin [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495447|gb|ADR52046.1| thioredoxin [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 107

 Score =  165 bits (417), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 93/107 (86%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M AL  D  +FD EVL+CSNPVVVDFWASWCRPCV LSPIIDD+ADEL+DKVKI K+DIE
Sbjct: 1   MGALATDADNFDLEVLKCSNPVVVDFWASWCRPCVALSPIIDDLADELSDKVKIVKVDIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++S ISTRY+I SIPTLILFKDG++ID+MMPG  S++DI +WILS V
Sbjct: 61  KNSSISTRYKIVSIPTLILFKDGQMIDKMMPGGLSKNDISKWILSLV 107


>gi|319898219|ref|YP_004158312.1| thioredoxin [Bartonella clarridgeiae 73]
 gi|319402183|emb|CBI75714.1| thioredoxin [Bartonella clarridgeiae 73]
          Length = 107

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 81/103 (78%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D+ +F+SEVL  S PVVVDFWA WC PC  ++PI+D+IA E+ +++K+ K++I+
Sbjct: 1   MTCIKIDSSNFESEVLTSSLPVVVDFWAEWCGPCKSIAPILDEIATEMQNQIKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++TRY I SIPTL++FK+G+V    + GASS+  ++EW+
Sbjct: 61  ENPELATRYGIRSIPTLLMFKNGEVSSNKV-GASSKGHLVEWV 102


>gi|49474855|ref|YP_032896.1| thioredoxin [Bartonella henselae str. Houston-1]
 gi|49237660|emb|CAF26842.1| Thioredoxin [Bartonella henselae str. Houston-1]
          Length = 107

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 79/103 (76%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS +KVD  +F+SEVL  S PVVVDFWA WC PC  ++PI+D+I+ E+ ++VKI K++I+
Sbjct: 1   MSCIKVDKSNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQNQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++T+Y + SIPTL++FKDG +   M+ GA+S+  + EWI
Sbjct: 61  ENPELATQYGVRSIPTLLMFKDGNIASNMV-GAASKGRVSEWI 102


>gi|163867332|ref|YP_001608526.1| thioredoxin [Bartonella tribocorum CIP 105476]
 gi|161016973|emb|CAK00531.1| thioredoxin [Bartonella tribocorum CIP 105476]
          Length = 107

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 79/103 (76%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F+SEVL  S PVVVDFWA WC PC  ++PI+D+I+ E+ ++VKI K++I+
Sbjct: 1   MTCVKVDKDNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISTEMQNQVKIVKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++T+Y + SIPTL++FK+G V   M+ GA+S+  + EWI
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGNVSSNMV-GATSKGRLSEWI 102


>gi|158422339|ref|YP_001523631.1| thioredoxin [Azorhizobium caulinodans ORS 571]
 gi|158329228|dbj|BAF86713.1| thioredoxin [Azorhizobium caulinodans ORS 571]
          Length = 106

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/105 (49%), Positives = 79/105 (75%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV  +SFD++VL+ S PVVVDFWA WC PC  ++P++D+++ EL DKVKI KL+++
Sbjct: 1   MAVEKVSDQSFDADVLQSSTPVVVDFWAEWCGPCRMVAPVLDELSGELGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+   +++Y I SIPTL+LFKDGK+  R + GA++++ +  WI S
Sbjct: 61  ENPVTASKYGIMSIPTLLLFKDGKIASRQV-GAAAKAKLASWIGS 104


>gi|240849708|ref|YP_002971096.1| thioredoxin [Bartonella grahamii as4aup]
 gi|240266831|gb|ACS50419.1| thioredoxin [Bartonella grahamii as4aup]
          Length = 107

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 79/103 (76%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F+SEVL  S PVVVDFWA WC PC  ++PI+D+I+ E+ ++VKI K++I+
Sbjct: 1   MTCIKVDKDNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQNQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++T+Y + SIPTL++FK+G +   M+ GA+S+  + EWI
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGNISSNMV-GATSKGRLSEWI 102


>gi|319404938|emb|CBI78540.1| thioredoxin [Bartonella sp. AR 15-3]
          Length = 107

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 81/107 (75%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D+ +F+SE+L    P+VVDFWA WC PC  ++PI+D+IA E+  ++K+ K++I+
Sbjct: 1   MTCIKIDSSNFESEILTSPLPIVVDFWAEWCGPCKSIAPILDEIATEMQSQIKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++T+Y I SIPTL++FK+GKV    + GA+S+  ++EWI + +
Sbjct: 61  ENPELATQYGIRSIPTLLMFKNGKVSSNKV-GAASKGHLVEWIKNNL 106


>gi|17988305|ref|NP_540939.1| thioredoxin C-1 [Brucella melitensis bv. 1 str. 16M]
 gi|23502953|ref|NP_699080.1| thioredoxin [Brucella suis 1330]
 gi|62290947|ref|YP_222740.1| thioredoxin [Brucella abortus bv. 1 str. 9-941]
 gi|82700858|ref|YP_415432.1| thioredoxin domain-containing protein [Brucella melitensis biovar
           Abortus 2308]
 gi|148560068|ref|YP_001259905.1| thioredoxin [Brucella ovis ATCC 25840]
 gi|161620016|ref|YP_001593903.1| thioredoxin [Brucella canis ATCC 23365]
 gi|163844121|ref|YP_001628525.1| thioredoxin [Brucella suis ATCC 23445]
 gi|189025158|ref|YP_001935926.1| Thioredoxin [Brucella abortus S19]
 gi|225626479|ref|ZP_03784518.1| thioredoxin [Brucella ceti str. Cudo]
 gi|225853532|ref|YP_002733765.1| thioredoxin [Brucella melitensis ATCC 23457]
 gi|237816451|ref|ZP_04595444.1| thioredoxin [Brucella abortus str. 2308 A]
 gi|254690237|ref|ZP_05153491.1| thioredoxin [Brucella abortus bv. 6 str. 870]
 gi|254694725|ref|ZP_05156553.1| thioredoxin [Brucella abortus bv. 3 str. Tulya]
 gi|254696354|ref|ZP_05158182.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700734|ref|ZP_05162562.1| thioredoxin [Brucella suis bv. 5 str. 513]
 gi|254707378|ref|ZP_05169206.1| thioredoxin [Brucella pinnipedialis M163/99/10]
 gi|254709080|ref|ZP_05170891.1| thioredoxin [Brucella pinnipedialis B2/94]
 gi|254713493|ref|ZP_05175304.1| thioredoxin [Brucella ceti M644/93/1]
 gi|254716151|ref|ZP_05177962.1| thioredoxin [Brucella ceti M13/05/1]
 gi|254718136|ref|ZP_05179947.1| thioredoxin [Brucella sp. 83/13]
 gi|254731268|ref|ZP_05189846.1| thioredoxin [Brucella abortus bv. 4 str. 292]
 gi|256030605|ref|ZP_05444219.1| thioredoxin [Brucella pinnipedialis M292/94/1]
 gi|256045707|ref|ZP_05448585.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060067|ref|ZP_05450249.1| thioredoxin [Brucella neotomae 5K33]
 gi|256112428|ref|ZP_05453349.1| thioredoxin [Brucella melitensis bv. 3 str. Ether]
 gi|256158604|ref|ZP_05456491.1| thioredoxin [Brucella ceti M490/95/1]
 gi|256254012|ref|ZP_05459548.1| thioredoxin [Brucella ceti B1/94]
 gi|256258490|ref|ZP_05464026.1| thioredoxin [Brucella abortus bv. 9 str. C68]
 gi|256262984|ref|ZP_05465516.1| thioredoxin [Brucella melitensis bv. 2 str. 63/9]
 gi|256370503|ref|YP_003108014.1| thioredoxin [Brucella microti CCM 4915]
 gi|260169511|ref|ZP_05756322.1| thioredoxin [Brucella sp. F5/99]
 gi|260546209|ref|ZP_05821949.1| thioredoxin [Brucella abortus NCTC 8038]
 gi|260563009|ref|ZP_05833495.1| thioredoxin [Brucella melitensis bv. 1 str. 16M]
 gi|260567424|ref|ZP_05837894.1| thioredoxin [Brucella suis bv. 4 str. 40]
 gi|260755778|ref|ZP_05868126.1| thioredoxin [Brucella abortus bv. 6 str. 870]
 gi|260759001|ref|ZP_05871349.1| thioredoxin [Brucella abortus bv. 4 str. 292]
 gi|260760726|ref|ZP_05873069.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884802|ref|ZP_05896416.1| thioredoxin [Brucella abortus bv. 9 str. C68]
 gi|261215054|ref|ZP_05929335.1| thioredoxin [Brucella abortus bv. 3 str. Tulya]
 gi|261217924|ref|ZP_05932205.1| thioredoxin [Brucella ceti M13/05/1]
 gi|261221153|ref|ZP_05935434.1| thioredoxin [Brucella ceti B1/94]
 gi|261314861|ref|ZP_05954058.1| thioredoxin [Brucella pinnipedialis M163/99/10]
 gi|261316581|ref|ZP_05955778.1| thioredoxin [Brucella pinnipedialis B2/94]
 gi|261321226|ref|ZP_05960423.1| thioredoxin [Brucella ceti M644/93/1]
 gi|261324044|ref|ZP_05963241.1| thioredoxin [Brucella neotomae 5K33]
 gi|261751246|ref|ZP_05994955.1| thioredoxin [Brucella suis bv. 5 str. 513]
 gi|261759039|ref|ZP_06002748.1| thioredoxin [Brucella sp. F5/99]
 gi|265983089|ref|ZP_06095824.1| thioredoxin [Brucella sp. 83/13]
 gi|265987653|ref|ZP_06100210.1| thioredoxin [Brucella pinnipedialis M292/94/1]
 gi|265992128|ref|ZP_06104685.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993866|ref|ZP_06106423.1| thioredoxin [Brucella melitensis bv. 3 str. Ether]
 gi|265997113|ref|ZP_06109670.1| thioredoxin [Brucella ceti M490/95/1]
 gi|294851331|ref|ZP_06792004.1| thioredoxin [Brucella sp. NVSL 07-0026]
 gi|297247331|ref|ZP_06931049.1| thioredoxin [Brucella abortus bv. 5 str. B3196]
 gi|306837650|ref|ZP_07470519.1| thioredoxin [Brucella sp. NF 2653]
 gi|306842784|ref|ZP_07475425.1| thioredoxin [Brucella sp. BO2]
 gi|306843522|ref|ZP_07476123.1| thioredoxin [Brucella sp. BO1]
 gi|17984078|gb|AAL53203.1| thioredoxin c-1 [Brucella melitensis bv. 1 str. 16M]
 gi|23348988|gb|AAN30995.1| thioredoxin [Brucella suis 1330]
 gi|62197079|gb|AAX75379.1| Trx-1, thioredoxin [Brucella abortus bv. 1 str. 9-941]
 gi|82616959|emb|CAJ12063.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2 [Brucella
           melitensis biovar Abortus 2308]
 gi|148371325|gb|ABQ61304.1| thioredoxin [Brucella ovis ATCC 25840]
 gi|161336827|gb|ABX63132.1| thioredoxin [Brucella canis ATCC 23365]
 gi|163674844|gb|ABY38955.1| thioredoxin [Brucella suis ATCC 23445]
 gi|189020730|gb|ACD73452.1| Thioredoxin [Brucella abortus S19]
 gi|225618136|gb|EEH15179.1| thioredoxin [Brucella ceti str. Cudo]
 gi|225641897|gb|ACO01811.1| thioredoxin [Brucella melitensis ATCC 23457]
 gi|237788518|gb|EEP62733.1| thioredoxin [Brucella abortus str. 2308 A]
 gi|256000666|gb|ACU49065.1| thioredoxin [Brucella microti CCM 4915]
 gi|260096316|gb|EEW80192.1| thioredoxin [Brucella abortus NCTC 8038]
 gi|260153025|gb|EEW88117.1| thioredoxin [Brucella melitensis bv. 1 str. 16M]
 gi|260156942|gb|EEW92022.1| thioredoxin [Brucella suis bv. 4 str. 40]
 gi|260669319|gb|EEX56259.1| thioredoxin [Brucella abortus bv. 4 str. 292]
 gi|260671158|gb|EEX57979.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675886|gb|EEX62707.1| thioredoxin [Brucella abortus bv. 6 str. 870]
 gi|260874330|gb|EEX81399.1| thioredoxin [Brucella abortus bv. 9 str. C68]
 gi|260916661|gb|EEX83522.1| thioredoxin [Brucella abortus bv. 3 str. Tulya]
 gi|260919737|gb|EEX86390.1| thioredoxin [Brucella ceti B1/94]
 gi|260923013|gb|EEX89581.1| thioredoxin [Brucella ceti M13/05/1]
 gi|261293916|gb|EEX97412.1| thioredoxin [Brucella ceti M644/93/1]
 gi|261295804|gb|EEX99300.1| thioredoxin [Brucella pinnipedialis B2/94]
 gi|261300024|gb|EEY03521.1| thioredoxin [Brucella neotomae 5K33]
 gi|261303887|gb|EEY07384.1| thioredoxin [Brucella pinnipedialis M163/99/10]
 gi|261739023|gb|EEY27019.1| thioredoxin [Brucella sp. F5/99]
 gi|261740999|gb|EEY28925.1| thioredoxin [Brucella suis bv. 5 str. 513]
 gi|262551581|gb|EEZ07571.1| thioredoxin [Brucella ceti M490/95/1]
 gi|262764847|gb|EEZ10768.1| thioredoxin [Brucella melitensis bv. 3 str. Ether]
 gi|263003194|gb|EEZ15487.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092857|gb|EEZ17032.1| thioredoxin [Brucella melitensis bv. 2 str. 63/9]
 gi|264659850|gb|EEZ30111.1| thioredoxin [Brucella pinnipedialis M292/94/1]
 gi|264661681|gb|EEZ31942.1| thioredoxin [Brucella sp. 83/13]
 gi|294819920|gb|EFG36919.1| thioredoxin [Brucella sp. NVSL 07-0026]
 gi|297174500|gb|EFH33847.1| thioredoxin [Brucella abortus bv. 5 str. B3196]
 gi|306276213|gb|EFM57913.1| thioredoxin [Brucella sp. BO1]
 gi|306287057|gb|EFM58565.1| thioredoxin [Brucella sp. BO2]
 gi|306407208|gb|EFM63418.1| thioredoxin [Brucella sp. NF 2653]
 gi|326410101|gb|ADZ67166.1| Thioredoxin [Brucella melitensis M28]
 gi|326539818|gb|ADZ88033.1| thioredoxin [Brucella melitensis M5-90]
          Length = 107

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 1   MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI
Sbjct: 61  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWI 102


>gi|254705106|ref|ZP_05166934.1| thioredoxin [Brucella suis bv. 3 str. 686]
 gi|261755811|ref|ZP_05999520.1| thioredoxin [Brucella suis bv. 3 str. 686]
 gi|261745564|gb|EEY33490.1| thioredoxin [Brucella suis bv. 3 str. 686]
          Length = 107

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 1   MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI
Sbjct: 61  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWI 102


>gi|153008152|ref|YP_001369367.1| thioredoxin [Ochrobactrum anthropi ATCC 49188]
 gi|151560040|gb|ABS13538.1| thioredoxin [Ochrobactrum anthropi ATCC 49188]
          Length = 107

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 1   MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKMIAPALDEIATEMAGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI
Sbjct: 61  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWI 102


>gi|239833146|ref|ZP_04681475.1| thioredoxin [Ochrobactrum intermedium LMG 3301]
 gi|239825413|gb|EEQ96981.1| thioredoxin [Ochrobactrum intermedium LMG 3301]
          Length = 124

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 18  MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKMIAPALDEIATEMAGQVKIAKVNID 77

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI
Sbjct: 78  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWI 119


>gi|319407898|emb|CBI81552.1| thioredoxin [Bartonella schoenbuchensis R1]
          Length = 107

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K D  +F +EVL  S PVVVDFWA WC PC  ++PI+D+I+ E+  +VKI K++I+
Sbjct: 1   MTCIKADNSNFKNEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++T+Y + SIPTL++FK+G +   M+ GA S+  + EWI
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGNISSHMV-GAVSKGRLCEWI 102


>gi|298290319|ref|YP_003692258.1| thioredoxin [Starkeya novella DSM 506]
 gi|296926830|gb|ADH87639.1| thioredoxin [Starkeya novella DSM 506]
          Length = 106

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 79/107 (73%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M   KV  +SF+S+V++   PV+VDFWA WC PC  ++P++D++A EL DK+KI KL+++
Sbjct: 1   MGVEKVSDQSFESDVIKSDGPVLVDFWAEWCGPCRMVAPVLDEVAGELGDKLKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   +++Y I SIPTL+LFKDG++  R + GA+ ++ +++WI S +
Sbjct: 61  ENPATASKYGIMSIPTLLLFKDGQLASRQV-GAAPKAKMLQWINSAI 106


>gi|307313939|ref|ZP_07593554.1| thioredoxin [Sinorhizobium meliloti BL225C]
 gi|307322027|ref|ZP_07601405.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|306892316|gb|EFN23124.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|306899213|gb|EFN29851.1| thioredoxin [Sinorhizobium meliloti BL225C]
          Length = 107

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  LKVDT +F  EVL  + PVVVDFWA WC PC  ++P +++I+ ELA KVK+ KL+I+
Sbjct: 1   MPTLKVDTSNFQKEVLNSAEPVVVDFWAPWCGPCKMIAPSLEEISTELAGKVKLVKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++  Y + SIP L +FK G+V D  + GA+ ++ +I WIL+ +
Sbjct: 61  ENPELTAEYGVRSIPMLAMFKAGEVADTKV-GAAPKTALISWILNAI 106


>gi|110635908|ref|YP_676116.1| thioredoxin [Mesorhizobium sp. BNC1]
 gi|110286892|gb|ABG64951.1| thioredoxin [Chelativorans sp. BNC1]
          Length = 107

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD+ +F S+VL+   PVVVDFWA WC PC  ++P +++I+ E+  KVK+ KL+I+
Sbjct: 1   MATVKVDSGNFQSDVLQACEPVVVDFWAEWCGPCKMIAPALEEISSEMQGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ RY + SIPTL+LFK+G+V D M  GA+ ++ +  WI
Sbjct: 61  ENPELAARYGVRSIPTLMLFKNGEVAD-MKVGAAPKTALSAWI 102


>gi|319403512|emb|CBI77091.1| thioredoxin [Bartonella rochalimae ATCC BAA-1498]
          Length = 107

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D+ +F++EVL    PVVVDFWA WC PC  ++PI+D+IA E+  ++K+ K++I+
Sbjct: 1   MTCIKIDSSNFENEVLSSPLPVVVDFWAEWCGPCKSIAPILDEIATEMQSQIKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ +++T+Y I SIPTL++F +GKV    + GA+S+  ++EWI
Sbjct: 61  ENPDLATQYGIRSIPTLLMFTNGKVSSNKV-GATSKGHLVEWI 102


>gi|319406426|emb|CBI80066.1| thioredoxin [Bartonella sp. 1-1C]
          Length = 107

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D+ +F++EVL    PVVVDFWA WC PC  ++PI+D+IA E+  ++K+ K++I+
Sbjct: 1   MTCIKIDSSNFENEVLTSPLPVVVDFWAEWCGPCKSIAPILDEIATEMQSQIKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ +++T+Y I SIPTL++F +GKV    + GA+S+  ++EWI
Sbjct: 61  ENPDLATQYGIRSIPTLLMFTNGKVSSNKV-GATSKGHLVEWI 102


>gi|49473709|ref|YP_031751.1| thioredoxin [Bartonella quintana str. Toulouse]
 gi|49239212|emb|CAF25531.1| Thioredoxin [Bartonella quintana str. Toulouse]
          Length = 107

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 77/103 (74%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K D  +F++EVL  S PVVVDFWA WC PC  ++PI+D+I+ E+  ++KI K++I+
Sbjct: 1   MTCIKTDKCNFENEVLASSVPVVVDFWAEWCGPCKMIAPILDEISTEMQGQIKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++T+Y + SIPTL++FK+GK    M+ GA+S+  + EWI
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGKASSNMV-GAASKGRVSEWI 102


>gi|135741|sp|P00275|THIO1_CORNE RecName: Full=Thioredoxin C-1
          Length = 105

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 77/102 (75%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+E
Sbjct: 1   ATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKMIAPALDEIATEMAGQVKIAKVNIDE 60

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI
Sbjct: 61  NPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWI 101


>gi|15963786|ref|NP_384139.1| thioredoxin protein [Sinorhizobium meliloti 1021]
 gi|307310974|ref|ZP_07590619.1| thioredoxin [Sinorhizobium meliloti BL225C]
 gi|307322015|ref|ZP_07601394.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|15072961|emb|CAC41420.1| Probable thioredoxin protein [Sinorhizobium meliloti 1021]
 gi|306892353|gb|EFN23160.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|306899654|gb|EFN30281.1| thioredoxin [Sinorhizobium meliloti BL225C]
          Length = 107

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVDT +F  EVL  + PVVVDFWA WC PC  ++P +++IA ELA KVK+ KL+I+
Sbjct: 1   MATVKVDTANFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEIATELAGKVKVVKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++ +Y + SIPTL +FK G+V D  + GA+ ++ +  WI + V
Sbjct: 61  ENPELAAQYGVRSIPTLAMFKGGEVADIKV-GAAPKTALSSWISNAV 106


>gi|121602565|ref|YP_989605.1| thioredoxin [Bartonella bacilliformis KC583]
 gi|120614742|gb|ABM45343.1| thioredoxin [Bartonella bacilliformis KC583]
          Length = 107

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 77/103 (74%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D  +F++EVL  S PVVVDFWA WC PC  ++PI+D+I+ E+  +VKI K+ I+
Sbjct: 1   MTCIKIDNSNFENEVLTSSIPVVVDFWAEWCGPCKMIAPILDEISAEMEGQVKIAKISID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++T+Y + SIPTL++FK+G V   ++ GA+S+  + EWI
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGNVSSNVV-GATSKGRLCEWI 102


>gi|197103665|ref|YP_002129042.1| thioredoxin [Phenylobacterium zucineum HLK1]
 gi|196477085|gb|ACG76613.1| thioredoxin [Phenylobacterium zucineum HLK1]
          Length = 109

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS +KV  +SF+++VL+   PV+VDFWA WC PC +++P ++ ++DELADKV I KL+IE
Sbjct: 1   MSTVKVTDESFETDVLQAERPVLVDFWAEWCGPCKQIAPALEQLSDELADKVTIAKLNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ES    +RY +  IPT++LFK G++   M  GA  +  I+EW+
Sbjct: 61  ESPTTPSRYGVRGIPTMMLFKGGQMAS-MKVGAMPKQKILEWL 102


>gi|154247229|ref|YP_001418187.1| thioredoxin [Xanthobacter autotrophicus Py2]
 gi|154161314|gb|ABS68530.1| thioredoxin [Xanthobacter autotrophicus Py2]
          Length = 106

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  KV  ++F+ +VL+ S PV+VDFWA WC PC  ++PI+++++ E+ +K++I KL+++
Sbjct: 1   MSVEKVSDQNFEQDVLQSSAPVIVDFWAEWCGPCRMVAPILEEVSGEMGEKIRIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+   +++Y I SIPTL+LFKDGK+  R + GA+ ++ +++WI
Sbjct: 61  ENPATASKYGIMSIPTLLLFKDGKIASRQV-GAAPKAKLVQWI 102


>gi|115522487|ref|YP_779398.1| thioredoxin [Rhodopseudomonas palustris BisA53]
 gi|115516434|gb|ABJ04418.1| thioredoxin [Rhodopseudomonas palustris BisA53]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    FDSEVL  + PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MAVGKVSDADFDSEVLNATGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ ++ + +WI + V
Sbjct: 61  ESPKTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWISAAV 106


>gi|182679139|ref|YP_001833285.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635022|gb|ACB95796.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +F ++V++   PVVVDFWA WC PC  + P +++IADELADKVKI KL+++
Sbjct: 1   MATVKVTDATFKNDVVDAKAPVVVDFWAEWCGPCKMIGPALEEIADELADKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+  +S  Y I +IPTL+LFKDGK+ +  + GA+ + ++ +WI
Sbjct: 61  ENPGVSGAYGIRTIPTLLLFKDGKIANTKI-GAAPKGELKKWI 102


>gi|325291475|ref|YP_004277339.1| thioredoxin [Agrobacterium sp. H13-3]
 gi|325059328|gb|ADY63019.1| thioredoxin [Agrobacterium sp. H13-3]
          Length = 106

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE S PVVVDFWA WC PC  ++P +++I+ ELA KVK+ KL+I+
Sbjct: 1   MATVKVDAANFQSEVLESSEPVVVDFWAEWCGPCKMIAPSLEEISSELAGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA+ ++ +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKSGEVADIKV-GAAPKTALSAWI 102


>gi|159184127|ref|NP_353062.2| thioredoxin [Agrobacterium tumefaciens str. C58]
 gi|159139464|gb|AAK85847.2| thioredoxin [Agrobacterium tumefaciens str. C58]
          Length = 106

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 76/105 (72%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ ELA KVK+ KL+I+
Sbjct: 1   MATVKVDAANFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISSELAGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++ ++ + SIPTL +FK G+V D  + GA+ ++ +  WI S
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADIKV-GAAPKTALSAWISS 104


>gi|227823892|ref|YP_002827865.1| thioredoxin [Sinorhizobium fredii NGR234]
 gi|227342894|gb|ACP27112.1| thioredoxin [Sinorhizobium fredii NGR234]
          Length = 107

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F  EVL  + PVVVDFWA WC PC  ++P +++IA ELA KVK+ KL+I+
Sbjct: 1   MATVKVDASNFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEIATELAGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ +Y + SIPTL LFK G+V D  + GA+ ++ +  WI
Sbjct: 61  ENPELAAQYGVRSIPTLALFKAGEVADIKV-GAAPKTALSSWI 102


>gi|27375862|ref|NP_767391.1| thioredoxin C-1 [Bradyrhizobium japonicum USDA 110]
 gi|27349000|dbj|BAC46016.1| thioredoxin C-1 [Bradyrhizobium japonicum USDA 110]
          Length = 106

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F++EVL+ + PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MAVGKVSDTDFEAEVLKANGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  ESPKTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWITSAV 106


>gi|150398433|ref|YP_001328900.1| thioredoxin [Sinorhizobium medicae WSM419]
 gi|150029948|gb|ABR62065.1| thioredoxin [Sinorhizobium medicae WSM419]
          Length = 107

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVDT +F  EVL  + PVVVDFWA WC PC  ++P +++I+ ELA KVK+ KL+I+
Sbjct: 1   MATVKVDTSNFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEISTELAGKVKVVKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++ +Y + SIPTL +FK G+V D  + GA+ ++ +  WI + V
Sbjct: 61  ENPELAAQYGVRSIPTLAMFKGGEVADIKV-GAAPKTALSSWISNAV 106


>gi|260463225|ref|ZP_05811427.1| thioredoxin [Mesorhizobium opportunistum WSM2075]
 gi|259031075|gb|EEW32349.1| thioredoxin [Mesorhizobium opportunistum WSM2075]
          Length = 107

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F ++VL  + PVVVDFWA WC PC  ++P ++DIA EL  KVKI KL+I+
Sbjct: 1   MTTVKVDKSNFQADVLNANVPVVVDFWAEWCGPCKMIAPALEDIATELGAKVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL++FK G+V D M  GA+ ++ +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLMIFKGGEVAD-MKVGAAPKTALSHWI 102


>gi|170749779|ref|YP_001756039.1| thioredoxin [Methylobacterium radiotolerans JCM 2831]
 gi|170656301|gb|ACB25356.1| thioredoxin [Methylobacterium radiotolerans JCM 2831]
          Length = 107

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 78/106 (73%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF+ +VL+ + PVVVDFWA WC PC ++ P +++IA +L  KVKI K++++
Sbjct: 1   MATVKVTDASFEQDVLKSAEPVVVDFWAEWCGPCRQIGPALEEIATDLQGKVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ +I+ +Y I SIPTL+LFK+G+ +D+ + GA+ + D+  WI ++
Sbjct: 61  ENPQIAAQYGIRSIPTLLLFKNGERVDQKV-GAAPKGDLSRWIGAQ 105


>gi|209883634|ref|YP_002287491.1| thioredoxin [Oligotropha carboxidovorans OM5]
 gi|209871830|gb|ACI91626.1| thioredoxin [Oligotropha carboxidovorans OM5]
          Length = 106

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  KV    F++EVL+   PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MSVGKVSDADFEAEVLKAEGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ESPKTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKQKLQQWITAAV 106


>gi|92115691|ref|YP_575420.1| thioredoxin [Nitrobacter hamburgensis X14]
 gi|91798585|gb|ABE60960.1| thioredoxin [Nitrobacter hamburgensis X14]
          Length = 106

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV   +F++EVL+ + PVVVDFWA WC PC  + P++D+I+  + DKVKI KL+++
Sbjct: 1   MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEISGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ESPRTASKYGVMSIPTLMIFKGGELASRQV-GAAPKQKLEQWITATV 106


>gi|121078481|gb|ABM47397.1| TrxA [Rhizobium leguminosarum bv. trifolii]
          Length = 110

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+++KVD  +F SEVLE + PVVVDFWA WC PC  ++PII++IA E+  KVK+ KL+I+
Sbjct: 1   MASVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPIIEEIAVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++ ++ + SIPTL +FK G+V D +  G   +S  ++WI   V
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVAD-ISVGEKPKSFFVDWIQRMV 106


>gi|222147039|ref|YP_002547996.1| thioredoxin [Agrobacterium vitis S4]
 gi|221734029|gb|ACM34992.1| thioredoxin [Agrobacterium vitis S4]
          Length = 106

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F++EVL+   PVVVDFWA WC PC  ++P +D+I+ E+A KVKI KL+I+
Sbjct: 1   MATVKVDASNFEAEVLQSVEPVVVDFWAEWCGPCKMIAPSLDEISTEMAGKVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA+ ++ +  WI
Sbjct: 61  ENPELAAKFGVRSIPTLAMFKGGEVADIKV-GAAPKTALSSWI 102


>gi|319780203|ref|YP_004139679.1| thioredoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166091|gb|ADV09629.1| thioredoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 107

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F ++VL+ + PVVVDFWA WC PC  ++P ++DIA EL  KVKI KL+I+
Sbjct: 1   MATVKVDKSNFQADVLDANVPVVVDFWAEWCGPCKMIAPALEDIATELGAKVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL++FK G++ D M  GA+ ++ +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLMIFKGGEMAD-MKVGAAPKTALSHWI 102


>gi|75674250|ref|YP_316671.1| thioredoxin [Nitrobacter winogradskyi Nb-255]
 gi|74419120|gb|ABA03319.1| thioredoxin [Nitrobacter winogradskyi Nb-255]
          Length = 106

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV   +F++EVL+ + PVVVDFWA WC PC  + P++D+I+  +  KVKI KL+++
Sbjct: 1   MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEISSAMGSKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FKDG++  R + GA+ +  + +WI + V
Sbjct: 61  ESPRTASKYGVMSIPTLMIFKDGELASRQV-GAAPKQKLEQWITATV 106


>gi|299133346|ref|ZP_07026541.1| thioredoxin [Afipia sp. 1NLS2]
 gi|298593483|gb|EFI53683.1| thioredoxin [Afipia sp. 1NLS2]
          Length = 106

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M   KV    F++EVL+   PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MGVGKVSDTDFEAEVLKAEGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ESPKTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKQKLQQWITAAV 106


>gi|170742304|ref|YP_001770959.1| thioredoxin [Methylobacterium sp. 4-46]
 gi|168196578|gb|ACA18525.1| thioredoxin [Methylobacterium sp. 4-46]
          Length = 107

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF  +VLE S PVVVDFWA WC PC  + P++++I+ E+  +VKI K++++
Sbjct: 1   MATVKVTDASFRQDVLEASEPVVVDFWAEWCGPCQAIGPVLEEISSEMQGRVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+  I + Y I  IPTL++FKDGK+  + + GA+ + D++ WI S +
Sbjct: 61  ENPGIVSEYGIRPIPTLMIFKDGKLASQKV-GAAPKGDLLRWIQSAI 106


>gi|148251713|ref|YP_001236298.1| thioredoxin 1, redox factor [Bradyrhizobium sp. BTAi1]
 gi|146403886|gb|ABQ32392.1| thioredoxin 1, redox factor [Bradyrhizobium sp. BTAi1]
          Length = 106

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F+SEVL+   PVVVDFWA WC PC  ++P +D+I+  + DKVKI KL+++
Sbjct: 1   MAVGKVSDADFESEVLQADGPVVVDFWAEWCGPCRMIAPALDEISSAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  ESPKTASKYGVMSIPTLMVFKGGEMASRQV-GAAPKAKLQQWISSAV 106


>gi|13474238|ref|NP_105806.1| thioredoxin [Mesorhizobium loti MAFF303099]
 gi|14024990|dbj|BAB51592.1| thioredoxin [Mesorhizobium loti MAFF303099]
          Length = 107

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 74/102 (72%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KVD  +F ++VL  + PVVVDFWA WC PC +++P ++DIA EL  K+KI KL+I+E
Sbjct: 3   ATVKVDKNNFQADVLNANVPVVVDFWAEWCGPCKQIAPSLEDIATELGAKIKIAKLNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E++ ++ + SIPTL++FK G+V D M  GA+ ++ +  WI
Sbjct: 63  NPELAAQFGVRSIPTLMIFKGGEVAD-MKVGAAPKTALSHWI 103


>gi|220921617|ref|YP_002496918.1| thioredoxin [Methylobacterium nodulans ORS 2060]
 gi|219946223|gb|ACL56615.1| thioredoxin [Methylobacterium nodulans ORS 2060]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF  +VLE S PVVVDFWA WC PC  + P +++I+ E+  +VKI K++++
Sbjct: 1   MATVKVTDASFKQDVLEASEPVVVDFWAEWCGPCRAIGPALEEISSEMQGRVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI S
Sbjct: 61  ENPGIASEYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWIQS 104


>gi|158337952|ref|YP_001519128.1| thioredoxin [Acaryochloris marina MBIC11017]
 gi|158308193|gb|ABW29810.1| thioredoxin [Acaryochloris marina MBIC11017]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S   ++  +F +EVLE   PV+VDFWA WC PC  + PI+DDIA +  D+VK+ K +++E
Sbjct: 3   STTAINDTTFTAEVLESQQPVLVDFWAPWCGPCRMVGPIVDDIAADYQDQVKVVKFNVDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           SS++++RY I SIPTLI+FK+G+ ++ ++ GAS ++ ++E
Sbjct: 63  SSDVASRYGIRSIPTLIVFKEGQPVETLV-GASPKATLVE 101


>gi|170738816|ref|YP_001767471.1| thioredoxin [Methylobacterium sp. 4-46]
 gi|168193090|gb|ACA15037.1| thioredoxin [Methylobacterium sp. 4-46]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF  +VLE S PVVVDFWA WC PC  + P +++I+ E+  +VKI K++++
Sbjct: 1   MATVKVTDASFRQDVLEASEPVVVDFWAEWCGPCRAIGPALEEISSEMQGRVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI S
Sbjct: 61  ENPGIASEYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWIQS 104


>gi|146337258|ref|YP_001202306.1| thioredoxin 1, redox factor [Bradyrhizobium sp. ORS278]
 gi|146190064|emb|CAL74056.1| thioredoxin 1, redox factor [Bradyrhizobium sp. ORS278]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           KV    F+SEVL+   PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++ES +
Sbjct: 6   KVSDADFESEVLKADGPVVVDFWAEWCGPCRMIAPALDEIASAMGDKVKIVKLNVDESPK 65

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 66  TASKYGVMSIPTLMVFKGGELASRQV-GAAPKAKLQQWISSAV 107


>gi|91974683|ref|YP_567342.1| thioredoxin [Rhodopseudomonas palustris BisB5]
 gi|91681139|gb|ABE37441.1| thioredoxin [Rhodopseudomonas palustris BisB5]
          Length = 106

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  KV    F++EVL+   PVVVDFWA WC PC  ++P +D+I+  + DKVKI KL+++
Sbjct: 1   MSVGKVSDADFETEVLKAQGPVVVDFWAEWCGPCRMIAPALDEISGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  ESPVTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWISSAV 106


>gi|163757509|ref|ZP_02164598.1| thioredoxin C-1 [Hoeflea phototrophica DFL-43]
 gi|162285011|gb|EDQ35293.1| thioredoxin C-1 [Hoeflea phototrophica DFL-43]
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD+ +F SEVL+ S PVVVDFWA WC PC  ++P +++I++E+  KVK+ K++I+
Sbjct: 1   MATVKVDSANFQSEVLDSSVPVVVDFWAEWCGPCKMIAPSLEEISNEMEGKVKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ EI++++ + SIPTL +FK G V D  + GAS ++ +  WI   V
Sbjct: 61  ENPEIASQFGVRSIPTLAMFKAGAVADIKV-GASPKTALSSWISGAV 106


>gi|39933153|ref|NP_945429.1| thioredoxin [Rhodopseudomonas palustris CGA009]
 gi|192288509|ref|YP_001989114.1| thioredoxin [Rhodopseudomonas palustris TIE-1]
 gi|316931470|ref|YP_004106452.1| thioredoxin [Rhodopseudomonas palustris DX-1]
 gi|39652778|emb|CAE25517.1| thioredoxin [Rhodopseudomonas palustris CGA009]
 gi|192282258|gb|ACE98638.1| thioredoxin [Rhodopseudomonas palustris TIE-1]
 gi|315599184|gb|ADU41719.1| thioredoxin [Rhodopseudomonas palustris DX-1]
          Length = 106

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F++EVL    PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MAVGKVSDADFENEVLNAQGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ ++ + +WI + V
Sbjct: 61  ESPVTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWISAAV 106


>gi|85714147|ref|ZP_01045136.1| thioredoxin [Nitrobacter sp. Nb-311A]
 gi|85699273|gb|EAQ37141.1| thioredoxin [Nitrobacter sp. Nb-311A]
          Length = 106

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV   +F++EVL+ + PVVVDFWA WC PC  + P++D+I+  +  KVKI KL+++
Sbjct: 1   MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEISSAMGSKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ESPRTASKYGVMSIPTLMIFKGGELASRQV-GAAPKQKLEQWITATV 106


>gi|116249791|ref|YP_765629.1| thioredoxin [Rhizobium leguminosarum bv. viciae 3841]
 gi|241206968|ref|YP_002978064.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|115254439|emb|CAK05513.1| putative thioredoxin [Rhizobium leguminosarum bv. viciae 3841]
 gi|240860858|gb|ACS58525.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 106

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++IA E+  KVK+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEIAVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++ ++ + SIPTL +FK G+V D  + GA  ++ +  WI S
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADISV-GAKPKTALSNWISS 104


>gi|90421912|ref|YP_530282.1| thioredoxin [Rhodopseudomonas palustris BisB18]
 gi|90103926|gb|ABD85963.1| thioredoxin [Rhodopseudomonas palustris BisB18]
          Length = 106

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F+SEVL  + PVVVDFWA WC PC  ++P +D+I+  L +KVKI KL+++
Sbjct: 1   MAVGKVSDADFESEVLNATGPVVVDFWAEWCGPCRMIAPALDEISSALGEKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ + +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ENPQTASKYSVMSIPTLLIFKGGEMASRQV-GAAPKQKLHQWISAAV 106


>gi|304392404|ref|ZP_07374345.1| thioredoxin [Ahrensia sp. R2A130]
 gi|303295508|gb|EFL89867.1| thioredoxin [Ahrensia sp. R2A130]
          Length = 106

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D  +F+S+VL    PVVVDFWA WC PC  ++P +++I++E+ DKVKI K++++
Sbjct: 1   MATVKIDNSNFESDVLNSDTPVVVDFWAEWCGPCKMIAPSLEEISNEMGDKVKIAKVNMD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++++Y + SIPTL++FK G+ +  +  GA+ +  +  WI S V
Sbjct: 61  ENPELASKYGVRSIPTLLMFKGGEPV-AIQVGAAPKEKLSSWISSEV 106


>gi|218670427|ref|ZP_03520098.1| thioredoxin protein [Rhizobium etli GR56]
          Length = 106

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++IA E+  KVK+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEIAVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA  ++ +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADISV-GAKPKTALSNWI 102


>gi|329847173|ref|ZP_08262201.1| thioredoxin [Asticcacaulis biprosthecum C19]
 gi|328842236|gb|EGF91805.1| thioredoxin [Asticcacaulis biprosthecum C19]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  K+   SF+++VL+ S PV+VDFWA WC PC +++PI++++++ L DK+KI KL+IE
Sbjct: 1   MATHKITDDSFEADVLKSSTPVLVDFWAEWCGPCKQIAPILEELSEGLGDKIKIAKLNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +S    +R+ +  IPT+ILFKDG++   M  GA  ++ ++EW+
Sbjct: 61  DSPMTPSRFGVRGIPTMILFKDGQMTS-MKVGALPKAKLLEWL 102


>gi|148284251|ref|YP_001248341.1| thioredoxin [Orientia tsutsugamushi str. Boryong]
 gi|146739690|emb|CAM79500.1| thioredoxin [Orientia tsutsugamushi str. Boryong]
 gi|267847123|gb|ACY80702.1| thioredoxin [Orientia tsutsugamushi str. Boryong]
 gi|267847125|gb|ACY80703.1| thioredoxin [Orientia tsutsugamushi]
 gi|267847135|gb|ACY80708.1| thioredoxin [Orientia tsutsugamushi]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 73/97 (75%), Gaps = 1/97 (1%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
           D ++F  EVL  S  V+VDF+A WC PC +LSPI++ I++EL+DKVKI K++IE++ + +
Sbjct: 10  DEENFKQEVLLSSKLVLVDFYADWCGPCRQLSPILEQISEELSDKVKIVKVNIEKNIQAA 69

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           T ++I SIPTLILF +G+ + R + G S Q DII+WI
Sbjct: 70  TDFKIQSIPTLILFNNGEAVSREIGGKSKQ-DIIDWI 105


>gi|209551529|ref|YP_002283446.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537285|gb|ACI57220.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 106

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  KVK+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++ ++ + SIPTL +FK G+V D +  GA +++ +  WI S
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVAD-ISVGAKAKTALSNWISS 104


>gi|296444511|ref|ZP_06886476.1| thioredoxin [Methylosinus trichosporium OB3b]
 gi|296258158|gb|EFH05220.1| thioredoxin [Methylosinus trichosporium OB3b]
          Length = 110

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 73/102 (71%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A+KV   SF++EVL+   PVVVDFWA WC PC  ++P +++IA EL DK+K+ KL+++E
Sbjct: 3   TAIKVSDASFEAEVLKSDQPVVVDFWAEWCGPCRTIAPALEEIAIELKDKLKVVKLNVDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  ++    I SIPTLI+FKDGK   + + GA+ + +++ WI
Sbjct: 63  NPNVAGALGIRSIPTLIVFKDGKAAAQKV-GAAPKGELLRWI 103


>gi|267847129|gb|ACY80705.1| thioredoxin [Orientia tsutsugamushi]
 gi|267847131|gb|ACY80706.1| thioredoxin [Orientia tsutsugamushi]
 gi|267847137|gb|ACY80709.1| thioredoxin [Orientia tsutsugamushi]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 73/97 (75%), Gaps = 1/97 (1%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
           D +SF  EVL     V+VDF+A WC PC +LSPI++ I++EL+DKVKI K++IE++ +++
Sbjct: 10  DEESFKQEVLLSPKLVLVDFYADWCGPCRQLSPILEQISEELSDKVKIVKVNIEKNIQVA 69

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           T ++I SIPTLILF +G+ + R + G S Q DII+WI
Sbjct: 70  TDFKIQSIPTLILFNNGEAVSREIGGKSKQ-DIIDWI 105


>gi|329891018|ref|ZP_08269361.1| thioredoxin [Brevundimonas diminuta ATCC 11568]
 gi|328846319|gb|EGF95883.1| thioredoxin [Brevundimonas diminuta ATCC 11568]
          Length = 110

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SFD++VL+ S PV+VDFWA WC PC ++ P ++ IADELA KV + K++I+
Sbjct: 1   MATVKVTDDSFDADVLKSSTPVLVDFWAEWCGPCKQIGPALEQIADELAGKVTVAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +S  + ++  +  IPTL+LFKDG+ +  M  GA  +  I+EW+
Sbjct: 61  DSPMVPSKMGVKGIPTLMLFKDGQ-MTSMKVGAMPKGKIVEWL 102


>gi|163853838|ref|YP_001641881.1| thioredoxin [Methylobacterium extorquens PA1]
 gi|163665443|gb|ABY32810.1| thioredoxin [Methylobacterium extorquens PA1]
          Length = 119

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF+ +VL+ + PVVVDFWA WC PC ++ P +++I+ +L  KVKI K++++
Sbjct: 14  MATVKVTDASFEQDVLQSAEPVVVDFWAEWCGPCRQIGPALEEISADLQGKVKIVKVNVD 73

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI
Sbjct: 74  ENPGIASTYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWI 115


>gi|258515471|ref|YP_003191693.1| thioredoxin [Desulfotomaculum acetoxidans DSM 771]
 gi|257779176|gb|ACV63070.1| thioredoxin [Desulfotomaculum acetoxidans DSM 771]
          Length = 105

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 73/101 (72%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL+V+  +F+SEVL+ S PVVVDFWA WC PC  ++P+I+++A +   K KI KL+++E+
Sbjct: 2   ALEVNQSNFESEVLKASEPVVVDFWAPWCGPCRSMAPVIEELAKDFEGKAKIAKLNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             ++ ++ + SIPTLI FKDGK +D ++ G + ++ I E I
Sbjct: 62  QALAGQFGVMSIPTLIFFKDGKAVDTVV-GFTPKNKIAEKI 101


>gi|331085315|ref|ZP_08334401.1| thioredoxin [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330408098|gb|EGG87588.1| thioredoxin [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 103

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 78/103 (75%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+++ +++F  EVLE   PV+VDFWA WC PC  + PII+++A+E+ D VKI K++++
Sbjct: 1   MAAIQLTSETFQKEVLEAKEPVLVDFWAPWCGPCQMVLPIIEELAEEVTD-VKICKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  +I+  Y++ SIPTLILFKDGK++ + + GA ++ +++E I
Sbjct: 60  EQMKIAKEYRVMSIPTLILFKDGKIVKQDL-GAKTKEELLEMI 101


>gi|325660975|ref|ZP_08149602.1| thioredoxin [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325472482|gb|EGC75693.1| thioredoxin [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 103

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 77/103 (74%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+++ +++F  EVLE   PV+VDFWA WC PC  + PII+++A+E+ D VKI K++++
Sbjct: 1   MAAIQLTSETFQKEVLEAKEPVLVDFWAPWCGPCQMVLPIIEELAEEVTD-VKICKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  +I+  Y++ SIPTLILFKDGK+  + + GA ++ +++E I
Sbjct: 60  EQMKIAKEYRVMSIPTLILFKDGKIAKQEL-GAKTKEELLEMI 101


>gi|218532783|ref|YP_002423599.1| thioredoxin [Methylobacterium chloromethanicum CM4]
 gi|240141292|ref|YP_002965772.1| thioredoxin [Methylobacterium extorquens AM1]
 gi|254563801|ref|YP_003070896.1| thioredoxin [Methylobacterium extorquens DM4]
 gi|218525086|gb|ACK85671.1| thioredoxin [Methylobacterium chloromethanicum CM4]
 gi|240011269|gb|ACS42495.1| thioredoxin [Methylobacterium extorquens AM1]
 gi|254271079|emb|CAX27086.1| thioredoxin [Methylobacterium extorquens DM4]
          Length = 106

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF+ +VL+ + PVVVDFWA WC PC ++ P +++I+ +L  KVKI K++++
Sbjct: 1   MATVKVTDASFEQDVLQSAEPVVVDFWAEWCGPCRQIGPALEEISADLQGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI
Sbjct: 61  ENPGIASTYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWI 102


>gi|330813553|ref|YP_004357792.1| thioredoxin [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486648|gb|AEA81053.1| thioredoxin [Candidatus Pelagibacter sp. IMCC9063]
          Length = 107

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   +F++EVL+   PV+VDFWA WC PC  + P++++++DE+ADK+ I K +I+
Sbjct: 1   MATKQVTDDNFENEVLKSEKPVLVDFWAEWCGPCKMVGPVLEELSDEMADKLVIAKHNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +S    T+Y +  IPT++LF  G++ID  + GA+++S+I EW+ S+V
Sbjct: 61  DSPNTPTKYGVRGIPTMLLFSGGQLIDTKV-GAANKSNIKEWLDSKV 106


>gi|254471037|ref|ZP_05084440.1| thioredoxin [Pseudovibrio sp. JE062]
 gi|211960179|gb|EEA95376.1| thioredoxin [Pseudovibrio sp. JE062]
          Length = 106

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V+  +F++EVL+ S PV+VDFWA+WC PC  ++P +++I++E+A +VKI KLDI+
Sbjct: 1   MATVNVEDGNFEAEVLQSSTPVLVDFWATWCGPCKMIAPSLEEISEEMAGQVKIAKLDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + + +  Y + SIPT+ILFKDG+    ++ GA  +  I +WI
Sbjct: 61  SNQQSAMNYGVRSIPTMILFKDGQPAATLV-GAQPKGKIADWI 102


>gi|315925571|ref|ZP_07921781.1| thioredoxin [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315621112|gb|EFV01083.1| thioredoxin [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 102

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 76/100 (76%), Gaps = 2/100 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + +   +F+SEVL+ + PV+VDFWASWC PC  +SP++D+IA+E  D+VK+ K++++
Sbjct: 1   MSVVTLTKDNFESEVLQSNKPVLVDFWASWCGPCKMVSPLVDEIAEE-HDEVKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E SE++ ++QI SIPTL++FKDG++  R + GA  +  I+
Sbjct: 60  EESELAQQFQIMSIPTLLVFKDGEIAQRQV-GAVPKEKIV 98


>gi|283850647|ref|ZP_06367934.1| thioredoxin [Desulfovibrio sp. FW1012B]
 gi|283573890|gb|EFC21863.1| thioredoxin [Desulfovibrio sp. FW1012B]
          Length = 106

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 73/101 (72%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A+++   +F++E L+C  PV+VDFWA WC PC  + P+ID++A+E   +VK+ K++++E+
Sbjct: 2   AIQLSDANFEAEALQCDLPVLVDFWAPWCGPCRAMGPVIDELANEYTGQVKVAKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++Y I +IPTLILFK G+V++++  GA S+S I E I
Sbjct: 62  PSTPSKYGIRAIPTLILFKGGEVVEQIT-GAVSKSSIKEMI 101


>gi|237736442|ref|ZP_04566923.1| thioredoxin [Fusobacterium mortiferum ATCC 9817]
 gi|229421484|gb|EEO36531.1| thioredoxin [Fusobacterium mortiferum ATCC 9817]
          Length = 104

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 76/102 (74%), Gaps = 1/102 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EVL+   PVVVDFWASWC PC  L+PI++++  ELA  VK+ K++I+
Sbjct: 1   MAILHITKENFEKEVLQSKEPVVVDFWASWCGPCKALAPILEEVDAELAGTVKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEW 102
           E  E++ ++++ SIPTL+LFK+G+V+++ + G + + +++ +
Sbjct: 61  EEEELAAQFRVMSIPTLLLFKNGEVVNKSV-GLAPKEEVVAF 101


>gi|86355693|ref|YP_467585.1| thioredoxin protein [Rhizobium etli CFN 42]
 gi|190889665|ref|YP_001976207.1| thioredoxin protein [Rhizobium etli CIAT 652]
 gi|218510667|ref|ZP_03508545.1| thioredoxin protein [Rhizobium etli Brasil 5]
 gi|45505285|gb|AAS67015.1| TrxA [Rhizobium etli]
 gi|86279795|gb|ABC88858.1| thioredoxin protein [Rhizobium etli CFN 42]
 gi|190694944|gb|ACE89029.1| thioredoxin protein [Rhizobium etli CIAT 652]
 gi|327192793|gb|EGE59721.1| thioredoxin protein [Rhizobium etli CNPAF512]
          Length = 106

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  KVK+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA  ++ +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADISV-GAKPKTALSNWI 102


>gi|303245510|ref|ZP_07331794.1| thioredoxin [Desulfovibrio fructosovorans JJ]
 gi|302493359|gb|EFL53221.1| thioredoxin [Desulfovibrio fructosovorans JJ]
          Length = 106

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 74/104 (71%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A+++   +F++E L+C  PV+VDFWA WC PC  + P+ID++A+E   +VK+ K++++E+
Sbjct: 2   AIQLSDANFEAEALQCDLPVLVDFWAPWCGPCRAMGPVIDELANEYTGQVKVAKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               ++Y I +IPTLILFK G+V++++  GA S+S I E +  +
Sbjct: 62  PSTPSKYGIRAIPTLILFKGGEVVEQIT-GAVSKSSIKEMLTQK 104


>gi|260893513|ref|YP_003239610.1| thioredoxin [Ammonifex degensii KC4]
 gi|260865654|gb|ACX52760.1| thioredoxin [Ammonifex degensii KC4]
          Length = 110

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L+V+ ++F++EVL+ + PV+VDFWA WC PC  ++P+++++A E A ++K+ KL+++E+ 
Sbjct: 3   LEVNERNFEAEVLQSNIPVLVDFWAPWCGPCRSMAPVVEEVAREFAGRLKVAKLNVDENM 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++ RY I  IPTL+ F++GKVI + + G + +  ++ W+
Sbjct: 63  SLAQRYGIRGIPTLLFFREGKVIAQEV-GYTPKETLVAWL 101


>gi|312135383|ref|YP_004002721.1| thioredoxin [Caldicellulosiruptor owensensis OL]
 gi|311775434|gb|ADQ04921.1| thioredoxin [Caldicellulosiruptor owensensis OL]
          Length = 108

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 73/96 (76%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL++++  +I+ 
Sbjct: 10  SENFEKEVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAY 69

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++I SIPT++LFKDGK +D+++ GA  +SD + +I
Sbjct: 70  AFRIMSIPTIMLFKDGKAVDKII-GARPKSDFVNFI 104


>gi|328545809|ref|YP_004305918.1| Thiol-disulfide isomerase and thioredoxins [polymorphum gilvum
           SL003B-26A1]
 gi|326415549|gb|ADZ72612.1| Thiol-disulfide isomerase and thioredoxins [Polymorphum gilvum
           SL003B-26A1]
          Length = 106

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  K+   SF+++VL+ S PVVVDFWA WC PC  ++P +++I++E+A KVKI KL+I+
Sbjct: 1   MATSKITDASFEADVLKSSEPVVVDFWAEWCGPCKMIAPALEEISEEMAGKVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+  ++ +Y + SIP LILFK+G+ +   + GA+ +  I +WI
Sbjct: 61  ENQNMAMKYGVRSIPMLILFKNGEPMATQV-GAAPKGKIADWI 102


>gi|188584142|ref|YP_001927587.1| thioredoxin [Methylobacterium populi BJ001]
 gi|179347640|gb|ACB83052.1| thioredoxin [Methylobacterium populi BJ001]
          Length = 106

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF+ +VL+ + PVVVDFWA WC PC ++ P +++I+ +L  KVKI K++++
Sbjct: 1   MATVKVTDASFEQDVLQSAEPVVVDFWAEWCGPCRQIGPALEEISVDLQGKVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI
Sbjct: 61  ENPGIASTYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWI 102


>gi|242279289|ref|YP_002991418.1| thioredoxin [Desulfovibrio salexigens DSM 2638]
 gi|242122183|gb|ACS79879.1| thioredoxin [Desulfovibrio salexigens DSM 2638]
          Length = 106

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL+V   +F  EVL    PV+VDFWA WC PC  + P+ID++A+E + ++KI K++++++
Sbjct: 2   ALQVTDSNFQEEVLNSDKPVLVDFWAPWCGPCRAMGPVIDELAEEFSGQIKICKMNVDDN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
                +Y I +IPTLILFKDG+V+D+   GA S+S I E I S+ 
Sbjct: 62  PASPGKYGIRAIPTLILFKDGEVVDQTT-GAVSKSSIKEMISSKA 105


>gi|86747756|ref|YP_484252.1| thioredoxin [Rhodopseudomonas palustris HaA2]
 gi|86570784|gb|ABD05341.1| thioredoxin [Rhodopseudomonas palustris HaA2]
          Length = 106

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F++EVL+   PVVVDFWA WC PC  ++P +D+I+  + D VKI KL+++
Sbjct: 1   MAVGKVSDADFEAEVLKAQGPVVVDFWAEWCGPCRMIAPALDEISGAMGDTVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  ESPVTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWISSAV 106


>gi|239906801|ref|YP_002953542.1| thioredoxin [Desulfovibrio magneticus RS-1]
 gi|239796667|dbj|BAH75656.1| thioredoxin [Desulfovibrio magneticus RS-1]
          Length = 106

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 73/101 (72%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A+++   +F++E L+C  PV+VDFWA WC PC  + P+ID++A+E   +VK+ K++++E+
Sbjct: 2   AIQLSDANFEAEALQCDLPVLVDFWAPWCGPCRAMGPVIDELANEYTGQVKVAKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++Y I +IPTLILFK G+V++++  GA S+S I E +
Sbjct: 62  PSTPSKYGIRAIPTLILFKGGEVVEQIT-GAVSKSSIKEML 101


>gi|118593732|ref|ZP_01551101.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2 [Stappia
           aggregata IAM 12614]
 gi|118433642|gb|EAV40305.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2 [Stappia
           aggregata IAM 12614]
          Length = 106

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   SF++EVL+   PVVVDFWA WC PC  ++P +++I++E++ +VKITKL+I+
Sbjct: 1   MATTQVTDSSFEAEVLKSDGPVVVDFWAEWCGPCKMIAPALEEISEEMSGQVKITKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++ +Y + SIP LILFKDG+ +   + GA+ +  + +WI S +
Sbjct: 61  ENQDMAMKYGVRSIPMLILFKDGEPMATQI-GAAPKGKLSDWIKSAL 106


>gi|332704218|ref|ZP_08424306.1| thioredoxin [Desulfovibrio africanus str. Walvis Bay]
 gi|332554367|gb|EGJ51411.1| thioredoxin [Desulfovibrio africanus str. Walvis Bay]
          Length = 107

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A +V   +F+SEVL+C  PV+VDFWA WC PC  L P+I+++A+E   +VKI K++++E+
Sbjct: 2   AGQVMDSNFESEVLKCDLPVLVDFWAPWCGPCRALGPVIEELANEYTGQVKIVKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
                ++ I +IPTLILFK+G+V+D++  GA S+S I + I  +V
Sbjct: 62  PNTPGKFGIRAIPTLILFKNGEVLDQVT-GAVSKSSIKDMISKKV 105


>gi|222084226|ref|YP_002542752.1| thioredoxin [Agrobacterium radiobacter K84]
 gi|221721674|gb|ACM24830.1| thioredoxin [Agrobacterium radiobacter K84]
          Length = 108

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVL+ + PV+VDFWA WC PC  ++P +++++++   KVK+ KL+I+
Sbjct: 1   MATVKVDNANFASEVLQSAEPVIVDFWAEWCGPCKMIAPSLEELSEQFEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA+ +S +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLAMFKAGEVADIKV-GAAPKSALESWI 102


>gi|90420587|ref|ZP_01228494.1| thioredoxin [Aurantimonas manganoxydans SI85-9A1]
 gi|90335315|gb|EAS49068.1| thioredoxin [Aurantimonas manganoxydans SI85-9A1]
          Length = 106

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 77/103 (74%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  K+DT +F ++VL    PVVVDFWA WC PC  ++P +++I++E+ D V+I K++I+
Sbjct: 1   MATTKIDTSNFQTDVLGSDKPVVVDFWAEWCGPCKMIAPSLEEISNEM-DNVRIAKVNID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ +I+ ++ + SIPTL++FK+G+  D M+ GA S+S +++WI
Sbjct: 60  ENPDIAAQFGVRSIPTLMIFKNGEHADTMV-GAQSKSKLVDWI 101


>gi|189182938|ref|YP_001936723.1| thioredoxin [Orientia tsutsugamushi str. Ikeda]
 gi|189179709|dbj|BAG39489.1| thioredoxin [Orientia tsutsugamushi str. Ikeda]
 gi|267847127|gb|ACY80704.1| thioredoxin [Orientia tsutsugamushi]
 gi|267847133|gb|ACY80707.1| thioredoxin [Orientia tsutsugamushi]
          Length = 108

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 72/97 (74%), Gaps = 1/97 (1%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
           D ++F  EV      V+VDF+A WC PC +LSPI++ I++EL+DKVKI K++IE++ +++
Sbjct: 10  DEENFKQEVFLSPKLVLVDFYADWCGPCRQLSPILEQISEELSDKVKIVKVNIEKNIQVA 69

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           T ++I SIPTLILF +G+ + R + G S Q DII+WI
Sbjct: 70  TDFKIQSIPTLILFNNGEAVSREIGGKSKQ-DIIDWI 105


>gi|302384280|ref|YP_003820103.1| thioredoxin [Brevundimonas subvibrioides ATCC 15264]
 gi|302194908|gb|ADL02480.1| thioredoxin [Brevundimonas subvibrioides ATCC 15264]
          Length = 111

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SFD++VL+ S PV+VDFWA WC PC ++ P ++ IADELA +V I K++I+
Sbjct: 1   MATMKVTDDSFDTDVLKASTPVLVDFWAEWCGPCKQIGPALEQIADELAGQVTIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +S    ++  +  IPTL+LFKDG++    + GA  +  I+EW+
Sbjct: 61  DSPMTPSKLGVKGIPTLMLFKDGQMTSLKV-GAMPKGKILEWL 102


>gi|91203303|emb|CAJ72942.1| strongly similar to thioredoxin [Candidatus Kuenenia
           stuttgartiensis]
          Length = 108

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 68/90 (75%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD+EV     PV+VDFWASWC PC +L+P+I+++A E + K KI KL+ EE++    ++
Sbjct: 12  NFDAEVTNAKIPVLVDFWASWCGPCRQLAPVIEELAKEYSGKAKIGKLNTEENNSTPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            I+SIPT+ILFK+GK ++R++ G  S++D+
Sbjct: 72  GITSIPTIILFKNGKAVNRIV-GVKSKNDL 100


>gi|157826387|ref|YP_001495451.1| thioredoxin [Rickettsia bellii OSU 85-389]
 gi|157801691|gb|ABV76943.1| Thioredoxin [Rickettsia bellii OSU 85-389]
          Length = 119

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V  KSF+ EVL+   PV+VDFWA WC PC  L+PII++I+ +L  KVK+ K++I+E+
Sbjct: 16  ASNVTDKSFEEEVLKSDLPVLVDFWAEWCGPCRMLTPIIEEISKDLESKVKVLKMNIDEN 75

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            EI ++Y I SIPT++LFK+G+  D  + G   ++ +IEWI + +
Sbjct: 76  PEIPSKYGIRSIPTVMLFKNGEQKDTKV-GLHQKNSLIEWINNNI 119


>gi|91204817|ref|YP_537172.1| thioredoxin [Rickettsia bellii RML369-C]
 gi|91068361|gb|ABE04083.1| Thioredoxin [Rickettsia bellii RML369-C]
          Length = 119

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V  KSF+ EVL+   PV+VDFWA WC PC  L+PII++I+ +L  KVK+ K++I+E+
Sbjct: 16  ASNVTDKSFEEEVLKSDLPVLVDFWAEWCSPCRMLTPIIEEISKDLESKVKVLKMNIDEN 75

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            EI ++Y I SIPT++LFK+G+  D  + G   ++ +IEWI + +
Sbjct: 76  PEIPSKYGIRSIPTVMLFKNGEQKDTKV-GLHQKNSLIEWINNNI 119


>gi|254418173|ref|ZP_05031897.1| thioredoxin [Brevundimonas sp. BAL3]
 gi|196184350|gb|EDX79326.1| thioredoxin [Brevundimonas sp. BAL3]
          Length = 111

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV  +SFD++VL+ S PV+VDFWA WC PC ++ P ++ IADEL  +V + K++I+
Sbjct: 1   MATVKVTDESFDADVLKSSTPVLVDFWAEWCGPCKQIGPALEQIADELGGQVTVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +S    ++  +  IPTL+LFKDG+ +  M  GA  +  I+EW+
Sbjct: 61  DSPMTPSKLGVKGIPTLMLFKDGQ-MTSMKVGAMPKGKIVEWL 102


>gi|116619449|ref|YP_821605.1| thioredoxin [Candidatus Solibacter usitatus Ellin6076]
 gi|116222611|gb|ABJ81320.1| thioredoxin [Candidatus Solibacter usitatus Ellin6076]
          Length = 109

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + L     +FD +VL    PV+VDFWA WC PC ++SP ID +A E A KVK+ KLD++ 
Sbjct: 5   NTLTFSDSTFDEDVLRSDVPVLVDFWAEWCGPCRQMSPTIDVVAGEYAGKVKVGKLDVDA 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   + RY +  IPTL+LFK G+V+++ + GA  +SD+++ I + V
Sbjct: 65  NGGTAMRYNVRGIPTLLLFKGGQVVEQRV-GAIGKSDVLKMIDAHV 109


>gi|302871611|ref|YP_003840247.1| thioredoxin [Caldicellulosiruptor obsidiansis OB47]
 gi|312793820|ref|YP_004026743.1| thioredoxin [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|302574470|gb|ADL42261.1| thioredoxin [Caldicellulosiruptor obsidiansis OB47]
 gi|312180960|gb|ADQ41130.1| thioredoxin [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 108

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 73/96 (76%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL++++  +I+ 
Sbjct: 10  SENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAY 69

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++I SIPT++LFK+GK +D+++ GA  +SD + +I
Sbjct: 70  AFRIMSIPTIMLFKNGKAVDKII-GARPKSDFVNFI 104


>gi|124053397|sp|Q1RKN1|THIO_RICBR RecName: Full=Thioredoxin; Short=Trx
          Length = 105

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V  KSF+ EVL+   PV+VDFWA WC PC  L+PII++I+ +L  KVK+ K++I+E+
Sbjct: 2   ASNVTDKSFEEEVLKSDLPVLVDFWAEWCSPCRMLTPIIEEISKDLESKVKVLKMNIDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            EI ++Y I SIPT++LFK+G+  D  + G   ++ +IEWI + +
Sbjct: 62  PEIPSKYGIRSIPTVMLFKNGEQKDTKV-GLHQKNSLIEWINNNI 105


>gi|295687597|ref|YP_003591290.1| thioredoxin [Caulobacter segnis ATCC 21756]
 gi|295429500|gb|ADG08672.1| thioredoxin [Caulobacter segnis ATCC 21756]
          Length = 110

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +F+S+VL+ S PV+VDFWA WC PC +++P ++ I++ELAD V + K++IE
Sbjct: 1   MSTVVVTDATFESDVLKASKPVLVDFWAEWCGPCKQIAPALEQISEELADVVTVAKVNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +S    +RY +  IPT++LF+DG+ +  M  GA  +  I+EW+
Sbjct: 61  DSPTTPSRYGVRGIPTMMLFRDGQ-MTSMKVGAMPKQKILEWL 102


>gi|165924245|ref|ZP_02220077.1| thioredoxin [Coxiella burnetii RSA 334]
 gi|165916309|gb|EDR34913.1| thioredoxin [Coxiella burnetii RSA 334]
          Length = 108

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 76/99 (76%), Gaps = 1/99 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F++EVL+   PV+VDFWA WC+PC  +SP++++IA E A +VK+ KL+++E+++  T+
Sbjct: 7   ENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLNVDENAQTPTK 66

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           Y +  IP+L++F++G+V+DR + GA ++S +  ++  R+
Sbjct: 67  YGVRGIPSLLIFREGEVVDRKV-GALNKSQLAAFLDERL 104


>gi|221236589|ref|YP_002519026.1| thioredoxin [Caulobacter crescentus NA1000]
 gi|220965762|gb|ACL97118.1| thioredoxin [Caulobacter crescentus NA1000]
          Length = 127

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +F+++VL+ S PV+VDFWA WC PC +++P ++ +++ELAD V I K++IE
Sbjct: 18  MSTVAVTDATFEADVLKSSKPVLVDFWAEWCGPCKQIAPALEQLSEELADVVTIAKVNIE 77

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +S    +RY +  IPT++LF+DG++   M  GA  +  I+EW+
Sbjct: 78  DSPTTPSRYGVRGIPTMMLFRDGQMTS-MKVGAMPKQKILEWL 119


>gi|167648809|ref|YP_001686472.1| thioredoxin [Caulobacter sp. K31]
 gi|167351239|gb|ABZ73974.1| thioredoxin [Caulobacter sp. K31]
          Length = 111

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V  +SF+ +VL+   PV+VDFWA WC PC +++P ++ I++ELAD V + K++IE
Sbjct: 1   MSTVAVTDESFERDVLQAEKPVLVDFWAEWCGPCKQIAPALEQISEELADHVTVAKVNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +S    +RY +  IPT++LF+ G++   M  GA  ++ I+EW+
Sbjct: 61  DSPTTPSRYGVRGIPTMMLFRGGQMAS-MKVGAMPKAKILEWL 102


>gi|332981517|ref|YP_004462958.1| thioredoxin [Mahella australiensis 50-1 BON]
 gi|332699195|gb|AEE96136.1| thioredoxin [Mahella australiensis 50-1 BON]
          Length = 109

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 70/94 (74%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD EVL+   PV+VDFWA+WC PC  +SPIID++A + A K+K+ K++++E   I+ RY
Sbjct: 13  NFDDEVLKSDKPVLVDFWAAWCGPCRMVSPIIDELAADYAGKIKVGKVNVDEQRSIAERY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I SIPT+ LFKDG+ +D+++ GA  ++D   +I
Sbjct: 73  RIMSIPTIYLFKDGQPVDKII-GARPKADFERFI 105


>gi|312877468|ref|ZP_07737431.1| thioredoxin [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795789|gb|EFR12155.1| thioredoxin [Caldicellulosiruptor lactoaceticus 6A]
          Length = 108

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 73/96 (76%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL++++  +I+ 
Sbjct: 10  SENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAY 69

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++I SIPT++LFK+G+ +D+++ GA  +SD + +I
Sbjct: 70  AFRIMSIPTIMLFKNGRAVDKII-GARPKSDFVNFI 104


>gi|146296734|ref|YP_001180505.1| thioredoxin [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410310|gb|ABP67314.1| thioredoxin [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 115

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 73/96 (76%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL++++  +I+ 
Sbjct: 17  SENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAY 76

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++I SIPT++LFK+G+ +D+++ GA  +SD + +I
Sbjct: 77  AFRIMSIPTIMLFKNGQAVDKII-GARPKSDFVNFI 111


>gi|167037408|ref|YP_001664986.1| thioredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040076|ref|YP_001663061.1| thioredoxin [Thermoanaerobacter sp. X514]
 gi|256752833|ref|ZP_05493674.1| thioredoxin [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914159|ref|ZP_07131475.1| thioredoxin [Thermoanaerobacter sp. X561]
 gi|307724605|ref|YP_003904356.1| thioredoxin [Thermoanaerobacter sp. X513]
 gi|320115822|ref|YP_004185981.1| thioredoxin [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166854316|gb|ABY92725.1| thioredoxin [Thermoanaerobacter sp. X514]
 gi|166856242|gb|ABY94650.1| thioredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256748283|gb|EEU61346.1| thioredoxin [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889094|gb|EFK84240.1| thioredoxin [Thermoanaerobacter sp. X561]
 gi|307581666|gb|ADN55065.1| thioredoxin [Thermoanaerobacter sp. X513]
 gi|319928913|gb|ADV79598.1| thioredoxin [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 107

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 74/101 (73%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V  ++F  EV   + PV+VDFWA WCRPC+ ++P++++ A+E ADK+K+ KLD++
Sbjct: 1   MKPVNVTDETFAEEVYNSNKPVLVDFWAKWCRPCLMMAPVLEEFAEEYADKMKVAKLDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E+  I+++Y+I SIPT+ +F +GK++D+++ G   +  ++E
Sbjct: 61  ENPVIASKYRIMSIPTMGVFVNGKMVDKVI-GFMPKEHLVE 100


>gi|304414181|ref|ZP_07395549.1| thioredoxin [Candidatus Regiella insecticola LSR1]
 gi|304283395|gb|EFL91791.1| thioredoxin [Candidatus Regiella insecticola LSR1]
          Length = 108

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 68/94 (72%), Gaps = 1/94 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           ++ K+F  +VL+ S PV+VDFWA WC PC  L+PI+D+IA+E A K+ +TKL+I++  E 
Sbjct: 8   LEDKTFQVDVLKASGPVLVDFWAEWCGPCKTLAPILDEIANEYAGKLTVTKLNIDDQRET 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           + +Y +  IPTL+LFKDGKV    + G  S++D+
Sbjct: 68  APKYGVRGIPTLLLFKDGKVAANQV-GLVSKTDL 100


>gi|312127343|ref|YP_003992217.1| thioredoxin [Caldicellulosiruptor hydrothermalis 108]
 gi|311777362|gb|ADQ06848.1| thioredoxin [Caldicellulosiruptor hydrothermalis 108]
          Length = 108

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 73/96 (76%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           +++F+ EVL+   PVVVDFWA+WC PC  ++P+++++A E A KVK  KL++++  +I+ 
Sbjct: 10  SENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVMEELAQEYAGKVKFAKLNVDDYGDIAY 69

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++I SIPT++LFK+GK +D+++ GA  +SD + +I
Sbjct: 70  AFRIMSIPTIMLFKNGKAVDKII-GARPKSDFVNFI 104


>gi|16127769|ref|NP_422333.1| thioredoxin [Caulobacter crescentus CB15]
 gi|13425273|gb|AAK25501.1| thioredoxin [Caulobacter crescentus CB15]
          Length = 110

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +F+++VL+ S PV+VDFWA WC PC +++P ++ +++ELAD V I K++IE
Sbjct: 1   MSTVAVTDATFEADVLKSSKPVLVDFWAEWCGPCKQIAPALEQLSEELADVVTIAKVNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +S    +RY +  IPT++LF+DG++   M  GA  +  I+EW+
Sbjct: 61  DSPTTPSRYGVRGIPTMMLFRDGQMTS-MKVGAMPKQKILEWL 102


>gi|209966105|ref|YP_002299020.1| thioredoxin [Rhodospirillum centenum SW]
 gi|209959571|gb|ACJ00208.1| thioredoxin [Rhodospirillum centenum SW]
          Length = 107

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A  V   SF ++VLE S PV+VDFWA WC PC  ++P +D+IA EL  K+ + KL+I+E
Sbjct: 3   NATAVSDASFTTDVLEASGPVLVDFWAEWCGPCRMIAPALDEIAGELQGKLTVAKLNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    TRY +  IPTL++FKDGKV    + GA  +  +  WI
Sbjct: 63  NPGTPTRYGVRGIPTLMIFKDGKVAATKI-GALPKQQLRNWI 103


>gi|260461330|ref|ZP_05809578.1| thioredoxin [Mesorhizobium opportunistum WSM2075]
 gi|319785495|ref|YP_004144971.1| thioredoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|259032867|gb|EEW34130.1| thioredoxin [Mesorhizobium opportunistum WSM2075]
 gi|317171383|gb|ADV14921.1| thioredoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 106

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  K+K+ KL+I+
Sbjct: 1   MATVKVDIDNFQSEVLESAAPVVVDFWAEWCDPCKMIAPSLEEISVEMEGKIKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ +  + SIPTL +FK G+V D  + GA  ++ ++ WI
Sbjct: 61  ENPELAAQLGVRSIPTLAIFKGGEVADFSV-GAKPKTALLNWI 102


>gi|222529610|ref|YP_002573492.1| thioredoxin [Caldicellulosiruptor bescii DSM 6725]
 gi|312622172|ref|YP_004023785.1| thioredoxin [Caldicellulosiruptor kronotskyensis 2002]
 gi|222456457|gb|ACM60719.1| thioredoxin [Caldicellulosiruptor bescii DSM 6725]
 gi|312202639|gb|ADQ45966.1| thioredoxin [Caldicellulosiruptor kronotskyensis 2002]
          Length = 108

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 73/96 (76%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL++++  +I+ 
Sbjct: 10  SENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAY 69

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++I SIPT++LFK+G+ +D+++ GA  +SD + +I
Sbjct: 70  AFRIMSIPTIMLFKNGRAVDKII-GARPKSDFVNFI 104


>gi|95928472|ref|ZP_01311219.1| thioredoxin [Desulfuromonas acetoxidans DSM 684]
 gi|95135262|gb|EAT16914.1| thioredoxin [Desulfuromonas acetoxidans DSM 684]
          Length = 109

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 72/94 (76%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD+EVL+   PV+VDFWA+WC PC  ++P+ID++A++ + +VKI K++++E+     +Y
Sbjct: 13  NFDAEVLKADQPVLVDFWATWCAPCKAIAPVIDELANQFSGQVKIGKVNVDENPNTPGQY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFK+G+V+D+++ GA  ++ + E+I
Sbjct: 73  GVRGIPTLVLFKNGEVVDQLV-GAIPKNQLEEFI 105


>gi|157825127|ref|YP_001492847.1| thioredoxin [Rickettsia akari str. Hartford]
 gi|157799085|gb|ABV74339.1| Thioredoxin [Rickettsia akari str. Hartford]
          Length = 139

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/101 (48%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V   SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+
Sbjct: 36  ANNVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELKGKVKVLKMNIDEN 95

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             IS+ Y I SIPT++LFK+G+  D  + G   ++ +++WI
Sbjct: 96  PNISSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWI 135


>gi|307265225|ref|ZP_07546784.1| thioredoxin [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326390141|ref|ZP_08211702.1| thioredoxin [Thermoanaerobacter ethanolicus JW 200]
 gi|306919847|gb|EFN50062.1| thioredoxin [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325993789|gb|EGD52220.1| thioredoxin [Thermoanaerobacter ethanolicus JW 200]
          Length = 223

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 77/103 (74%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EV+    PV++DFWA WC PC  ++PIID++A E   K+K+ K++++
Sbjct: 1   MAELVITLENFEQEVVNSDVPVLIDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E +E++ +++I SIPT+ LFK+GK++D+++ GA  ++D +++I
Sbjct: 61  EENELAMKFRIMSIPTIGLFKNGKMVDKII-GARPKADFVKFI 102



 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 72/94 (76%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EV+    PV++DFWA WC PC  ++PIID++A E   K+K+ K++++E +E++ ++
Sbjct: 125 NFEEEVVNSDVPVLIDFWAEWCAPCRLVAPIIDELAKEYKGKIKVGKVNVDEENELAMQF 184

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I SIPT+ LFK+GK++D+++ GA  ++D +++I
Sbjct: 185 RIMSIPTIGLFKNGKMVDKII-GARPKADFVKFI 217


>gi|154250595|ref|YP_001411419.1| thioredoxin [Parvibaculum lavamentivorans DS-1]
 gi|154154545|gb|ABS61762.1| thioredoxin [Parvibaculum lavamentivorans DS-1]
          Length = 106

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV   SF+++VL+ + PV+VDFWA WC PC ++ P +++IA +   K+ I K++I+
Sbjct: 1   MATNKVTDASFEADVLDAAGPVLVDFWAEWCGPCKQIGPALEEIAKDYGGKLTIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+  + T+Y +  IPTL++FKDG+V    + GA  +  I+EWI
Sbjct: 61  ENPNVPTKYGVRGIPTLMIFKDGQVAATKV-GALPKGKIVEWI 102


>gi|317471979|ref|ZP_07931311.1| thioredoxin [Anaerostipes sp. 3_2_56FAA]
 gi|316900383|gb|EFV22365.1| thioredoxin [Anaerostipes sp. 3_2_56FAA]
          Length = 107

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS LK+   +F  EVL    PV++DFWA+WC PC  +SP++D+IA+EL   VKI K++++
Sbjct: 1   MSVLKITGANFVEEVLNAKEPVLIDFWAAWCGPCRMMSPVVDEIAEELHG-VKIGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E  E++ ++++ SIPTL++FK+GKV ++   GA  + +I++ +  +V
Sbjct: 60  EEQELAVKFRVMSIPTLLIFKNGKV-EKSFVGARDKKEIVDALKMQV 105


>gi|307942843|ref|ZP_07658188.1| thioredoxin [Roseibium sp. TrichSKD4]
 gi|307773639|gb|EFO32855.1| thioredoxin [Roseibium sp. TrichSKD4]
          Length = 106

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   +   SF+ +VL+ S PVVVDFWA WC PC  ++P +++I++ELA +VKI KL+I+
Sbjct: 1   MATNTITDASFEEDVLKSSEPVVVDFWAEWCGPCKMIAPALEEISEELAGQVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ + + +Y + SIP LI+FKDG+ + + + GA+ ++ + +WI S +
Sbjct: 61  ENQDAAMKYGVRSIPMLIMFKDGEPMAQQV-GAAPKNKLADWIKSSI 106


>gi|29655365|ref|NP_821057.1| thioredoxin [Coxiella burnetii RSA 493]
 gi|154707163|ref|YP_001425487.1| thioredoxin [Coxiella burnetii Dugway 5J108-111]
 gi|161829780|ref|YP_001597821.1| thioredoxin [Coxiella burnetii RSA 331]
 gi|212213530|ref|YP_002304466.1| thioredoxin [Coxiella burnetii CbuG_Q212]
 gi|29542637|gb|AAO91571.1| thioredoxin [Coxiella burnetii RSA 493]
 gi|154356449|gb|ABS77911.1| thioredoxin [Coxiella burnetii Dugway 5J108-111]
 gi|161761647|gb|ABX77289.1| thioredoxin [Coxiella burnetii RSA 331]
 gi|212011940|gb|ACJ19321.1| thioredoxin [Coxiella burnetii CbuG_Q212]
          Length = 112

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 74/95 (77%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F++EVL+   PV+VDFWA WC+PC  +SP++++IA E A +VK+ KL+++E+++  T+
Sbjct: 11  ENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLNVDENAQTPTK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y +  IP+L++F++G+V+DR + GA ++S +  ++
Sbjct: 71  YGVRGIPSLLIFREGEVVDRKV-GALNKSQLAAFL 104


>gi|196230444|ref|ZP_03129306.1| thioredoxin [Chthoniobacter flavus Ellin428]
 gi|196225374|gb|EDY19882.1| thioredoxin [Chthoniobacter flavus Ellin428]
          Length = 109

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 69/91 (75%), Gaps = 1/91 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD+EVL+   PV+VDFWA WC PCV+LSP+ID+IA   A   K+ K++++E+ +++ RY
Sbjct: 13  NFDTEVLKSDKPVLVDFWAPWCGPCVQLSPVIDEIATAKAGSAKVAKVNVDENQQVAARY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +I+SIP L+ FK+G+V  +++ G   +++I+
Sbjct: 73  RINSIPALLFFKNGEVQGQLV-GRQPKTEIV 102


>gi|169334899|ref|ZP_02862092.1| hypothetical protein ANASTE_01305 [Anaerofustis stercorihominis
          DSM 17244]
 gi|169257637|gb|EDS71603.1| hypothetical protein ANASTE_01305 [Anaerofustis stercorihominis
          DSM 17244]
          Length = 108

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 65/83 (78%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          +  ++F+SEV+    PV+VDFWA+WC PC  L+PIID+IA+E +DKVK+ K+D++ + E+
Sbjct: 9  ITNENFESEVVNSDKPVMVDFWANWCGPCKGLAPIIDEIANEYSDKVKVGKVDVDANGEL 68

Query: 66 STRYQISSIPTLILFKDGKVIDR 88
          S ++++ SIPT+I FK+G+ I R
Sbjct: 69 SMKFRVMSIPTVIFFKNGEQIAR 91


>gi|167037452|ref|YP_001665030.1| thioredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040114|ref|YP_001663099.1| thioredoxin [Thermoanaerobacter sp. X514]
 gi|256752941|ref|ZP_05493770.1| thioredoxin [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914199|ref|ZP_07131515.1| thioredoxin [Thermoanaerobacter sp. X561]
 gi|307724566|ref|YP_003904317.1| thioredoxin [Thermoanaerobacter sp. X513]
 gi|320115866|ref|YP_004186025.1| thioredoxin [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166854354|gb|ABY92763.1| thioredoxin [Thermoanaerobacter sp. X514]
 gi|166856286|gb|ABY94694.1| thioredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256748174|gb|EEU61249.1| thioredoxin [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889134|gb|EFK84280.1| thioredoxin [Thermoanaerobacter sp. X561]
 gi|307581627|gb|ADN55026.1| thioredoxin [Thermoanaerobacter sp. X513]
 gi|319928957|gb|ADV79642.1| thioredoxin [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 223

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EV+    PV++DFWA WC PC  ++PIID++A E   K+K+ K++++
Sbjct: 1   MAELVITLENFEQEVVNSDVPVLIDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E +E++ +++I SIPT+ LFK+GK++D+++ GA  ++D + +I
Sbjct: 61  EENELAMKFRIMSIPTIGLFKNGKMVDKII-GARPKADFVRFI 102



 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 72/94 (76%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EV+    PV++DFWA WC PC  ++PIID++A E   K+K+ K++++E +E++ ++
Sbjct: 125 NFEEEVVNSDVPVLIDFWAEWCAPCRLVAPIIDELAKEYKGKIKVGKVNVDEENELAMQF 184

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I SIPT+ LFK+GK++D+++ GA  ++D +++I
Sbjct: 185 RIMSIPTIGLFKNGKMVDKII-GARPKADFVKFI 217


>gi|326390465|ref|ZP_08212022.1| thioredoxin [Thermoanaerobacter ethanolicus JW 200]
 gi|325993433|gb|EGD51868.1| thioredoxin [Thermoanaerobacter ethanolicus JW 200]
          Length = 107

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 73/101 (72%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V  ++F  EV     PV+VDFWA WCRPC+ ++P++++ A+E ADK+K+ KLD++
Sbjct: 1   MKPVNVTDETFAEEVYNSDKPVLVDFWAKWCRPCLMMAPVLEEFAEEYADKIKVAKLDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E+  I+++Y+I SIPT+ +F +GK++D+++ G   +  ++E
Sbjct: 61  ENPVIASKYRIMSIPTMGVFVNGKMVDKVI-GFMPKEHLVE 100


>gi|83590509|ref|YP_430518.1| thioredoxin [Moorella thermoacetica ATCC 39073]
 gi|83573423|gb|ABC19975.1| thioredoxin [Moorella thermoacetica ATCC 39073]
          Length = 109

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (75%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F+ EVL  + PV+VDFWA+WC PC  ++PI+D++A E A KVK+ KL+++E  +I   Y
Sbjct: 13 NFEEEVLSATTPVLVDFWAAWCGPCRMIAPIVDELAQEYAGKVKVAKLNVDEYPKIPADY 72

Query: 70 QISSIPTLILFKDGKVIDR 88
           I SIPTLILFK+G+VI R
Sbjct: 73 GIMSIPTLILFKNGEVIAR 91


>gi|291279557|ref|YP_003496392.1| thioredoxin [Deferribacter desulfuricans SSM1]
 gi|290754259|dbj|BAI80636.1| thioredoxin [Deferribacter desulfuricans SSM1]
          Length = 105

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 64/88 (72%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL    ++F  EVLE   PV+VDFWA WC PC  L+P ID +A+EL  KVK+ K++++E+
Sbjct: 2  ALTFTEENFQKEVLESDIPVLVDFWAVWCGPCKMLAPTIDQLANELEGKVKVGKVNVDEN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
            ++ RY I SIPT+++FKDGKV+++ +
Sbjct: 62 QSLAARYGIMSIPTVMIFKDGKVVEQFI 89


>gi|153206904|ref|ZP_01945722.1| thioredoxin [Coxiella burnetii 'MSU Goat Q177']
 gi|212219584|ref|YP_002306371.1| thioredoxin [Coxiella burnetii CbuK_Q154]
 gi|120576977|gb|EAX33601.1| thioredoxin [Coxiella burnetii 'MSU Goat Q177']
 gi|212013846|gb|ACJ21226.1| thioredoxin [Coxiella burnetii CbuK_Q154]
          Length = 112

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 75/99 (75%), Gaps = 1/99 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F++EVL+   PV+VDFWA WC+PC  +SP++++IA E A +VK+ K +++E+++  T+
Sbjct: 11  ENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKFNVDENAQTPTK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           Y +  IP+L++F++G+V+DR + GA ++S +  ++  R+
Sbjct: 71  YGVRGIPSLLIFREGEVVDRKV-GALNKSQLAAFLDERL 108


>gi|289578238|ref|YP_003476865.1| thioredoxin [Thermoanaerobacter italicus Ab9]
 gi|297544518|ref|YP_003676820.1| thioredoxin [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289527951|gb|ADD02303.1| thioredoxin [Thermoanaerobacter italicus Ab9]
 gi|296842293|gb|ADH60809.1| thioredoxin [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 108

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F+ EV+    PV+VDFWA WC PC  ++PIID++A E   K+K+ K++++
Sbjct: 1   MAEVVITLENFEEEVVNSDVPVLVDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E +E++ +++I SIPT+ LFK+GK++D+++ GA  + D +++I
Sbjct: 61  EENELAMKFRIMSIPTIGLFKNGKMVDKII-GARPKGDFVKFI 102


>gi|317122076|ref|YP_004102079.1| thioredoxin [Thermaerobacter marianensis DSM 12885]
 gi|315592056|gb|ADU51352.1| thioredoxin [Thermaerobacter marianensis DSM 12885]
          Length = 109

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 64/87 (73%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L +    FD+EVL+   PV+VDFWA WC PC  ++PI+++IA E AD++K+TKL++++  
Sbjct: 6  LDLTADRFDTEVLQSDKPVLVDFWAPWCGPCRMIAPIVEEIAQEYADRLKVTKLNVDDHG 65

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
           I+ RY + SIPTLI+FK G+ + R++
Sbjct: 66 AIAGRYGVMSIPTLIVFKGGQPVTRIV 92


>gi|218961129|ref|YP_001740904.1| thioredoxin [Candidatus Cloacamonas acidaminovorans]
 gi|167729786|emb|CAO80698.1| thioredoxin [Candidatus Cloacamonas acidaminovorans]
          Length = 107

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 69/90 (76%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ L+V++ +F++EVL+ + PV+VDFWA WC PC  LSP ID IA+E   K+K+ K++++
Sbjct: 1  MAILEVNSANFETEVLKSTQPVLVDFWAPWCGPCKALSPTIDKIANETEGKIKVVKINVD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ +I+ +Y + SIPTL++F +G V D+++
Sbjct: 61 EAQDIAAKYSVMSIPTLLIFVNGVVSDQLI 90


>gi|258406028|ref|YP_003198770.1| thioredoxin [Desulfohalobium retbaense DSM 5692]
 gi|257798255|gb|ACV69192.1| thioredoxin [Desulfohalobium retbaense DSM 5692]
          Length = 106

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 71/97 (73%), Gaps = 1/97 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A +V   +F+SEVL+C  PV+VDFWA WC PC  ++P+I+++A E   +VKI K++++E+
Sbjct: 2  ANQVTDANFESEVLQCDLPVLVDFWAPWCGPCRAIAPVIEELAKEYTGRVKIMKMNVDEN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
               +Y I +IPTLILFK+G+V++++  GA S++ I
Sbjct: 62 PTSPNKYGIRAIPTLILFKNGEVVEQLT-GAVSKASI 97


>gi|167772271|ref|ZP_02444324.1| hypothetical protein ANACOL_03648 [Anaerotruncus colihominis DSM
           17241]
 gi|167665374|gb|EDS09504.1| hypothetical protein ANACOL_03648 [Anaerotruncus colihominis DSM
           17241]
          Length = 116

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 64/90 (71%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS       +F SEVL+ S P++VDFWA WC PC  L P+ID +ADEL+ K  + K++I+
Sbjct: 12  MSVKHFSNDTFQSEVLQGSGPILVDFWAPWCGPCKMLGPVIDGLADELSGKAVVGKVNID 71

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
           +  +++ +Y + +IPT+ILFKDG+ ++R++
Sbjct: 72  DEPDLAAKYGVVTIPTIILFKDGQEVNRLV 101


>gi|307717901|ref|YP_003873433.1| thioredoxin [Spirochaeta thermophila DSM 6192]
 gi|306531626|gb|ADN01160.1| thioredoxin [Spirochaeta thermophila DSM 6192]
          Length = 106

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 68/94 (72%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          +L V T  F+ EVL+   PV+VDFWA WC PC  +SPI+D++A+E A K+K+ K++++E 
Sbjct: 2  SLHVKTADFEKEVLQADIPVLVDFWAEWCMPCRMVSPILDELAEEYAGKLKVVKVNVDEE 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96
           ++++R+ I SIPT++LFK+G+V  + +  A  Q
Sbjct: 62 PDLASRFGIVSIPTILLFKNGQVAAQQIGAAPRQ 95


>gi|13474806|ref|NP_106376.1| thioredoxin [Mesorhizobium loti MAFF303099]
 gi|14025562|dbj|BAB52162.1| thioredoxin [Mesorhizobium loti MAFF303099]
          Length = 106

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  K+K+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAAPVVVDFWAEWCDPCKMIAPSLEEISVEMESKIKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ +  + SIP L +FK G+V D  + GA  ++ ++ WI
Sbjct: 61  ENPELAAQLGVRSIPALAIFKGGEVADFSV-GAKPKTALLNWI 102


>gi|307265829|ref|ZP_07547379.1| thioredoxin [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919104|gb|EFN49328.1| thioredoxin [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 107

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V  ++F  EV     PV+VDFWA WCRPC+ ++P++++ A+E ADK+K+ KLD++
Sbjct: 1   MKPVNVTDETFAEEVYSSDKPVLVDFWAKWCRPCLMMAPVLEEFAEEYADKMKVVKLDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I+++Y+I SIPT+ +F +GK++D+++ G   +  ++E +L 
Sbjct: 61  ENPVIASKYRIMSIPTMGVFVEGKMVDKVI-GFMPKERLVEKLLK 104


>gi|325679390|ref|ZP_08158975.1| thioredoxin [Ruminococcus albus 8]
 gi|324108987|gb|EGC03218.1| thioredoxin [Ruminococcus albus 8]
          Length = 103

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 1/83 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MS   V++ +F  EVLEC  PVVVDFWA WC PC+ LSPI+D+++ E  DKVK  KL+++
Sbjct: 1  MSVYVVNSSNFKQEVLECDKPVVVDFWAGWCGPCMALSPIVDELSAE-TDKVKFCKLNVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDG 83
          E+ +I+  Y I SIPTL+LFK G
Sbjct: 60 EARDIAMEYGIMSIPTLMLFKSG 82


>gi|317153534|ref|YP_004121582.1| thioredoxin [Desulfovibrio aespoeensis Aspo-2]
 gi|316943785|gb|ADU62836.1| thioredoxin [Desulfovibrio aespoeensis Aspo-2]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A ++   +FD EVL+   PV++DFWA WC PC  + P+ID++A E   +VKI K++++E+
Sbjct: 2   ANQITDGNFDQEVLQSDVPVLIDFWAPWCGPCRAMGPVIDELAVEYEGQVKIVKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           S    +Y I +IPTLILFK G+V+D+   GA S+S I E I  +
Sbjct: 62  SATPGKYGIRAIPTLILFKGGEVVDQST-GAVSKSSIKEMITKK 104


>gi|189502057|ref|YP_001957774.1| hypothetical protein Aasi_0649 [Candidatus Amoebophilus asiaticus
          5a2]
 gi|189497498|gb|ACE06045.1| hypothetical protein Aasi_0649 [Candidatus Amoebophilus asiaticus
          5a2]
          Length = 109

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 1/84 (1%)

Query: 11 FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
          FD + L+ SNPV+VDFWA WC PC  +SPIID++A E   K  I KL+I+E+S++ T+Y 
Sbjct: 14 FD-KALQSSNPVLVDFWAPWCGPCRMMSPIIDELAKEYEGKADIYKLNIDENSQVPTKYS 72

Query: 71 ISSIPTLILFKDGKVIDRMMPGAS 94
          I SIPT+I+FK+G+ ++R++ G S
Sbjct: 73 IRSIPTMIIFKNGQAVERIVGGLS 96


>gi|302036920|ref|YP_003797242.1| thioredoxin [Candidatus Nitrospira defluvii]
 gi|300604984|emb|CBK41317.1| Thioredoxin [Candidatus Nitrospira defluvii]
          Length = 115

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 71/101 (70%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           ALK    ++D +V++ S  V+VDFWA WC PC  ++PI+D++A E A KVK+ KL+ +E+
Sbjct: 5   ALKATDATWDEDVMKASELVMVDFWAVWCGPCQMVAPIVDELATEYAGKVKVRKLNTDEN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            EI+ RYQ+ SIPT++ FK+G+ ++R++ GA  +    E I
Sbjct: 65  PEIAGRYQVMSIPTILFFKNGQAVERLV-GARPKRQFKEII 104


>gi|220905793|ref|YP_002481104.1| thioredoxin [Cyanothece sp. PCC 7425]
 gi|219862404|gb|ACL42743.1| thioredoxin [Cyanothece sp. PCC 7425]
          Length = 107

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 72/100 (72%), Gaps = 2/100 (2%)

Query: 1  MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
          MSA+ +V   +F  EVLE   PV+VDFWA WC PC  ++P++D++A +   +VK+ KL+ 
Sbjct: 1  MSAVAQVTNATFRQEVLEDRLPVLVDFWAPWCGPCRMVAPVVDEVASQYEGQVKVVKLNT 60

Query: 60 EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +E  EI+++Y I SIPTLILFK+G+ +DR++ GA  ++ +
Sbjct: 61 DEHPEIASQYGIRSIPTLILFKEGQAVDRVV-GAVPKTTL 99


>gi|226322282|ref|ZP_03797800.1| hypothetical protein COPCOM_00042 [Coprococcus comes ATCC 27758]
 gi|225209312|gb|EEG91666.1| hypothetical protein COPCOM_00042 [Coprococcus comes ATCC 27758]
          Length = 102

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + + T++F+ EVL    PV+VDFWA+WC PC  + P++D++A E  D VK+ K++++
Sbjct: 1   MSVINLTTENFEEEVLNAKEPVLVDFWATWCGPCQTMGPVVDELAQEFTD-VKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   ++  Y++ SIPT ++FKDGKV +R + G   +S++ + I
Sbjct: 60  EQMALAREYKVMSIPTFLVFKDGKVAERTL-GVQEKSELEQLI 101


>gi|227834353|ref|YP_002836060.1| thioredoxin [Corynebacterium aurimucosum ATCC 700975]
 gi|262183085|ref|ZP_06042506.1| thioredoxin [Corynebacterium aurimucosum ATCC 700975]
 gi|227455369|gb|ACP34122.1| thioredoxin [Corynebacterium aurimucosum ATCC 700975]
          Length = 107

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 69/95 (72%), Gaps = 1/95 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V T SF ++V+E   PVVVDFWA WC PC KLSPI++++A+EL + V + K++++E   +
Sbjct: 7   VTTDSFRADVVEAGKPVVVDFWAEWCGPCKKLSPILEEVAEELGEDVSVVKVNVDEERTL 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
              +QI SIP++++FKDG+ +D  + G  S++DI+
Sbjct: 67  GAMFQIMSIPSVLIFKDGEKVDEFV-GLRSKADIV 100


>gi|145597089|ref|YP_001161386.1| thioredoxin [Salinispora tropica CNB-440]
 gi|145306426|gb|ABP57008.1| thioredoxin [Salinispora tropica CNB-440]
          Length = 107

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 73/106 (68%), Gaps = 2/106 (1%)

Query: 1   MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M A K V   SF +EVL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I
Sbjct: 1   MGATKSVTDASFTTEVLKSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMGDQVTIVKLNI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +++ E +  Y+I S+PTL +FKDGK +  +  GA  + ++++ I S
Sbjct: 61  DDNPETARTYRIMSVPTLTVFKDGKPVQSIA-GAKPKGELVKLIQS 105


>gi|87200012|ref|YP_497269.1| thioredoxin [Novosphingobium aromaticivorans DSM 12444]
 gi|87135693|gb|ABD26435.1| thioredoxin [Novosphingobium aromaticivorans DSM 12444]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    V   SF S+VL  S PV+VDFWA WC PC  ++P +++IA+EL DKV+I K+DI 
Sbjct: 1   MPTKAVTDASFASDVLGSSKPVLVDFWADWCGPCKMIAPALEEIAEELGDKVEIAKVDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+++ ++++ + SIP LILFKDG+ + + + GA+ +S +  W+ S
Sbjct: 61  ENTDTASKFGVQSIPLLILFKDGQPVAQKL-GAAPKSQLKGWLES 104


>gi|167757999|ref|ZP_02430126.1| hypothetical protein CLOSCI_00336 [Clostridium scindens ATCC 35704]
 gi|167664431|gb|EDS08561.1| hypothetical protein CLOSCI_00336 [Clostridium scindens ATCC 35704]
          Length = 109

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A  +  ++F+ EVL+   PV+VDFWA+WC PC  + PII+++A E+ D  KI K++++
Sbjct: 8   MAATHLTKETFNEEVLQAKEPVLVDFWATWCGPCQMVLPIIEELAGEVKD-AKICKVNVD 66

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++  Y++ SIPTL++F+DGK + R + GA S+++I+E +
Sbjct: 67  EQPELAKEYRVMSIPTLMVFRDGKPVKREV-GAKSKAEILEML 108


>gi|229829284|ref|ZP_04455353.1| hypothetical protein GCWU000342_01371 [Shuttleworthia satelles
          DSM 14600]
 gi|229792447|gb|EEP28561.1| hypothetical protein GCWU000342_01371 [Shuttleworthia satelles
          DSM 14600]
          Length = 103

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 64/88 (72%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MS LKV T +F+SEVL+   PV+VDFWASWC PC  L P+I +IA+E     ++ KL+++
Sbjct: 1  MSELKVTTANFESEVLKSDVPVMVDFWASWCGPCRMLGPVISEIAEESDGSYRVGKLNVD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ +Y + SIPT+I+FKDG+V  +
Sbjct: 61 EEMELAEKYNVMSIPTVIVFKDGQVYKK 88


>gi|222109736|ref|YP_002552000.1| thioredoxin [Acidovorax ebreus TPSY]
 gi|221729180|gb|ACM32000.1| thioredoxin [Acidovorax ebreus TPSY]
          Length = 145

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +D  SFD  V     PVVVDFWA WC PC +++P     A EL  +V++ KLD E   
Sbjct: 44  LALDAASFDRHVARSHLPVVVDFWAPWCGPCRQMAPAFAQAARELEPRVRLAKLDTEAHP 103

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            I+ RY I SIPT+ILF+ G+   R+  GA   +DI  W+ S
Sbjct: 104 AIAARYGIRSIPTMILFRGGQEAARIS-GALGAADIARWVQS 144


>gi|325971856|ref|YP_004248047.1| thioredoxin [Spirochaeta sp. Buddy]
 gi|324027094|gb|ADY13853.1| thioredoxin [Spirochaeta sp. Buddy]
          Length = 106

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (69%), Gaps = 1/99 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MS + V   +F+ EVL+   PV+VDFWA WC PC  ++P I  +A   ADK+K+ K++++
Sbjct: 1  MSEIIVTEANFEQEVLKADKPVLVDFWAPWCGPCKMIAPAIAQLAQAHADKLKVAKINVD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          E+  ++T Y ++SIPTL+LFK G+V+ + M GA+S S I
Sbjct: 61 EAGSLATMYSVNSIPTLMLFKGGEVVGQRM-GAASLSVI 98


>gi|317485233|ref|ZP_07944114.1| thioredoxin [Bilophila wadsworthia 3_1_6]
 gi|316923524|gb|EFV44729.1| thioredoxin [Bilophila wadsworthia 3_1_6]
          Length = 107

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 70/101 (69%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A +V+  +FD+ VL+   PV+VDFWA WC PC  + PIID++A+E   K+ + KL+++ES
Sbjct: 2   ATQVNDSNFDAVVLQSQLPVLVDFWAPWCGPCRAIGPIIDELANEYEGKLSVVKLNVDES 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
                +Y I +IPTLILFK+G+V++++  GA S+S I   I
Sbjct: 62  PSTPGKYGIRAIPTLILFKNGEVVEQVT-GAVSKSSIATMI 101


>gi|253582058|ref|ZP_04859282.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251836407|gb|EES64944.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 104

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++FD EVL+   PV+VDFWA WC PC  L PI++++  ELA  VKI K++I+
Sbjct: 1   MAILHITKENFDKEVLKSDVPVLVDFWADWCGPCKALGPILEEVESELAPGVKIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E  E++ ++++ SIPTL+LFK+G+ +++ + G  S+  +IE
Sbjct: 61  EQEELAAQFRVMSIPTLLLFKNGQPVEKSV-GLISKDQVIE 100


>gi|317050788|ref|YP_004111904.1| thioredoxin [Desulfurispirillum indicum S5]
 gi|316945872|gb|ADU65348.1| thioredoxin [Desulfurispirillum indicum S5]
          Length = 109

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 63/87 (72%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S L     SFDS+VL+ S PV+VD+WASWC PC  LSP ID +A+E   K K+ K++++E
Sbjct: 5  SVLNFTDASFDSDVLQSSTPVLVDYWASWCAPCRMLSPTIDALAEEFVGKAKVGKVNVDE 64

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDR 88
          + + S ++ + SIPT+++FK G+V+D+
Sbjct: 65 NPQTSQKFGVRSIPTIMIFKGGQVVDQ 91


>gi|255527388|ref|ZP_05394263.1| thioredoxin [Clostridium carboxidivorans P7]
 gi|296184616|ref|ZP_06853027.1| thioredoxin [Clostridium carboxidivorans P7]
 gi|255508922|gb|EET85287.1| thioredoxin [Clostridium carboxidivorans P7]
 gi|296050398|gb|EFG89821.1| thioredoxin [Clostridium carboxidivorans P7]
          Length = 105

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 63/80 (78%)

Query: 11 FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
          F   V E S PVV+DFWASWC PC  L+P+ID+I++EL DKV+  KL+++E+   S +Y+
Sbjct: 10 FSKAVQESSKPVVIDFWASWCGPCKMLAPVIDEISEELNDKVEFLKLNVDENPVTSNQYR 69

Query: 71 ISSIPTLILFKDGKVIDRMM 90
          ++SIPT+++FKDGKV+D ++
Sbjct: 70 VASIPTVMIFKDGKVVDTLV 89


>gi|163797154|ref|ZP_02191109.1| Thioredoxin [alpha proteobacterium BAL199]
 gi|159177670|gb|EDP62223.1| Thioredoxin [alpha proteobacterium BAL199]
          Length = 106

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   SFD +VL+   PVVVDFWA WC PC  ++P +++IA+EL DKV + K++I+
Sbjct: 1   MVTVPVSDGSFDDDVLKSEKPVVVDFWAEWCGPCKMIAPALEEIANELGDKVTVAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +    Y +  IPTL+LFKDG+V   M  GA  + D+  WI S +
Sbjct: 61  DNPKTPAAYGVRGIPTLMLFKDGQVA-AMKIGALPKGDLKAWIESSI 106


>gi|323705240|ref|ZP_08116815.1| thioredoxin [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535142|gb|EGB24918.1| thioredoxin [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 110

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   +FD+EV     PV+VDFWA+WC PC  ++P+++++A+E +DK+K+ KL+++
Sbjct: 1   MKPINVTDMNFDTEVYNSDKPVLVDFWAAWCGPCRMMAPVLEEVAEEYSDKIKVVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDR---MMPGASSQSDIIEWILSRV 107
           E+  I+++Y+I SIPTL +F++G+++D+    MP    +  +  +I ++V
Sbjct: 61  ENPLIASQYRIMSIPTLGVFQNGQLVDKVIGFMPKEQLEYRLARYIDAQV 110


>gi|30249037|ref|NP_841107.1| thioredoxin [Nitrosomonas europaea ATCC 19718]
 gi|30138654|emb|CAD84945.1| Thioredoxin [Nitrosomonas europaea ATCC 19718]
          Length = 108

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+SEVL+C  PV+VD+WA WC PC  ++P++D+IA E  D++KI KL+I+E+   
Sbjct: 8   VTDASFESEVLQCPVPVLVDYWAEWCGPCRMIAPLLDEIASEYGDRLKIAKLNIDENQST 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y I  IPTL++FK+G  I+    GA S+S +  ++ S +
Sbjct: 68  PQKYGIRGIPTLMIFKNGN-IEATKVGALSKSQLTAFVDSHL 108


>gi|326796183|ref|YP_004314003.1| thioredoxin [Marinomonas mediterranea MMB-1]
 gi|326546947|gb|ADZ92167.1| thioredoxin [Marinomonas mediterranea MMB-1]
          Length = 108

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +    F SEVLE   PV+VDFWA WC PC  ++PI+ D+ADE   KVK+ KL+++E++
Sbjct: 6   LNITDAQFQSEVLESDVPVIVDFWAPWCGPCKMIAPILADVADEFEGKVKVVKLNVDENT 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E + +Y +  IPTLI+ K G+V    + GA ++S +I+++ S
Sbjct: 66  ETAPKYNVRGIPTLIIVKGGEVAATKV-GAVTKSQLIDFVQS 106


>gi|323702212|ref|ZP_08113879.1| thioredoxin [Desulfotomaculum nigrificans DSM 574]
 gi|323532899|gb|EGB22771.1| thioredoxin [Desulfotomaculum nigrificans DSM 574]
          Length = 105

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 76/97 (78%), Gaps = 1/97 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A++++  +F++EVL+   PV+VDFWA+WC PC  ++PI++ ++ E A KVKI K++++E+
Sbjct: 2  AMELNAANFETEVLKADIPVLVDFWAAWCGPCRAIAPIVEQLSTEFAGKVKIGKVNVDEN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +++ ++ + SIPTLI FK+G+ +D+++ G +S++D+
Sbjct: 62 RDLAQQFGVMSIPTLIFFKNGEKVDQVI-GFTSKADL 97


>gi|302342569|ref|YP_003807098.1| thioredoxin [Desulfarculus baarsii DSM 2075]
 gi|301639182|gb|ADK84504.1| thioredoxin [Desulfarculus baarsii DSM 2075]
          Length = 108

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 73/100 (73%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF+ E+L+   P +VDFWASWC PC  ++P++++++++ A KVK+ KL+++E
Sbjct: 4   NVVQVTDDSFEQEILKSELPTLVDFWASWCGPCRAIAPVVEELSEDYAGKVKVAKLNVDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           S +   +Y I +IPTLI+FKDGK +D++  GA S++ I E
Sbjct: 64  SPKTPGQYGIRAIPTLIMFKDGKQVDQIT-GAVSKAHIEE 102


>gi|327399192|ref|YP_004340061.1| thioredoxin [Hippea maritima DSM 10411]
 gi|327181821|gb|AEA34002.1| thioredoxin [Hippea maritima DSM 10411]
          Length = 106

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++   +++ EVL    PV+VDFWA WC PC  ++P++ +IADE A K+K+ KL+ +
Sbjct: 1   MAEIQLTQANWEDEVLGSDIPVLVDFWAPWCGPCRMVAPVVAEIADEYAGKLKVGKLNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E  EI+ RY I SIPTL++FK+G+V D+++ GA  +  I+E
Sbjct: 61  EEPEIAVRYGIMSIPTLMIFKNGEVADQII-GAVPKEYIVE 100


>gi|323704143|ref|ZP_08115722.1| thioredoxin [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536209|gb|EGB25981.1| thioredoxin [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 106

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+   +F  EV+  + PV+VDFWA WC PC  +SPII+++A++   KVK+ K++++
Sbjct: 1   MAEVKITKDNFQEEVVNSNIPVLVDFWAEWCGPCRMVSPIIEELAEDYEGKVKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E +E++ +++I SIPT+ LFK GK++D+++ GA  +SD  ++I
Sbjct: 61  EENELAMQFRIMSIPTIGLFKGGKMVDKII-GARPKSDFEDFI 102


>gi|304316705|ref|YP_003851850.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778207|gb|ADL68766.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 106

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +   +F  EV+  + PV+VDFWA WC PC  +SPII+++A++   KVK+ K++++
Sbjct: 1   MAEVTITKNNFQEEVVNSNIPVLVDFWAEWCGPCRMVSPIIEELANDYEGKVKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +E++ +++I SIPT+ LFKDGK++D+++ GA  +SD  ++I
Sbjct: 61  DENELAVQFKIMSIPTIALFKDGKMVDKIV-GARPKSDFEDFI 102


>gi|67458394|ref|YP_246018.1| thioredoxin [Rickettsia felis URRWXCal2]
 gi|67003927|gb|AAY60853.1| Thioredoxin [Rickettsia felis URRWXCal2]
          Length = 153

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V   SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+
Sbjct: 50  ANNVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELKGKVKVLKMNIDEN 109

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             I + Y I SIPT++LFK+G+  D  + G   ++ +++WI
Sbjct: 110 PNIPSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWI 149


>gi|94265669|ref|ZP_01289409.1| Thioredoxin [delta proteobacterium MLMS-1]
 gi|93453796|gb|EAT04165.1| Thioredoxin [delta proteobacterium MLMS-1]
          Length = 109

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 63/86 (73%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          ++V    FDS+VL+ + PV+VDFWA WC PC  + P+++++ADE A K KI K++++++ 
Sbjct: 7  VQVSDADFDSQVLQSAEPVLVDFWAPWCGPCKAIGPVVEELADEYAGKAKIAKMNVDDNP 66

Query: 64 EISTRYQISSIPTLILFKDGKVIDRM 89
              +Y I +IPTLILFK G+V+D++
Sbjct: 67 ATPGKYGIRAIPTLILFKGGEVVDQV 92


>gi|77920658|ref|YP_358473.1| thioredoxin [Pelobacter carbinolicus DSM 2380]
 gi|77546741|gb|ABA90303.1| thioredoxin [Pelobacter carbinolicus DSM 2380]
          Length = 109

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 40/82 (48%), Positives = 63/82 (76%)

Query: 9  KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           SFD++VL+ S PV+VDFWASWC PC  ++P ID++A++   +VKI K++++E+    + 
Sbjct: 12 NSFDADVLKSSEPVLVDFWASWCGPCKAIAPAIDELAEQFDGQVKIGKINVDENPATPSN 71

Query: 69 YQISSIPTLILFKDGKVIDRMM 90
          Y +  IPTLILFKDG+V+D+++
Sbjct: 72 YGVRGIPTLILFKDGQVVDQVV 93


>gi|88861237|ref|ZP_01135869.1| thioredoxin 1, redox factor [Pseudoalteromonas tunicata D2]
 gi|88816718|gb|EAR26541.1| thioredoxin 1, redox factor [Pseudoalteromonas tunicata D2]
          Length = 108

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI+DD+A E AD+V + KL+I+++S    ++
Sbjct: 12  SFETDVLKADKPVLVDFWAEWCGPCKMIAPILDDVASEYADRVVVGKLNIDQNSATPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFKDG+V    + GA S++ +IE++ + +
Sbjct: 72  GIRGIPTLLLFKDGQVAATKV-GALSKTQLIEFLENNI 108


>gi|257437964|ref|ZP_05613719.1| thioredoxin [Faecalibacterium prausnitzii A2-165]
 gi|257199624|gb|EEU97908.1| thioredoxin [Faecalibacterium prausnitzii A2-165]
          Length = 130

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 77/100 (77%), Gaps = 2/100 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F++EVL  + PV++DFWA+WC PC  LSPI+D++A+E  D VK+ K++++
Sbjct: 6   MAVVTITKENFEAEVLHSTKPVLLDFWATWCGPCRMLSPIVDEVAEERTD-VKVGKVNVD 64

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E  E+++++ + SIPTL++F+DGK++++ + GA  ++ ++
Sbjct: 65  EQPELASQFGVMSIPTLLVFRDGKLVNQAV-GARPKAGVL 103


>gi|227549427|ref|ZP_03979476.1| thioredoxin [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078504|gb|EEI16467.1| thioredoxin [Corynebacterium lipophiloflavum DSM 44291]
          Length = 107

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   +F SEV++   PVVVDFWA WC PC KLSPI++ IA+E+  +VK+ K+D++ 
Sbjct: 3   TPIDVTQSTFKSEVVDSDIPVVVDFWAEWCGPCKKLSPILEQIAEEMDGQVKVAKVDVDT 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +   +Q+ SIPT+++FKDG  +D M+ GA  +++I+  I   +
Sbjct: 63  ERTLGAMFQVMSIPTVMIFKDGAAVDTMI-GAQPKNEIVSRIHQHI 107


>gi|37528481|ref|NP_931826.1| thioredoxin 1 (TRX1) (TRX) [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787919|emb|CAE17036.1| thioredoxin 1 (TRX1) (TRX) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 108

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL  + PV+VDFWA+WC PC  ++PI+D+IA E + K+ ITKL+I+++   + +Y
Sbjct: 12  SFDTDVLNAAGPVLVDFWAAWCGPCKMIAPILDEIAPEYSGKLTITKLNIDDNPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG+V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKDGQVAATKV-GALSKTQLKEFL 104


>gi|308051268|ref|YP_003914834.1| thioredoxin [Ferrimonas balearica DSM 9799]
 gi|307633458|gb|ADN77760.1| thioredoxin [Ferrimonas balearica DSM 9799]
          Length = 108

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 70/94 (74%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++P++D++A+E  D++ I KL+++++SE   +Y
Sbjct: 12  SFETDVLKADKPVLVDFWAEWCGPCKMIAPVLDELAEEYGDQLTIGKLNVDQNSETPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG++    + GA+S++ + E+I
Sbjct: 72  GIRGIPTLLLFKDGQLAGTKV-GAASKTQLKEFI 104


>gi|11498883|ref|NP_070112.1| thioredoxin (trx-3) [Archaeoglobus fulgidus DSM 4304]
 gi|2649295|gb|AAB89961.1| thioredoxin (trx-3) [Archaeoglobus fulgidus DSM 4304]
          Length = 134

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 72/102 (70%), Gaps = 2/102 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +K+++ +FD E L+ +  VVVDFWA WC PC  ++P+I+++A E A KV   KL+ +E
Sbjct: 31  SPVKLNSSNFD-ETLKNNENVVVDFWAEWCMPCKMIAPVIEELAKEYAGKVVFGKLNTDE 89

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  I+ RY IS+IPTLI FK GK +D+++ GA  +S++  W+
Sbjct: 90  NPTIAARYGISAIPTLIFFKKGKPVDQLV-GAMPKSELKRWV 130


>gi|124053398|sp|Q4UNK3|THIO_RICFE RecName: Full=Thioredoxin; Short=Trx
          Length = 105

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V   SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+
Sbjct: 2   ANNVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELKGKVKVLKMNIDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             I + Y I SIPT++LFK+G+  D  + G   ++ +++WI
Sbjct: 62  PNIPSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWI 101


>gi|288932581|ref|YP_003436641.1| thioredoxin [Ferroglobus placidus DSM 10642]
 gi|288894829|gb|ADC66366.1| thioredoxin [Ferroglobus placidus DSM 10642]
          Length = 139

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 70/100 (70%), Gaps = 2/100 (2%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++V++ +FD E+L+    VVVDFWA WC PC  ++PII+ +A E A KV   KL+ +E+ 
Sbjct: 38  IEVNSSNFD-EILKKYENVVVDFWAEWCMPCRMIAPIIEQLAKEYAGKVVFAKLNTDENP 96

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I+ RY I+ IPTLI FK+GK +D+++ GA  + +I  WI
Sbjct: 97  QIAARYGITGIPTLIFFKNGKPVDKII-GAYPKGEIERWI 135


>gi|157803191|ref|YP_001491740.1| thioredoxin [Rickettsia canadensis str. McKiel]
 gi|157784454|gb|ABV72955.1| Thioredoxin [Rickettsia canadensis str. McKiel]
          Length = 105

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V+  SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+
Sbjct: 2   ASNVNDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               + Y I SIPT++LFK+G+  D  + G   +S +++WI
Sbjct: 62  PNTPSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKSYLLDWI 101


>gi|159040578|ref|YP_001539831.1| thioredoxin [Salinispora arenicola CNS-205]
 gi|157919413|gb|ABW00841.1| thioredoxin [Salinispora arenicola CNS-205]
          Length = 107

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A  V   SF ++VL+   PV+VDFWA WC PC K+SP++++IA E+AD+V I KL+I+E
Sbjct: 3   TAKSVTDASFTTDVLKSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMADQVTIVKLNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + E +  Y++ S+PTL +FK+G+ +  +  GA  + ++I+ I S
Sbjct: 63  NPETARNYRVMSVPTLTVFKNGEPVQSIA-GAKPKGELIKLIQS 105


>gi|121592934|ref|YP_984830.1| thioredoxin [Acidovorax sp. JS42]
 gi|120605014|gb|ABM40754.1| thioredoxin [Acidovorax sp. JS42]
          Length = 145

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +D  SFD  V     PVVVDFWA WC PC +++P     A EL  ++++ KLD E   
Sbjct: 44  LALDAASFDRHVARSHLPVVVDFWAPWCGPCRQMAPAFAQAARELEPRMRLAKLDTEAHP 103

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            I+ RY I SIPT+ILF+ G+   R+  GA   +DI  W+ S
Sbjct: 104 AIAARYGIRSIPTMILFRGGQEAARIS-GALGAADIARWVQS 144


>gi|255281235|ref|ZP_05345790.1| thioredoxin [Bryantella formatexigens DSM 14469]
 gi|255268192|gb|EET61397.1| thioredoxin [Bryantella formatexigens DSM 14469]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 74/100 (74%), Gaps = 2/100 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+AL +   +F  EVLE   PV+VDFWASWC PC  + PI++++++E  D +K+ K++++
Sbjct: 1   MAALHITKDNFQKEVLESDKPVLVDFWASWCGPCRMVGPIVEEVSEERPD-IKVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E  E+++ YQ+ SIPTL++ K+G++++R + GA  ++DI+
Sbjct: 60  EEQELASAYQVMSIPTLMVVKNGEIVNRSV-GAKPKADIL 98


>gi|238897337|ref|YP_002923014.1| thioredoxin 1, redox factor [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465092|gb|ACQ66866.1| thioredoxin 1, redox factor [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 108

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++  KSFD +VL+    ++VDFWA WC PC  ++PI+D+IA+E  DK+ ITKL+I+ + 
Sbjct: 6   IQLSDKSFDRDVLKADGLILVDFWAQWCGPCKMIAPILDEIANEYVDKITITKLEIDTNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             + +Y I SIPTL+LFK+GK ID  + GA S+ ++ +++   V
Sbjct: 66  NTTQKYGIRSIPTLLLFKEGKPIDTKV-GAVSKHELKKFLDKHV 108


>gi|169831084|ref|YP_001717066.1| thioredoxin [Candidatus Desulforudis audaxviator MP104C]
 gi|169637928|gb|ACA59434.1| thioredoxin [Candidatus Desulforudis audaxviator MP104C]
          Length = 107

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++++ K+F++EV     PVVVDFWA WC PC  ++P+I  +A E A +VK+ K++++++ 
Sbjct: 3   VEINEKTFENEVTRSDQPVVVDFWAEWCGPCRSMAPVIQQVAAEFAGRVKVGKVNVDQNQ 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++ R+ I  IPTL+ F+DG+V+D+ + G + +  ++E I
Sbjct: 63  ALTARFGIKGIPTLLFFRDGQVVDQEV-GFTPRGVVVEKI 101


>gi|288940347|ref|YP_003442587.1| thioredoxin [Allochromatium vinosum DSM 180]
 gi|288895719|gb|ADC61555.1| thioredoxin [Allochromatium vinosum DSM 180]
          Length = 108

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + V   SF+ EVL+  +PV+VD+WA WC PC  ++P++D+IADE A +VKI KL+I+E
Sbjct: 4   SIVHVTDDSFEEEVLKSPDPVLVDYWADWCGPCKMIAPVLDEIADEYAGRVKIAKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     RY I  IPTL+LF+ G+V +    GA S+S +  +I S +
Sbjct: 64  NPNTPPRYGIRGIPTLMLFRGGEV-EATKVGAVSKSQLTAFIDSNL 108


>gi|257785118|ref|YP_003180335.1| thioredoxin [Atopobium parvulum DSM 20469]
 gi|257473625|gb|ACV51744.1| thioredoxin [Atopobium parvulum DSM 20469]
          Length = 105

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 72/98 (73%), Gaps = 1/98 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A ++ T  FDS +     PV+VDFWASWC PC  L P+++++ +E+ADK+ + K+++++ 
Sbjct: 2   AQQLTTAEFDSVLANADKPVLVDFWASWCGPCRALGPVVEEVGNEMADKLDVYKVNVDDE 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           ++++TR++I SIPTLILFK+G+ +  M+ G   ++D++
Sbjct: 62  ADLATRFRIVSIPTLILFKNGEPVHTMV-GNLPKADLV 98


>gi|329113819|ref|ZP_08242590.1| Thioredoxin [Acetobacter pomorum DM001]
 gi|326696829|gb|EGE48499.1| Thioredoxin [Acetobacter pomorum DM001]
          Length = 117

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SFD +VL+ S  V+VDFWA WC PC  + P +++I  ELA KV + K++I+++ 
Sbjct: 15  LAVSDSSFDKDVLKASGLVLVDFWAEWCGPCKMIGPALEEIGKELAGKVTVAKVNIDDNP 74

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E    YQ+ SIPTL+L +DGKV+D+ + GA  +S +  W+
Sbjct: 75  ETPNAYQVRSIPTLMLVRDGKVVDKKV-GALPKSQLKAWV 113


>gi|78357110|ref|YP_388559.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78219515|gb|ABB38864.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 107

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A++V   +F++EV++   P ++DFWA WC PC  + P+ID++A E A KV I K++++E+
Sbjct: 2   AVQVTDSNFEAEVIKSELPTLIDFWAPWCGPCRAMGPVIDELAAEFAGKVNIVKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               ++Y I +IPTLILFK G+V++++  GA S+S I + I  +
Sbjct: 62  PATPSKYGIRAIPTLILFKGGEVVEQIT-GAVSKSSIKDMITQK 104


>gi|189485014|ref|YP_001955955.1| thioredoxin [uncultured Termite group 1 bacterium phylotype
          Rs-D17]
 gi|170286973|dbj|BAG13494.1| thioredoxin [uncultured Termite group 1 bacterium phylotype
          Rs-D17]
          Length = 110

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 1/97 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A++++  +F  EVL    PV+VDFWA WC PC  LSPII+++A E  D VK+ K++ +E+
Sbjct: 2  AVEINKNNFAQEVLSSDKPVLVDFWAPWCNPCKMLSPIIEELAAEYEDSVKVGKVNTDEN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            +S ++QI SIP LILFK+GK + + + G  S++DI
Sbjct: 62 MSLSAKFQIVSIPCLILFKNGKTLHKTV-GFRSKNDI 97


>gi|323697684|ref|ZP_08109596.1| thioredoxin [Desulfovibrio sp. ND132]
 gi|323457616|gb|EGB13481.1| thioredoxin [Desulfovibrio desulfuricans ND132]
          Length = 106

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A ++   +F+ +VL+   PV++DFWA WC PC  + P+ID++A+E   +VKI K++++E+
Sbjct: 2   ANQITDGTFEQDVLQSDIPVLIDFWAPWCGPCRAMGPVIDELAEEFDGQVKIVKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           S    +Y I +IPTLILFK G+V+D+   GA S+S I E I  +
Sbjct: 62  SATPGKYGIRAIPTLILFKGGEVLDQST-GAVSKSSIKEMITKK 104


>gi|148241837|ref|YP_001226994.1| thioredoxin [Synechococcus sp. RCC307]
 gi|147850147|emb|CAK27641.1| Thioredoxin [Synechococcus sp. RCC307]
          Length = 107

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 64/89 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SFD +VL+C  PV+VDFWA WC PC  ++PI+D+IA E   ++K+ KL+ +E
Sbjct: 3  SAAAVTDASFDQDVLQCDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFEGRIKVVKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMVFKGGQKVDTVV 91


>gi|78484472|ref|YP_390397.1| thioredoxin [Thiomicrospira crunogena XCL-2]
 gi|78362758|gb|ABB40723.1| thioredoxin [Thiomicrospira crunogena XCL-2]
          Length = 108

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FDSEVL+   PV+VDFWA WC PC  ++PI+D++A E A K+K+ KL+I+E+     +Y
Sbjct: 12  NFDSEVLQSDVPVLVDFWAEWCGPCKMIAPILDEVAGEYAGKIKVAKLNIDENPATPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFK+G+V D    GA S+S +  ++
Sbjct: 72  GVRGIPTLVLFKNGEV-DATQVGALSKSQLCAFL 104


>gi|90408658|ref|ZP_01216810.1| putative thioredoxin [Psychromonas sp. CNPT3]
 gi|90310234|gb|EAS38367.1| putative thioredoxin [Psychromonas sp. CNPT3]
          Length = 108

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++V+  + PV+VDFWA WC PC  ++P++ +IA E A KV + KL+I+E+S    ++
Sbjct: 12  SFDADVINAAGPVLVDFWAEWCGPCKMIAPLLSEIATEYAGKVTVGKLNIDENSATPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDGKV    + GA S++ ++E++
Sbjct: 72  GIRGIPTLLLFKDGKVAATKV-GALSKTQLVEFL 104


>gi|315497133|ref|YP_004085937.1| thioredoxin [Asticcacaulis excentricus CB 48]
 gi|315415145|gb|ADU11786.1| thioredoxin [Asticcacaulis excentricus CB 48]
          Length = 110

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 74/102 (72%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV  ++F+++VL+   PV+VDFWA WC PC +++PI+D++A+   DK+ ++K++I++
Sbjct: 4   ATVKVTDETFENDVLKSDKPVLVDFWAEWCGPCKQIAPILDEVAEAYGDKLTVSKINIDD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           S    +++ +  IPT++LFKDGK+   M  GA  +S ++EW+
Sbjct: 64  SPLTPSKFGVRGIPTMMLFKDGKMT-SMKVGAMPKSKLVEWL 104


>gi|121534396|ref|ZP_01666219.1| thioredoxin [Thermosinus carboxydivorans Nor1]
 gi|121306889|gb|EAX47808.1| thioredoxin [Thermosinus carboxydivorans Nor1]
          Length = 107

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 69/96 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          + + V+  +F  EVL+ S PV+VDFWA WC  C KLSP+ D++A+E+ DKVK+ K++++E
Sbjct: 3  NVVNVNETNFQEEVLDSSKPVLVDFWAPWCGFCTKLSPVFDELANEMGDKVKLVKVNVDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          +  ++ +Y + S+PT+ILFK+G+  ++++     Q+
Sbjct: 63 NRSLAQKYGVMSLPTMILFKNGEPGEKLIGFMPKQA 98


>gi|310830075|ref|YP_003962432.1| hypothetical protein ELI_4535 [Eubacterium limosum KIST612]
 gi|308741809|gb|ADO39469.1| hypothetical protein ELI_4535 [Eubacterium limosum KIST612]
          Length = 107

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 74/97 (76%), Gaps = 1/97 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A KV++  F SEVL+    V+VDF+A+WC PC  L+PI+D +++E++ KVKI K+DI+E+
Sbjct: 2  AKKVNSSEFKSEVLDHKGVVLVDFFATWCGPCKALTPIVDKLSEEMSGKVKIVKVDIDEN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          S ++T Y++ S+PT+ LFK+G+V++ ++ G   +S++
Sbjct: 62 SALATEYRVMSVPTMKLFKNGEVVETLV-GLRPESEL 97


>gi|114332429|ref|YP_748651.1| thioredoxin [Nitrosomonas eutropha C91]
 gi|114309443|gb|ABI60686.1| thioredoxin [Nitrosomonas eutropha C91]
          Length = 108

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F++EVL+C  PV+VD+WA WC PC  ++PI+D+IA+E   ++K+ KL+I+E+   
Sbjct: 8   VTDATFEAEVLQCPLPVLVDYWAEWCGPCRMIAPILDEIANEYNGRLKVAKLNIDENQST 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             +Y I  IPTL+LFK+G  I+    GA S+S +I ++
Sbjct: 68  PQKYGIRGIPTLMLFKNGN-IEATKVGALSKSQLIAFV 104


>gi|89895175|ref|YP_518662.1| hypothetical protein DSY2429 [Desulfitobacterium hafniense Y51]
 gi|89334623|dbj|BAE84218.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 109

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 71/96 (73%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T +++ EVL     V+VDFWA+WC PC  ++PII+++ADE+A KV I KL+++E   I+ 
Sbjct: 11  TANWNEEVLGSDKAVLVDFWAAWCGPCRMVAPIIEELADEMAGKVIIGKLNVDEEPAIAG 70

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +YQ+ SIPTL +FK+G+V+D+ + G   ++D+++ I
Sbjct: 71  QYQVMSIPTLAVFKNGQVVDKSV-GFRGKADLVKMI 105


>gi|221632106|ref|YP_002521327.1| thioredoxin [Thermomicrobium roseum DSM 5159]
 gi|221156598|gb|ACM05725.1| thioredoxin [Thermomicrobium roseum DSM 5159]
          Length = 107

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V  ++F+ EV++   PV+VDFWA WC PC  ++PI+++IA+E A K+K+ K++++E+ ++
Sbjct: 7   VSDETFEREVVQSPVPVLVDFWAPWCGPCRMIAPILEEIAEEKAGKLKVAKINVDENMQV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + ++ ISSIPTLIL+K GK ++R++ GA  +  +++ I
Sbjct: 67  AMQHGISSIPTLILYKGGKPVERII-GAMPKQRLLQQI 103


>gi|254503055|ref|ZP_05115206.1| thioredoxin [Labrenzia alexandrii DFL-11]
 gi|222439126|gb|EEE45805.1| thioredoxin [Labrenzia alexandrii DFL-11]
          Length = 106

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   SF+++VL    PVVVDFWA WC PC  ++P +++I++E+  +VKITKL+I+
Sbjct: 1   MATTQVTDASFEADVLNSDEPVVVDFWAEWCGPCKMIAPALEEISEEMNGQVKITKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++ +Y + SIP LILFK G+ +   + GA+ +  + +WI S +
Sbjct: 61  ENQDMAMKYGVRSIPMLILFKGGEPMATQV-GAAPKGKLSDWIKSAL 106


>gi|193215618|ref|YP_001996817.1| thioredoxin [Chloroherpeton thalassium ATCC 35110]
 gi|193089095|gb|ACF14370.1| thioredoxin [Chloroherpeton thalassium ATCC 35110]
          Length = 108

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 67/91 (73%), Gaps = 1/91 (1%)

Query: 1  MSALKVDT-KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
          MS   V T ++F SEVL+   PV+VDFWA WC PC  ++P+I+++A E   K KI KL++
Sbjct: 1  MSKYLVATDQNFQSEVLQSDVPVLVDFWAVWCGPCRMIAPVIEELASEYEGKAKIAKLNV 60

Query: 60 EESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +E+ +IS  Y I SIPTL++FK+G+V+D+++
Sbjct: 61 DENPQISMAYGIRSIPTLLIFKNGEVVDQLV 91


>gi|85708413|ref|ZP_01039479.1| hypothetical protein NAP1_04220 [Erythrobacter sp. NAP1]
 gi|85689947|gb|EAQ29950.1| hypothetical protein NAP1_04220 [Erythrobacter sp. NAP1]
          Length = 118

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  +SF S+VLE   PV+VDFWA WC PC  ++P +++I++EL ++V I K+DI 
Sbjct: 13  MATVNVTDESFKSDVLESDKPVLVDFWADWCGPCKMIAPALEEISNELGEQVTIAKMDIM 72

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++ I     + SIP ++LFK+G+ + R + GA+ +S + +W+ S +
Sbjct: 73  ENTGIPAEMGVQSIPLMVLFKNGEAVARKV-GAAPKSQLKDWLESEI 118


>gi|291561756|emb|CBL40555.1| thioredoxin [butyrate-producing bacterium SS3/4]
          Length = 105

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 62/81 (76%)

Query: 8  TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
          + +FD++VL    PVVVDF+A+WC PC  ++P I ++A E A KVKI KLD++E+S+I+ 
Sbjct: 7  SANFDADVLGSEIPVVVDFFATWCGPCRMMAPAIAELAGEYAGKVKIGKLDVDENSDIAV 66

Query: 68 RYQISSIPTLILFKDGKVIDR 88
          RY + SIPT+ILFKDG++  +
Sbjct: 67 RYGVMSIPTIILFKDGEIFSK 87


>gi|242237661|ref|YP_002985842.1| thioredoxin [Dickeya dadantii Ech703]
 gi|242129718|gb|ACS84020.1| thioredoxin [Dickeya dadantii Ech703]
          Length = 108

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD+EVL+   P +VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+E+   + +Y
Sbjct: 12  SFDAEVLQAEGPTLVDFWAEWCGPCKMIAPILDEIADEFEGKLTVAKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G++    + GA S+  + E+I
Sbjct: 72  GIRGIPTLLLFKNGELAATKV-GALSKGQLKEFI 104


>gi|225871920|ref|YP_002753374.1| thioredoxin [Acidobacterium capsulatum ATCC 51196]
 gi|225791288|gb|ACO31378.1| thioredoxin [Acidobacterium capsulatum ATCC 51196]
          Length = 110

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 69/106 (65%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
             ++V+  +F+ EVL+   PV+VDFWA WC PC  L+P +D++A + A K+K+ K+D++ 
Sbjct: 5   GVIEVNDATFEQEVLQSEQPVLVDFWAGWCGPCKALAPTVDEVAAQYAGKLKVAKMDVDR 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++    RY I  IP L++FK GKV D+++       D+I+  L++V
Sbjct: 65  NASTPMRYGIRGIPALLIFKGGKVADQIV--GYVPKDVIDRSLTKV 108


>gi|306834788|ref|ZP_07467852.1| thioredoxin [Corynebacterium accolens ATCC 49726]
 gi|304569316|gb|EFM44817.1| thioredoxin [Corynebacterium accolens ATCC 49726]
          Length = 107

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 68/96 (70%), Gaps = 1/96 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           KV T++F S+V+E   PVVVDFWA WC PC KLSPI++++ADEL  +V I +++++E   
Sbjct: 6   KVTTETFRSDVIEADKPVVVDFWAEWCGPCKKLSPILEEVADELDGEVTIAQVNVDEERN 65

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +   +QI SIP +++F +G+ +D  + G  S+ DI+
Sbjct: 66  LGAMFQIMSIPNVLIFNNGEKVDEFV-GLRSKDDIV 100


>gi|157827864|ref|YP_001494106.1| thioredoxin [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932551|ref|YP_001649340.1| thioredoxin [Rickettsia rickettsii str. Iowa]
 gi|157800345|gb|ABV75598.1| Thioredoxin [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907638|gb|ABY71934.1| thioredoxin [Rickettsia rickettsii str. Iowa]
          Length = 105

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 67/101 (66%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V   SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+
Sbjct: 2   ANNVKDNSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               + Y I SIPT++LFK+G+  D  + G   ++ +++WI
Sbjct: 62  PNTPSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWI 101


>gi|56478118|ref|YP_159707.1| thioredoxin [Aromatoleum aromaticum EbN1]
 gi|56314161|emb|CAI08806.1| Thioredoxin [Aromatoleum aromaticum EbN1]
          Length = 108

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F++EVL+   PV+VD+WA WC PC  ++PI+DD+A E A K+K+ KL+I+E+ E 
Sbjct: 8   VTDGNFEAEVLQSQTPVLVDYWAEWCGPCKMIAPILDDVAKEYAGKLKVAKLNIDENQET 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ +  IPTL+LFK G V +    GA S+S +  +I S +
Sbjct: 68  PAKFGVRGIPTLMLFKGGNV-EATKVGALSKSQLTAFIDSNL 108


>gi|94986811|ref|YP_594744.1| Thiol-disulfide isomerase and thioredoxins [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731060|emb|CAJ54423.1| Thiol-disulfide isomerase and thioredoxins [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 107

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 72/100 (72%), Gaps = 2/100 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A   DT +FD+ VL+ + PV+VDFWA WC PC  + PIID+IA E A  + + KL+++
Sbjct: 1   MAAQVTDT-NFDTIVLKSNKPVLVDFWAPWCGPCRAIGPIIDEIALEYASDIHVVKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E++    +Y I +IPTLILFK+G+V++++  GA S++ II
Sbjct: 60  ENTITPGQYGIKAIPTLILFKNGEVVEQLT-GAVSKTSII 98


>gi|295102891|emb|CBL00436.1| thioredoxin [Faecalibacterium prausnitzii L2-6]
          Length = 102

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F++EVL+ + PV++DFWA+WC PC  LSP++D++A+E  D VK+ K++++
Sbjct: 1   MAVITITKENFETEVLKSAQPVLLDFWAAWCGPCRMLSPVVDEVAEERTD-VKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++  + + SIP L+LF++GK++ R   GA  +S ++E +
Sbjct: 60  EQPELAAEFGVMSIPALLLFENGKLV-RQAVGARPKSGVLELL 101


>gi|78224421|ref|YP_386168.1| thioredoxin [Geobacter metallireducens GS-15]
 gi|78195676|gb|ABB33443.1| Thioredoxin [Geobacter metallireducens GS-15]
          Length = 109

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 68/90 (75%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD++VL+ + PV+VDFWA+WC PC  ++P+ID IADE   KVK+ K++++++     +Y
Sbjct: 13  NFDTDVLKATVPVLVDFWATWCAPCKAIAPVIDAIADEYDGKVKVGKVNVDDNPGTPGKY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            +  IPT+ILFKDGKV+D+++ GA  ++ +
Sbjct: 73  GVRGIPTVILFKDGKVVDQVV-GAVPKAQL 101


>gi|114705060|ref|ZP_01437968.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2
           [Fulvimarina pelagi HTCC2506]
 gi|114539845|gb|EAU42965.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2
           [Fulvimarina pelagi HTCC2506]
          Length = 105

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 74/103 (71%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   +F ++VL  S PVVVDFWA WC PC  ++P +++I++E ++ V+I K++I+
Sbjct: 1   MATKTVTKDTFQNDVLGASKPVVVDFWAEWCGPCKMIAPSLEEISEENSN-VEIAKVNID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ I SIPTL++FKDG+ +D +M GA S+S +  WI
Sbjct: 60  ENQELAVQFGIRSIPTLMMFKDGQHVDTLM-GAQSKSKLASWI 101


>gi|315187503|gb|EFU21259.1| thioredoxin [Spirochaeta thermophila DSM 6578]
          Length = 106

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 67/94 (71%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          +L V    F+ EVL+   PV+VDFWA WC PC  +SPI+D++A+E A K+K+ K++++E 
Sbjct: 2  SLHVKAADFEKEVLKADIPVLVDFWAEWCMPCRMVSPILDELAEEYAGKLKVVKVNVDEE 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96
           ++++R+ I SIPT++LFK+G+V  + +  A  Q
Sbjct: 62 PDLASRFGIVSIPTILLFKNGQVAAQQIGAAPRQ 95


>gi|115378206|ref|ZP_01465378.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|310820646|ref|YP_003953004.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|115364794|gb|EAU63857.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|309393718|gb|ADO71177.1| Thioredoxin [Stigmatella aurantiaca DW4/3-1]
          Length = 110

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 63/98 (64%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +    F  EVL+   PV+VDFWA+WC PC  ++PI+D +A E   +VK+ K+D++ + 
Sbjct: 7   LNIGDGDFTKEVLQSDTPVLVDFWATWCGPCRTIAPIVDALATEYKGRVKVAKIDVDANQ 66

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +   +Y I SIPTL++FK GKV+D ++     +S I E
Sbjct: 67  DTPQQYGIRSIPTLLVFKGGKVVDTIIGAGGGKSKIEE 104


>gi|237653741|ref|YP_002890055.1| thioredoxin [Thauera sp. MZ1T]
 gi|237624988|gb|ACR01678.1| thioredoxin [Thauera sp. MZ1T]
          Length = 108

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +FD EVL+   PV+VD+WA WC PC  ++PI+DD+A + A K+K+ KL+I+++ E
Sbjct: 7   HVTDGNFDDEVLQSQTPVLVDYWAEWCGPCKMIAPILDDVAKDYAGKLKVAKLNIDDNQE 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +Y I  IPTL+LFK G V +    GA S+S +  +I S +
Sbjct: 67  TPAKYGIRGIPTLMLFKGGNV-EATKVGALSKSQLTAFIDSNI 108


>gi|251773430|gb|EES53979.1| thioredoxin [Leptospirillum ferrodiazotrophum]
          Length = 110

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           ++ T  +D +VLE    V+VDFWA WC PC  ++P++D++A+E   +V   KL+ +++ E
Sbjct: 7   EITTAEWDKKVLESKGLVMVDFWAPWCGPCRMVAPVVDELAEEYKGRVSFMKLNTDDNQE 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQS--DIIEWILS 105
           I+ RYQ+  IPTLI FKDGK++ +++   S ++  D IE IL+
Sbjct: 67  IAVRYQVMGIPTLIFFKDGKIVSKLVGAQSKKTFKDKIEEILA 109


>gi|39998370|ref|NP_954321.1| thioredoxin [Geobacter sulfurreducens PCA]
 gi|39985316|gb|AAR36671.1| thioredoxin [Geobacter sulfurreducens PCA]
 gi|307635165|gb|ADI86033.2| thioredoxin [Geobacter sulfurreducens KN400]
          Length = 109

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 42/90 (46%), Positives = 67/90 (74%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FDSEVL+   PV+VDFWA+WC PC  ++P+ID IADE   KVK+ K++++++     +Y
Sbjct: 13  TFDSEVLKSPVPVLVDFWATWCAPCKAIAPVIDAIADEFDGKVKVGKVNVDDNPGTPGKY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            +  IPT+ILFK+GKV+D+++ GA  ++ +
Sbjct: 73  GVRGIPTVILFKEGKVVDQVV-GAVPKAQL 101


>gi|149927013|ref|ZP_01915271.1| thioredoxin [Limnobacter sp. MED105]
 gi|149824234|gb|EDM83454.1| thioredoxin [Limnobacter sp. MED105]
          Length = 109

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SFDS+VL+   PV+VD+WA WC PC  ++PI+DD++ E   K++I K++++E++E
Sbjct: 8   HVSDASFDSDVLKTDGPVLVDYWAEWCGPCKMIAPILDDLSSEYNGKLQIAKMNVDENAE 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +Y I  IPTL+LFK+G V+   + GA S+S +  +I S +
Sbjct: 68  TPAKYGIRGIPTLMLFKNGAVVATKV-GALSKSQLAAFIDSHL 109


>gi|313115930|ref|ZP_07801357.1| thioredoxin [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310621694|gb|EFQ05222.1| thioredoxin [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 106

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 71/99 (71%), Gaps = 1/99 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ LK+   +F++E+L    PV++DF+A WC PC  LSP++ ++A+E +  +K+ K++++
Sbjct: 1  MAELKITAANFENEILHSDKPVLLDFYADWCGPCKMLSPVLHELAEEKSGTLKVGKVNVD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          E  E++ R+Q+SSIP L++FKDGK I + + G   +S+I
Sbjct: 61 EQMELAMRFQVSSIPMLVVFKDGKAITKSV-GYRPKSEI 98


>gi|328947707|ref|YP_004365044.1| thioredoxin [Treponema succinifaciens DSM 2489]
 gi|328448031|gb|AEB13747.1| thioredoxin [Treponema succinifaciens DSM 2489]
          Length = 102

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 72/100 (72%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +K++  +F  EVL  + PV+VDFWA+WC PC  LSPII++IA E ++ +K+ K++++E  
Sbjct: 3   VKINESNFKEEVLNSTKPVLVDFWATWCGPCRMLSPIIEEIAAEKSETLKVGKVNVDEEP 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++T++ I+SIP L+LFK+GKV+ R   G   + +I++ I
Sbjct: 63  ALATQFGIASIPMLVLFKNGKVV-RTSVGYQPKEEILKLI 101


>gi|91776641|ref|YP_546397.1| thioredoxin [Methylobacillus flagellatus KT]
 gi|91710628|gb|ABE50556.1| thioredoxin [Methylobacillus flagellatus KT]
          Length = 108

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD EVL+   PV+VD+WA WC PC  ++PI+D+IA E A ++KI KL+I+E+     +Y
Sbjct: 12  TFDQEVLQSQLPVLVDYWAEWCGPCKMIAPILDEIAKEYAGRLKIAKLNIDENQNTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFKDG V +    GA S+S +  +I S +
Sbjct: 72  GIRGIPTLMLFKDGNV-EATKVGALSKSQLTAFIDSNI 108


>gi|182415657|ref|YP_001820723.1| thioredoxin [Opitutus terrae PB90-1]
 gi|177842871|gb|ACB77123.1| thioredoxin [Opitutus terrae PB90-1]
          Length = 108

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 67/92 (72%), Gaps = 3/92 (3%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F+S +   + PV+VDFWA WC PC  ++PI++++A EL  K+KI K+++++  EI+TRY 
Sbjct: 13  FESAISSGTTPVLVDFWAPWCGPCKAIAPILEELATELDGKLKIAKVNVDDHGEIATRYS 72

Query: 71  ISSIPTLILFKDGKVIDR---MMPGASSQSDI 99
           I +IPT++LFK G+V ++   MMP A+ ++ I
Sbjct: 73  IRAIPTMLLFKGGQVAEQLVGMMPKATLKAKI 104


>gi|20141978|sp|Q9ZEE0|THIO_RICPR RecName: Full=Thioredoxin; Short=Trx
          Length = 105

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF +EVLE   PV+VDFWA WC PC  L PIID+I+ EL DKVK+ K++I+E+ +  + Y
Sbjct: 9   SFKNEVLESDLPVMVDFWAEWCGPCKMLIPIIDEISKELQDKVKVLKMNIDENPKTPSEY 68

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I SIPT++LFK+G+  D  + G   ++ +++WI
Sbjct: 69  GIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWI 101


>gi|15603883|ref|NP_220398.1| thioredoxin (trxA) [Rickettsia prowazekii str. Madrid E]
 gi|3860574|emb|CAA14475.1| THIOREDOXIN (trxA) [Rickettsia prowazekii]
 gi|292571600|gb|ADE29515.1| Thioredoxin [Rickettsia prowazekii Rp22]
          Length = 130

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF +EVLE   PV+VDFWA WC PC  L PIID+I+ EL DKVK+ K++I+E+ +  + Y
Sbjct: 34  SFKNEVLESDLPVMVDFWAEWCGPCKMLIPIIDEISKELQDKVKVLKMNIDENPKTPSEY 93

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I SIPT++LFK+G+  D  + G   ++ +++WI
Sbjct: 94  GIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWI 126


>gi|223939100|ref|ZP_03630984.1| thioredoxin [bacterium Ellin514]
 gi|223892260|gb|EEF58737.1| thioredoxin [bacterium Ellin514]
          Length = 114

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 43/92 (46%), Positives = 69/92 (75%), Gaps = 1/92 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  EVLE + PV+VDFWASWC PC  +SP+++ +A + A K KI K++++E+  + +++
Sbjct: 18  SFTQEVLESNVPVLVDFWASWCGPCRMISPLVESLAVDFAGKAKIAKVNVDENPGLCSQF 77

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            I SIPTL++FK+GK++D  + GASS++ + E
Sbjct: 78  SIRSIPTLLIFKNGKLVDTSI-GASSKTSLTE 108


>gi|118620069|ref|YP_908401.1| thioredoxin TrxC [Mycobacterium ulcerans Agy99]
 gi|118572179|gb|ABL06930.1| thioredoxin TrxC [Mycobacterium ulcerans Agy99]
          Length = 117

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 71/99 (71%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF +EVL  + PV+VDFWA+WC PC  ++P++++IA E AD + + KLD++ 
Sbjct: 9   ATIEVSDASFSTEVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERADNLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + E +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++
Sbjct: 69  NPETARNFQVVSIPTMILFKDGEPVKRIV-GAKGKAALL 106


>gi|322435411|ref|YP_004217623.1| thioredoxin [Acidobacterium sp. MP5ACTX9]
 gi|321163138|gb|ADW68843.1| thioredoxin [Acidobacterium sp. MP5ACTX9]
          Length = 115

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 74/106 (69%), Gaps = 3/106 (2%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V+  +F+ +VL+ S PV+VDFWA+WC PC  L+P++D +A++   ++K+ K+D++++S 
Sbjct: 8   EVNDSNFEQDVLKSSQPVLVDFWAAWCGPCRALAPVVDQVAEQFNGQLKVMKMDVDKNSA 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRM---MPGASSQSDIIEWILSRV 107
             +RY I  IP L++FKDGKV +++   +P AS +  I + I + V
Sbjct: 68  TPSRYGIRGIPALLIFKDGKVAEQIVGVVPKASIEQSITKVIGAPV 113


>gi|85373842|ref|YP_457904.1| thiol-disulfide isomerase [Erythrobacter litoralis HTCC2594]
 gi|84786925|gb|ABC63107.1| thiol-disulfide isomerase [Erythrobacter litoralis HTCC2594]
          Length = 106

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   SF ++VLE   PV+VDFWA WC PC  ++P +++I++EL ++V I K+DI 
Sbjct: 1   MATVNVTDASFKADVLESDKPVLVDFWAEWCGPCKMIAPALEEISEELGEQVTIAKMDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+++ ++   + SIP ++LFK+G+ + R + GA+ +S + +WI S +
Sbjct: 61  ENTDTASEMGVQSIPLMVLFKNGEAVARKV-GAAPKSQLKDWIESEI 106


>gi|329894565|ref|ZP_08270372.1| Thioredoxin [gamma proteobacterium IMCC3088]
 gi|328922973|gb|EGG30300.1| Thioredoxin [gamma proteobacterium IMCC3088]
          Length = 108

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   +FD+ VL+   PV+VDFWA+WC PC  ++PI+D+IA E   +++I K+D++ + 
Sbjct: 5   LHVSDAAFDTAVLKSPVPVLVDFWAAWCGPCKMIAPILDEIAPEFDGRLQIAKVDVDANP 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E + +Y I  IPTLI+FKDG V    + GA S++ ++E+I
Sbjct: 65  ETAPKYGIRGIPTLIIFKDGAVAGTKV-GALSKTQLVEFI 103


>gi|262374322|ref|ZP_06067598.1| thioredoxin [Acinetobacter junii SH205]
 gi|262310880|gb|EEY91968.1| thioredoxin [Acinetobacter junii SH205]
          Length = 121

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 74/105 (70%), Gaps = 3/105 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T  ++F ++VL+   PV+VDFWA WC PC  ++P+++D+++E A KVKI K+D
Sbjct: 14  MSATIVNTTDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSNEYAGKVKIVKVD 73

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    E + +Y I +IP L++FK+G+V+ + + GA+ +S +  +I
Sbjct: 74  VTACEETAVKYNIRNIPALLMFKNGEVVAQQV-GAAPRSKLAAFI 117


>gi|187776622|ref|ZP_02993095.1| hypothetical protein CLOSPO_00136 [Clostridium sporogenes ATCC
          15579]
 gi|187775281|gb|EDU39083.1| hypothetical protein CLOSPO_00136 [Clostridium sporogenes ATCC
          15579]
          Length = 105

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 63/86 (73%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
          +++   F  EVL    PVVVDFWA+WC PC  L+P++++I+ EL  KVK  K++++E+  
Sbjct: 4  EINENVFGEEVLNSEVPVVVDFWATWCGPCKMLAPVVEEISQELGQKVKFVKVNVDENPV 63

Query: 65 ISTRYQISSIPTLILFKDGKVIDRMM 90
          IST+Y+I+SIPTL+ FK GK ++ ++
Sbjct: 64 ISTQYKIASIPTLMTFKAGKAVETLV 89


>gi|158319702|ref|YP_001512209.1| thioredoxin [Alkaliphilus oremlandii OhILAs]
 gi|158139901|gb|ABW18213.1| thioredoxin [Alkaliphilus oremlandii OhILAs]
          Length = 104

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 71/94 (75%), Gaps = 4/94 (4%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          ++V+  +F+ EV++ + PV+VDFWA WC PC  L P+++++A EL  K+K+TKL+++E+ 
Sbjct: 3  MEVNQGNFN-EVIKDTVPVLVDFWAPWCGPCKMLGPVLEEVAVELEGKMKVTKLNVDENQ 61

Query: 64 EISTRYQISSIPTLILFKDGKVIDR---MMPGAS 94
          EIS  Y +SSIPT+++FK+G ++DR    MP A+
Sbjct: 62 EISMEYGVSSIPTVLVFKEGALVDRFVGFMPKAA 95


>gi|322378441|ref|ZP_08052894.1| thioredoxin [Helicobacter suis HS1]
 gi|322380732|ref|ZP_08054861.1| thioredoxin [Helicobacter suis HS5]
 gi|321146845|gb|EFX41616.1| thioredoxin [Helicobacter suis HS5]
 gi|321149132|gb|EFX43579.1| thioredoxin [Helicobacter suis HS1]
          Length = 105

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 2/96 (2%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S +++ +++FD+E    +  V+VDFWA WC PC  L+PIID++A E A K KI K++ +E
Sbjct: 3  SYVELTSENFDAET--GNGAVMVDFWAPWCGPCKMLAPIIDELAAEYAGKAKICKVNTDE 60

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
            E+S+RY I SIPTL+  KDGKVI++ +   S QS
Sbjct: 61 QEELSSRYGIRSIPTLLYMKDGKVINQTVGALSKQS 96


>gi|219669602|ref|YP_002460037.1| thioredoxin [Desulfitobacterium hafniense DCB-2]
 gi|219539862|gb|ACL21601.1| thioredoxin [Desulfitobacterium hafniense DCB-2]
          Length = 109

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 71/96 (73%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T +++ EVL     V+VDFWA+WC PC  ++PII+++ADE+A +V I KL+++E   I+ 
Sbjct: 11  TANWNEEVLGSDKAVLVDFWAAWCGPCRMVAPIIEELADEMAGRVIIGKLNVDEEPAIAG 70

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +YQ+ SIPTL +FK+G+V+D+ + G   ++D+++ I
Sbjct: 71  QYQVMSIPTLAVFKNGQVVDKSV-GFRGKADLVKMI 105


>gi|262172592|ref|ZP_06040270.1| thioredoxin reductase [Vibrio mimicus MB-451]
 gi|261893668|gb|EEY39654.1| thioredoxin reductase [Vibrio mimicus MB-451]
          Length = 108

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++V++ + PV+VDFWA WC PC  ++PI+D++ADE A K+ I KL+I+ ++
Sbjct: 6   LQLTDDGFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEVADEYAGKLTIGKLNIDHNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               +Y I  IPTL+LFKDG V+   + GA S++ + E++
Sbjct: 66  GTPPKYGIRGIPTLLLFKDGSVVATKV-GALSKTQLKEFL 104


>gi|56461462|ref|YP_156743.1| thioredoxin [Idiomarina loihiensis L2TR]
 gi|56180472|gb|AAV83194.1| Thioredoxin [Idiomarina loihiensis L2TR]
          Length = 108

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++V+    PV+VDFWA WC PC  ++PI+DDIA E ADK+ I KL+++ + +   +Y
Sbjct: 12  SFDADVINSDKPVLVDFWAEWCGPCKMVAPILDDIASEYADKLVIGKLNVDHNEQTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK G+V+   + GA S++ + E++
Sbjct: 72  NIRGIPTLLLFKGGEVVGTKV-GALSRAQLTEFL 104


>gi|256828930|ref|YP_003157658.1| thioredoxin [Desulfomicrobium baculatum DSM 4028]
 gi|256578106|gb|ACU89242.1| thioredoxin [Desulfomicrobium baculatum DSM 4028]
          Length = 106

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A +V+   F++EVL+   PV+VDFWA WC PC  ++P+I+++  E   KVKI K++++E+
Sbjct: 2   AAQVNDAGFEAEVLKGDLPVLVDFWAPWCGPCRAIAPVIEELTQEFEGKVKIVKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               ++Y I +IPTLILFK+G+V++++  GA S++ + + +  +V
Sbjct: 62  PGTPSKYGIRAIPTLILFKNGEVVEQVT-GAVSKASLKQMLSDKV 105


>gi|119897321|ref|YP_932534.1| thioredoxin-disulfide reductase [Azoarcus sp. BH72]
 gi|119669734|emb|CAL93647.1| thioredoxin-disulfide reductase [Azoarcus sp. BH72]
          Length = 108

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF++EVL+   PV+VD+WA WC PC  ++PI+D++A + A K+K+ KL+I+E+ E 
Sbjct: 8   VTDGSFEAEVLQSQTPVLVDYWAEWCGPCKMIAPILDEVAKDYAGKLKVAKLNIDENQET 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y I  IPTL++FK G  I+    GA S+S +  +I S +
Sbjct: 68  PAKYGIRGIPTLMIFKGGN-IEATKVGALSKSQLTAFIDSNI 108


>gi|304317063|ref|YP_003852208.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778565|gb|ADL69124.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 110

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   +FDSEV     PV+VDFWA+WC PC  ++P++++ A++ +DK+K+ KL+++
Sbjct: 1   MKPIDVTDMNFDSEVYNSDKPVLVDFWAAWCGPCRMMAPVLEEFAEDYSDKIKVVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDR---MMPGASSQSDIIEWILSRV 107
           E+  I+++Y+I SIPTL +F++G+++D+    MP    +  + ++I ++V
Sbjct: 61  ENPLIASQYRIMSIPTLGVFQNGQLVDKVIGFMPKEQLEYRLAKYIDAQV 110


>gi|269836181|ref|YP_003318409.1| thioredoxin [Sphaerobacter thermophilus DSM 20745]
 gi|269785444|gb|ACZ37587.1| thioredoxin [Sphaerobacter thermophilus DSM 20745]
          Length = 108

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 72/98 (73%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +FD EVL+   PV+VDFWA WC PC  ++PI+D+IA+E A  +K+ K++++E++ +
Sbjct: 7   VSDATFDQEVLKSDVPVLVDFWAVWCGPCRMVAPILDEIAEEKAGSLKVAKVNVDENARV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +  I+SIPTLIL+KDG+ ++R++ GA  +  +++ I
Sbjct: 67  AAQLGITSIPTLILYKDGQPVERII-GAHPKQRLLQQI 103


>gi|51473217|ref|YP_066974.1| thioredoxin [Rickettsia typhi str. Wilmington]
 gi|81826345|sp|Q68Y00|THIO_RICTY RecName: Full=Thioredoxin; Short=Trx
 gi|51459529|gb|AAU03492.1| thioredoxin [Rickettsia typhi str. Wilmington]
          Length = 105

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF +EVLE   PV+VDFWA WC PC  L PIID+I+ EL DKVK+ K++I+E+ +  + Y
Sbjct: 9   SFKNEVLESDLPVIVDFWAEWCGPCKMLIPIIDEISKELQDKVKVLKMNIDENPKTPSEY 68

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + SIPT++LFK+G+  D  + G   +  +++WI
Sbjct: 69  GVRSIPTIMLFKNGEQKDTKI-GLQQKKSLLDWI 101


>gi|239946630|ref|ZP_04698383.1| thioredoxin [Rickettsia endosymbiont of Ixodes scapularis]
 gi|241563468|ref|XP_002401716.1| thioredoxin, putative [Ixodes scapularis]
 gi|215501908|gb|EEC11402.1| thioredoxin, putative [Ixodes scapularis]
 gi|239920906|gb|EER20930.1| thioredoxin [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 105

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 67/101 (66%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V   SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+
Sbjct: 2   ASNVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELKGKVKVLKMNIDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               + Y I SIPT++LFK+G+  D  + G   ++ +++WI
Sbjct: 62  PNTPSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWI 101


>gi|114848857|gb|ABI83631.1| thioredoxin [Acetobacter aceti]
          Length = 108

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SFD +VL+ S  V+VDFWA WC PC  + P + +I  E A KV + K++I+++ 
Sbjct: 6   LAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E    YQ+ SIPTL+L +DGKVID+ + GA  +S +  W+ S
Sbjct: 66  ETPNAYQVRSIPTLMLVRDGKVIDKKV-GALPKSQLKAWVES 106


>gi|319761321|ref|YP_004125258.1| thioredoxin [Alicycliphilus denitrificans BC]
 gi|330823196|ref|YP_004386499.1| thioredoxin [Alicycliphilus denitrificans K601]
 gi|317115882|gb|ADU98370.1| thioredoxin [Alicycliphilus denitrificans BC]
 gi|329308568|gb|AEB82983.1| thioredoxin [Alicycliphilus denitrificans K601]
          Length = 148

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 59/102 (57%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +D  +FD  V     PVVVDFWA WC PC +++P     A  L   V++ KLD E   
Sbjct: 46  LALDAATFDRHVGRSHVPVVVDFWAPWCGPCRQMAPAFAQAARTLEPHVRLAKLDTEAHP 105

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +I+ RY I SIPT+ILFK G+   R+  GA   +DI  W+ S
Sbjct: 106 QIAGRYGIRSIPTMILFKGGREAARVS-GALGAADIARWVNS 146


>gi|268592935|ref|ZP_06127156.1| thioredoxin [Providencia rettgeri DSM 1131]
 gi|291311727|gb|EFE52180.1| thioredoxin [Providencia rettgeri DSM 1131]
          Length = 108

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 68/94 (72%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF +EVL  S+PV+VDFWA+WC PC  ++PI+D++A+E   K+ I KL+I+E+   + +Y
Sbjct: 12  SFATEVLNASSPVLVDFWAAWCGPCKMIAPILDEVAEEYTGKLTIAKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKTQLKEFL 104


>gi|331700381|ref|YP_004336620.1| thioredoxin [Pseudonocardia dioxanivorans CB1190]
 gi|326955070|gb|AEA28767.1| thioredoxin [Pseudonocardia dioxanivorans CB1190]
          Length = 109

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 71/97 (73%), Gaps = 3/97 (3%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+    V+VDFWA+WC PC  ++P++D+IA E +DK+ + KLDI+ +S+ +  Y
Sbjct: 12  SFEADVLKSDKTVLVDFWATWCGPCKMVAPVLDEIAGEHSDKLTVAKLDIDVNSKTAAAY 71

Query: 70  QISSIPTLILFKDGKVIDRMM---PGASSQSDIIEWI 103
           Q+ SIPT+ILFKDGK +  ++   P A+  SD+ ++I
Sbjct: 72  QVMSIPTMILFKDGKPVKTIVGARPKAALLSDLADYI 108


>gi|183985448|ref|YP_001853739.1| thioredoxin TrxC [Mycobacterium marinum M]
 gi|183178774|gb|ACC43884.1| thioredoxin TrxC [Mycobacterium marinum M]
          Length = 117

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 71/99 (71%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF +EVL  + PV+VDFWA+WC PC  ++P++++IA E AD + + KLD++ 
Sbjct: 9   ATIEVSDASFSTEVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERADSLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + E +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++
Sbjct: 69  NPETARNFQVVSIPTMILFKDGEPVKRIV-GAKGKAALL 106


>gi|127511272|ref|YP_001092469.1| thioredoxin [Shewanella loihica PV-4]
 gi|126636567|gb|ABO22210.1| thioredoxin [Shewanella loihica PV-4]
          Length = 108

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI+DD+ADE A KV I KL++++++    +Y
Sbjct: 12  SFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVADEYAGKVTIAKLNVDQNNASPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFK+G++ D  + GA S++ + E+I
Sbjct: 72  GVRGIPTLLLFKNGELADTKV-GALSKTQLKEFI 104


>gi|284161144|ref|YP_003399767.1| thioredoxin [Archaeoglobus profundus DSM 5631]
 gi|284011141|gb|ADB57094.1| thioredoxin [Archaeoglobus profundus DSM 5631]
          Length = 130

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%), Gaps = 2/100 (2%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +K+D+ +F   + E  N VVVDFWA WC PC  +SPIID++A E A KV   KL+I+E  
Sbjct: 29  VKLDSTNFKKFIEENEN-VVVDFWAEWCGPCKLISPIIDELAKEYAGKVAFGKLNIDEDR 87

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I+ +Y IS+IPTLI FK GK +  M+ GA  +S++  WI
Sbjct: 88  TIAMQYGISAIPTLIFFKKGKAVS-MIVGAYPKSELKRWI 126


>gi|89899924|ref|YP_522395.1| thioredoxin [Rhodoferax ferrireducens T118]
 gi|89344661|gb|ABD68864.1| thioredoxin [Rhodoferax ferrireducens T118]
          Length = 145

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
            ++ +D  +FD  +  C  PV+VDFWA WC PC +++P  +  A +L  + ++ K++ EE
Sbjct: 40  HSVALDDSNFDRHINRCQIPVLVDFWAPWCGPCRQMAPAFEQAAAQLEPRFRLAKVNTEE 99

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +  R+ I SIPTL LF  G+ + R  PGA   +DI+ W L++
Sbjct: 100 AQALGARFNIRSIPTLALFSAGRELAR-QPGAMGAADIVRWALAQ 143


>gi|307825387|ref|ZP_07655606.1| thioredoxin [Methylobacter tundripaludum SV96]
 gi|307733562|gb|EFO04420.1| thioredoxin [Methylobacter tundripaludum SV96]
          Length = 108

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S L V    F+  V++ + PV+VD+WA WC PC  ++PI+DDIA E A K+ + KL+I+E
Sbjct: 4   SVLHVGDSEFNETVIKAAGPVLVDYWAEWCGPCKMIAPILDDIAKEYAGKLTVVKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E    Y +  IPTL+LFKDG+V +    GA S+S +  ++ S +
Sbjct: 64  NPETPQHYGVRGIPTLMLFKDGEV-EATKVGALSKSQLAAFLDSNI 108


>gi|126030712|pdb|2I4A|A Chain A, Crystal Structure Of Thioredoxin From The Acidophile
           Acetobacter Aceti
          Length = 107

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SFD +VL+ S  V+VDFWA WC PC  + P + +I  E A KV + K++I+++ 
Sbjct: 5   LAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNP 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E    YQ+ SIPTL+L +DGKVID+ + GA  +S +  W+ S
Sbjct: 65  ETPNAYQVRSIPTLMLVRDGKVIDKKV-GALPKSQLKAWVES 105


>gi|313902375|ref|ZP_07835778.1| thioredoxin [Thermaerobacter subterraneus DSM 13965]
 gi|313467306|gb|EFR62817.1| thioredoxin [Thermaerobacter subterraneus DSM 13965]
          Length = 109

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 63/87 (72%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L +  + FD+EVL+   PV+VDFWA WC PC  ++PI+++IA E A ++K+ KL++++  
Sbjct: 6  LDLTAEQFDAEVLQSDQPVLVDFWAPWCGPCRMIAPIVEEIAQEYAGRLKVAKLNVDDHG 65

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
           I+ RY + SIPTL++FK G+ + R++
Sbjct: 66 VIAGRYGVMSIPTLLVFKGGQPVARIV 92


>gi|253991617|ref|YP_003042973.1| thioredoxin 1 [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253783067|emb|CAQ86232.1| thioredoxin 1 (trx1) (trx) [Photorhabdus asymbiotica]
          Length = 108

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+ + PV+VDFWA+WC PC  ++PI+D+IA E + K+ I KL+I+++   + +Y
Sbjct: 12  SFDADVLKAAGPVLVDFWAAWCGPCKMIAPILDEIAPEYSGKLTIAKLNIDDNPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG+V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKDGQVAATKV-GALSKTQLKEFL 104


>gi|220929624|ref|YP_002506533.1| thioredoxin [Clostridium cellulolyticum H10]
 gi|219999952|gb|ACL76553.1| thioredoxin [Clostridium cellulolyticum H10]
          Length = 108

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 70/94 (74%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+S VL+   PVVVDFWASWC PC  ++PI++++ADE   K  I K++++E  E++ ++
Sbjct: 12  SFESNVLKSDKPVVVDFWASWCGPCRMVAPIMEELADEFNGKASIAKVNVDEEGELAAQF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I SIPT+++FK G+ +++++ GA S+++  E I
Sbjct: 72  RIMSIPTVMVFKGGEAVEKIV-GARSKAEFSELI 104


>gi|167748490|ref|ZP_02420617.1| hypothetical protein ANACAC_03234 [Anaerostipes caccae DSM 14662]
 gi|167652482|gb|EDR96611.1| hypothetical protein ANACAC_03234 [Anaerostipes caccae DSM 14662]
          Length = 107

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 72/101 (71%), Gaps = 2/101 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS LK+   +F  EVL    PV++DFWA+WC PC  +S ++D+IA+EL   VK+ K++++
Sbjct: 1   MSVLKITEANFVEEVLNAKEPVLIDFWAAWCGPCRMMSSVVDEIAEELHG-VKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E  E++ ++++ SIPTL++FK+GKV ++   GA  + +I++
Sbjct: 60  EEQELAGKFRVMSIPTLLIFKNGKV-EKSFVGARDKKEIVD 99


>gi|89073868|ref|ZP_01160375.1| putative thioredoxin [Photobacterium sp. SKA34]
 gi|90581475|ref|ZP_01237269.1| putative thioredoxin [Vibrio angustum S14]
 gi|89050403|gb|EAR55904.1| putative thioredoxin [Photobacterium sp. SKA34]
 gi|90437336|gb|EAS62533.1| putative thioredoxin [Vibrio angustum S14]
          Length = 108

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++E   ++
Sbjct: 12  SFDTDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNAETPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|258543652|ref|YP_003189085.1| thioredoxin [Acetobacter pasteurianus IFO 3283-01]
 gi|256634730|dbj|BAI00706.1| thioredoxin [Acetobacter pasteurianus IFO 3283-01]
 gi|256637786|dbj|BAI03755.1| thioredoxin [Acetobacter pasteurianus IFO 3283-03]
 gi|256640840|dbj|BAI06802.1| thioredoxin [Acetobacter pasteurianus IFO 3283-07]
 gi|256643895|dbj|BAI09850.1| thioredoxin [Acetobacter pasteurianus IFO 3283-22]
 gi|256646950|dbj|BAI12898.1| thioredoxin [Acetobacter pasteurianus IFO 3283-26]
 gi|256650003|dbj|BAI15944.1| thioredoxin [Acetobacter pasteurianus IFO 3283-32]
 gi|256652993|dbj|BAI18927.1| thioredoxin [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256656047|dbj|BAI21974.1| thioredoxin [Acetobacter pasteurianus IFO 3283-12]
          Length = 108

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SFD +VL+ S  V+VDFWA WC PC  + P +++I  E A KV + K++I+++ 
Sbjct: 6   LAVSDSSFDKDVLKASGLVLVDFWAEWCGPCKMIGPALEEIGKEFAGKVTVAKVNIDDNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E    YQ+ SIPTL+L +DGKV+D+ + GA  +S +  W+
Sbjct: 66  ETPNAYQVRSIPTLMLVRDGKVVDKKV-GALPKSQLKAWV 104


>gi|187735197|ref|YP_001877309.1| thioredoxin [Akkermansia muciniphila ATCC BAA-835]
 gi|187425249|gb|ACD04528.1| thioredoxin [Akkermansia muciniphila ATCC BAA-835]
          Length = 105

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 70/92 (76%), Gaps = 1/92 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EVL+   PV+VDFWA+WC PC  ++PIID ++ ELA K+K+ K+D++ ++ ++  Y
Sbjct: 9   NFEDEVLKSDIPVLVDFWATWCGPCRMIAPIIDQLSTELAGKIKVGKVDVDANNGLAATY 68

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            + +IPTL++ KDG+++D M+ GASS+  I++
Sbjct: 69  GVRTIPTLLIIKDGEIMDTMV-GASSKDAIMQ 99


>gi|325982323|ref|YP_004294725.1| thioredoxin [Nitrosomonas sp. AL212]
 gi|325531842|gb|ADZ26563.1| thioredoxin [Nitrosomonas sp. AL212]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+ + PV+VD+WA WC PC  ++PI+D+IA+E ++++K+ KL+I+E+     +Y
Sbjct: 12  NFETEVLQSTTPVLVDYWAEWCGPCKMIAPILDEIANEYSERLKVAKLNIDENQLTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G  I+    GA S+S +  +I S +
Sbjct: 72  GIRGIPTLMLFKNGN-IEATKVGALSKSQLTAFIDSHI 108


>gi|261856914|ref|YP_003264197.1| thioredoxin [Halothiobacillus neapolitanus c2]
 gi|261837383|gb|ACX97150.1| thioredoxin [Halothiobacillus neapolitanus c2]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  +FD EVL+   PV+VD+WA WC PC  ++PI+D+IAD+   KVK+ KL+I+E+ E 
Sbjct: 8   VNDSNFDQEVLKSDLPVLVDYWAEWCGPCRMIAPILDEIADQYDGKVKVAKLNIDENPET 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             ++ I  IPTL+LFK+GKV +    GA S+S +  +I
Sbjct: 68  PRQHAIRGIPTLMLFKNGKV-EGTKVGAVSKSQLTAFI 104


>gi|300742665|ref|ZP_07072686.1| thioredoxin [Rothia dentocariosa M567]
 gi|311112581|ref|YP_003983803.1| thioredoxin [Rothia dentocariosa ATCC 17931]
 gi|300381850|gb|EFJ78412.1| thioredoxin [Rothia dentocariosa M567]
 gi|310944075|gb|ADP40369.1| thioredoxin [Rothia dentocariosa ATCC 17931]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 68/101 (67%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A  V   +F +EVL+ S PV+VDFWA WC PC  ++P++D+IA E  +KV + K+++EE
Sbjct: 3   NAKAVTDATFKAEVLDNSKPVIVDFWAEWCGPCRMVAPVLDEIAAEYGEKVDVVKVNVEE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEW 102
           S + +  Y I+SIP + LFKDG+V+ + +     Q+ I ++
Sbjct: 63  SGDTAMEYDITSIPAIYLFKDGQVVKKSVGARPKQALIADF 103


>gi|15891925|ref|NP_359639.1| thioredoxin [Rickettsia conorii str. Malish 7]
 gi|34581038|ref|ZP_00142518.1| thioredoxin [Rickettsia sibirica 246]
 gi|229586232|ref|YP_002844733.1| Thioredoxin [Rickettsia africae ESF-5]
 gi|238650215|ref|YP_002916065.1| thioredoxin [Rickettsia peacockii str. Rustic]
 gi|20140672|sp|Q92JR5|THIO_RICCN RecName: Full=Thioredoxin; Short=Trx
 gi|15619034|gb|AAL02540.1| thioredoxin [Rickettsia conorii str. Malish 7]
 gi|28262423|gb|EAA25927.1| thioredoxin [Rickettsia sibirica 246]
 gi|228021282|gb|ACP52990.1| Thioredoxin [Rickettsia africae ESF-5]
 gi|238624313|gb|ACR47019.1| thioredoxin [Rickettsia peacockii str. Rustic]
          Length = 105

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+    + Y
Sbjct: 9   SFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEY 68

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I SIPT++LFK+G+  D  + G   ++ +++WI
Sbjct: 69  GIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWI 101


>gi|197287126|ref|YP_002152998.1| thioredoxin [Proteus mirabilis HI4320]
 gi|227357183|ref|ZP_03841552.1| thioredoxin [Proteus mirabilis ATCC 29906]
 gi|194684613|emb|CAR46502.1| thioredoxin [Proteus mirabilis HI4320]
 gi|227162715|gb|EEI47682.1| thioredoxin [Proteus mirabilis ATCC 29906]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +   +FD +VL+ + PV+VDFWA WC PC  ++PI+D++A E A K+ + KL+I+E+ 
Sbjct: 6   LHLSDNTFDVDVLQATGPVLVDFWAEWCGPCKMIAPILDEVATEYAGKLTVAKLNIDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             + +Y I  IPTLILFK+G V    + GA S++ + E++
Sbjct: 66  ATAPKYGIRGIPTLILFKNGAVAATKV-GALSKTQLKEFL 104


>gi|332970273|gb|EGK09265.1| thioredoxin [Kingella kingae ATCC 23330]
          Length = 110

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 68/96 (70%), Gaps = 1/96 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F++EVL+ S PV++DFWA WC PC  ++PI+D +ADE A K+KI K++++++ 
Sbjct: 6   VHVTDATFEAEVLQSSQPVLLDFWAPWCGPCKMIAPILDQLADEWAGKIKIAKMNVDDNQ 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            I  ++ I SIPTL++ KDG+V+    PGA ++  +
Sbjct: 66  AIPAQFGIRSIPTLVVLKDGQVL-ATRPGALAKPQL 100


>gi|227876527|ref|ZP_03994639.1| thioredoxin [Mobiluncus mulieris ATCC 35243]
 gi|269977728|ref|ZP_06184688.1| thioredoxin [Mobiluncus mulieris 28-1]
 gi|306817488|ref|ZP_07451232.1| thioredoxin [Mobiluncus mulieris ATCC 35239]
 gi|307699872|ref|ZP_07636923.1| thioredoxin [Mobiluncus mulieris FB024-16]
 gi|227843068|gb|EEJ53265.1| thioredoxin [Mobiluncus mulieris ATCC 35243]
 gi|269934032|gb|EEZ90606.1| thioredoxin [Mobiluncus mulieris 28-1]
 gi|304649712|gb|EFM46993.1| thioredoxin [Mobiluncus mulieris ATCC 35239]
 gi|307614910|gb|EFN94128.1| thioredoxin [Mobiluncus mulieris FB024-16]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 60/91 (65%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +AL+V+  +F  EVL    PV+VDFWA+WC PC ++ PIID +A E  + +KI K D+++
Sbjct: 3  NALEVNESNFSEEVLRSETPVLVDFWATWCAPCRQMGPIIDQLAAEYGNDLKIVKCDVDQ 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPG 92
          +  +  +YQISSIP   LFK G+ I   + G
Sbjct: 63 NPALQMKYQISSIPAFHLFKGGESIAEFIGG 93


>gi|90025230|gb|ABD85118.1| thiol-disulfide oxido-reductase [Sinorhizobium meliloti]
          Length = 114

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (68%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +KVDT +F  EVL+ + PV+VDFW + C+PC  + P ++ IA ELA KVK+ K++  
Sbjct: 1  MATVKVDTSNFSEEVLQSAEPVIVDFWKNGCQPCDMIVPFLEQIATELAGKVKVVKINKA 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVID 87
          E+ E+  RY +   PTL LFKDG+V D
Sbjct: 61 ENPELVARYGVRGYPTLALFKDGEVAD 87


>gi|94311072|ref|YP_584282.1| thioredoxin [Cupriavidus metallidurans CH34]
 gi|93354924|gb|ABF09013.1| thioredoxin 1 [Cupriavidus metallidurans CH34]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 73/102 (71%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SFD++VL+   PV++DFWA WC PC  ++PI+D++A +  DKV++ K++++E+ ++
Sbjct: 8   VSDASFDADVLKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKVQVAKINVDENQQV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ I  IPTLILFK+G+V  + + GA S+S +  ++ S++
Sbjct: 68  PAKFGIRGIPTLILFKNGQVAAQKV-GALSKSQLTAFLDSQL 108


>gi|326387824|ref|ZP_08209430.1| thioredoxin [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207870|gb|EGD58681.1| thioredoxin [Novosphingobium nitrogenifigens DSM 19370]
          Length = 106

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    V   SF  +VL+   PV+VDFWA WC PC  + P +++IADELADKV+I K+DI 
Sbjct: 1   MPTKPVTDASFAEDVLQADKPVLVDFWADWCGPCKMIGPALEEIADELADKVEIAKMDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            ++ + +   + SIP L+LFKDGK + + + GA+ +S +  W+ S
Sbjct: 61  ANTSVPSEIGVQSIPLLVLFKDGKPVAQKL-GAAPKSQLKGWLES 104


>gi|262281024|ref|ZP_06058807.1| thioredoxin [Acinetobacter calcoaceticus RUH2202]
 gi|299771520|ref|YP_003733546.1| thioredoxin [Acinetobacter sp. DR1]
 gi|262257924|gb|EEY76659.1| thioredoxin [Acinetobacter calcoaceticus RUH2202]
 gi|298701608|gb|ADI92173.1| thioredoxin [Acinetobacter sp. DR1]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 73/105 (69%), Gaps = 3/105 (2%)

Query: 1   MSALKVDTK--SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T   +F ++VL+   PV+VDFWA WC PC  ++P+++D++ E A KVKI K+D
Sbjct: 1   MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSSEYAGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    +I+ +Y I +IP L+LFK+G+V+ + + GA  +S ++ +I
Sbjct: 61  VTSCEDIAVKYNIRNIPALLLFKNGEVVAQQI-GAVPRSKLVSFI 104


>gi|118465727|ref|YP_884412.1| thioredoxin [Mycobacterium avium 104]
 gi|118167014|gb|ABK67911.1| thioredoxin [Mycobacterium avium 104]
          Length = 117

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 71/100 (71%), Gaps = 1/100 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           ++ ++V   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E  D + + KLD++
Sbjct: 8   IATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
            + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++
Sbjct: 68  ANPETAQNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALL 106


>gi|296532482|ref|ZP_06895201.1| thioredoxin [Roseomonas cervicalis ATCC 49957]
 gi|296267199|gb|EFH13105.1| thioredoxin [Roseomonas cervicalis ATCC 49957]
          Length = 110

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  EVL  S PV+VDFWA WC PC  ++PI+D+IA E A ++ + K++I+E+      Y
Sbjct: 12  SFKDEVLGASGPVLVDFWAEWCGPCRMVAPILDEIAQEYAGQLTVAKVNIDENPMTPNDY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPT+ILFKDGK ++  + GA  +S + EWI
Sbjct: 72  AVRGIPTMILFKDGKPVETKV-GAMPRSQMKEWI 104


>gi|325954954|ref|YP_004238614.1| thioredoxin [Weeksella virosa DSM 16922]
 gi|323437572|gb|ADX68036.1| thioredoxin [Weeksella virosa DSM 16922]
          Length = 105

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL V   SFD E++    P +VDFWA WC PC  + PI+++IA E ++K  + K+D++ +
Sbjct: 2   ALDVTDASFDKEIINSGKPAMVDFWAVWCGPCRMVGPIVEEIAGEYSEKAVVAKVDVDNN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            E++ +Y I +IPT++ FK+G+V+D+++ G + +  +IE
Sbjct: 62  QEVAAKYGIRNIPTILYFKNGEVVDKVV-GVAPKEQLIE 99


>gi|126640673|ref|YP_001083657.1| hypothetical protein A1S_0606 [Acinetobacter baumannii ATCC 17978]
 gi|184156930|ref|YP_001845269.1| Thiol-disulfide isomerase and thioredoxin [Acinetobacter baumannii
           ACICU]
 gi|213156066|ref|YP_002318111.1| thioredoxin [Acinetobacter baumannii AB0057]
 gi|215484606|ref|YP_002326841.1| thioredoxin [Acinetobacter baumannii AB307-0294]
 gi|239500685|ref|ZP_04659995.1| thioredoxin [Acinetobacter baumannii AB900]
 gi|301344689|ref|ZP_07225430.1| thioredoxin [Acinetobacter baumannii AB056]
 gi|301510191|ref|ZP_07235428.1| thioredoxin [Acinetobacter baumannii AB058]
 gi|301595525|ref|ZP_07240533.1| thioredoxin [Acinetobacter baumannii AB059]
 gi|332856882|ref|ZP_08436291.1| thioredoxin [Acinetobacter baumannii 6013150]
 gi|332867216|ref|ZP_08437481.1| thioredoxin [Acinetobacter baumannii 6013113]
 gi|332873993|ref|ZP_08441928.1| thioredoxin [Acinetobacter baumannii 6014059]
 gi|126386557|gb|ABO11055.1| hypothetical protein A1S_0606 [Acinetobacter baumannii ATCC 17978]
 gi|183208524|gb|ACC55922.1| Thiol-disulfide isomerase and thioredoxin [Acinetobacter baumannii
           ACICU]
 gi|213055226|gb|ACJ40128.1| thioredoxin [Acinetobacter baumannii AB0057]
 gi|213985718|gb|ACJ56017.1| thioredoxin [Acinetobacter baumannii AB307-0294]
 gi|322506826|gb|ADX02280.1| trxA [Acinetobacter baumannii 1656-2]
 gi|323516695|gb|ADX91076.1| Thiol-disulfide isomerase and thioredoxin [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332726936|gb|EGJ58441.1| thioredoxin [Acinetobacter baumannii 6013150]
 gi|332734155|gb|EGJ65287.1| thioredoxin [Acinetobacter baumannii 6013113]
 gi|332737734|gb|EGJ68626.1| thioredoxin [Acinetobacter baumannii 6014059]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MSALKVDTK--SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T   +F ++VL+   PV+VDFWA WC PC  ++P+++D++ E A KVKI K+D
Sbjct: 1   MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSSEYAGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    E + +Y I +IP L+LFK+G+V+ + + GA  +S ++ +I
Sbjct: 61  VTSCEETAVKYNIRNIPALLLFKNGEVVAQQI-GAVPRSKLVSFI 104


>gi|254506548|ref|ZP_05118689.1| thioredoxin [Vibrio parahaemolyticus 16]
 gi|219550421|gb|EED27405.1| thioredoxin [Vibrio parahaemolyticus 16]
          Length = 110

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           +LE   PVV+DFWA WC PCV  +P+  D+A E A  V+  K+D E    I+ +YQI SI
Sbjct: 17  LLESKQPVVIDFWAPWCNPCVGFAPVFSDVASERAQSVRFVKVDTESQQNIAAKYQIRSI 76

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           PT+++FKDGK +D M+ GA  +    +W+
Sbjct: 77  PTIMVFKDGKRVD-MINGALPKGQFDQWL 104


>gi|169634327|ref|YP_001708063.1| thioredoxin [Acinetobacter baumannii SDF]
 gi|169153119|emb|CAP02193.1| thioredoxin [Acinetobacter baumannii]
          Length = 121

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MSALKVDTK--SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T   +F ++VL+   PV+VDFWA WC PC  ++P+++D++ E A KVKI K+D
Sbjct: 14  MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSSEYAGKVKIVKVD 73

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    E + +Y I +IP L+LFK+G+V+ + + GA  +S ++ +I
Sbjct: 74  VTSCEETAVKYNIRNIPALLLFKNGEVVAQQI-GAVPRSKLVSFI 117


>gi|227502231|ref|ZP_03932280.1| possible thioredoxin [Corynebacterium accolens ATCC 49725]
 gi|227077055|gb|EEI15018.1| possible thioredoxin [Corynebacterium accolens ATCC 49725]
          Length = 107

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 1/96 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           KV T++F  +V+E   PVVVDFWA WC PC KLSPI++++ADEL  +V I K++++E   
Sbjct: 6   KVTTETFRFDVIESDKPVVVDFWAEWCGPCKKLSPILEEVADELDGEVTIAKVNVDEERN 65

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +   +QI SIP +++F +G+ +D  + G  S+ DI+
Sbjct: 66  LGAMFQIMSIPNVLIFNNGEKVDEFV-GLRSKDDIV 100


>gi|293604497|ref|ZP_06686902.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Achromobacter
           piechaudii ATCC 43553]
 gi|311105319|ref|YP_003978172.1| thioredoxin 1 [Achromobacter xylosoxidans A8]
 gi|292817078|gb|EFF76154.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Achromobacter
           piechaudii ATCC 43553]
 gi|310760008|gb|ADP15457.1| thioredoxin 1 [Achromobacter xylosoxidans A8]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SFD++VL+   PV+VD+WA+WC PC  ++PI++++A E A ++ I KL+++E+  
Sbjct: 7   NVSDASFDADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVATEYAGRLTIAKLNVDENQG 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +T+Y I  IPTL+LFKDG+     + GA S+S +  ++
Sbjct: 67  TATKYGIRGIPTLMLFKDGQAAATKV-GALSKSQLTAFL 104


>gi|146328748|ref|YP_001209642.1| thioredoxin I [Dichelobacter nodosus VCS1703A]
 gi|146232218|gb|ABQ13196.1| thioredoxin I [Dichelobacter nodosus VCS1703A]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 72/100 (72%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
             V+   F S+VL+ + PV+VDFWA WC PC  L+P++++ A E A K+ + K++++++ 
Sbjct: 5   FAVNEADFQSQVLDANVPVLVDFWAEWCGPCRALAPVLEEFAAEQAGKLAVAKVNVDDNG 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I+ ++ I SIPTLILFK+G+ +DR++ G +S++ +  ++
Sbjct: 65  DIAAQFGIRSIPTLILFKNGQQVDRIV-GLASKAQLSNFV 103


>gi|82703204|ref|YP_412770.1| thioredoxin [Nitrosospira multiformis ATCC 25196]
 gi|82411269|gb|ABB75378.1| thioredoxin [Nitrosospira multiformis ATCC 25196]
          Length = 107

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+ + PV+VD+WA WC PC  ++PI+D++A E  D++K+ KL+I+E+     +Y
Sbjct: 11  NFETEVLQSTVPVLVDYWAEWCGPCKMIAPILDEVAKEYGDRLKVAKLNIDENQATPPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G  I+    GA S+S +  +I S +
Sbjct: 71  GIRGIPTLMLFKNGN-IEATKVGALSKSQLTAFIDSHI 107


>gi|56752273|ref|YP_172974.1| thioredoxin [Synechococcus elongatus PCC 6301]
 gi|81300639|ref|YP_400847.1| thioredoxin [Synechococcus elongatus PCC 7942]
 gi|135760|sp|P12243|THIO1_SYNE7 RecName: Full=Thioredoxin-1; Short=Trx-1; AltName:
          Full=Thioredoxin-M
 gi|79689|pir||A32956 thioredoxin m - Synechococcus sp
 gi|142154|gb|AAA22057.1| thioredoxin [Synechococcus elongatus PCC 6301]
 gi|24251253|gb|AAN46173.1| unknown protein [Synechococcus elongatus PCC 7942]
 gi|56687232|dbj|BAD80454.1| thioredoxin [Synechococcus elongatus PCC 6301]
 gi|81169520|gb|ABB57860.1| thioredoxin [Synechococcus elongatus PCC 7942]
          Length = 107

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 65/88 (73%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A  V   +F  EVLE S PV+VDFWA WC PC  ++P++D+IA + +D+VK+ K++ +E+
Sbjct: 4  AAAVTDATFKQEVLESSIPVLVDFWAPWCGPCRMVAPVVDEIAQQYSDQVKVVKVNTDEN 63

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
            ++++Y I SIPTL++FKDG+ +D ++
Sbjct: 64 PSVASQYGIRSIPTLMIFKDGQRVDTVV 91


>gi|254449285|ref|ZP_05062731.1| thioredoxin [gamma proteobacterium HTCC5015]
 gi|198261094|gb|EDY85393.1| thioredoxin [gamma proteobacterium HTCC5015]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FDSEVLE   PV+VD+WA WC PC  ++PI+D++A+E   ++K+ KL+I+E+ +   +Y
Sbjct: 12  TFDSEVLESDLPVLVDYWAEWCGPCKMIAPILDEVAEEYKGRLKVAKLNIDENGDTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL++FK G V D    GA S+S +I ++
Sbjct: 72  GIRGIPTLMIFKGGNV-DATKVGALSKSQLIAFV 104


>gi|167629921|ref|YP_001680420.1| thioredoxin [Heliobacterium modesticaldum Ice1]
 gi|167592661|gb|ABZ84409.1| thioredoxin [Heliobacterium modesticaldum Ice1]
          Length = 109

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 60/79 (75%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F ++VL+ S PV+VDFWA+WC PC  ++PIID++AD +A K  + KL+++E+   +  Y
Sbjct: 13 NFRTQVLQSSKPVLVDFWAAWCGPCKMIAPIIDEVADAMAGKAVVGKLNVDENRATAAEY 72

Query: 70 QISSIPTLILFKDGKVIDR 88
           I SIPTL++FK G+V+D+
Sbjct: 73 GIMSIPTLLVFKGGQVVDK 91


>gi|169797143|ref|YP_001714936.1| thioredoxin [Acinetobacter baumannii AYE]
 gi|260556045|ref|ZP_05828264.1| thioredoxin [Acinetobacter baumannii ATCC 19606]
 gi|169150070|emb|CAM87964.1| thioredoxin [Acinetobacter baumannii AYE]
 gi|260410100|gb|EEX03399.1| thioredoxin [Acinetobacter baumannii ATCC 19606]
          Length = 120

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MSALKVDTK--SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T   +F ++VL+   PV+VDFWA WC PC  ++P+++D++ E A KVKI K+D
Sbjct: 13  MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSSEYAGKVKIVKVD 72

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    E + +Y I +IP L+LFK+G+V+ + + GA  +S ++ +I
Sbjct: 73  VTSCEETAVKYNIRNIPALLLFKNGEVVAQQI-GAVPRSKLVSFI 116


>gi|168181911|ref|ZP_02616575.1| thioredoxin [Clostridium botulinum Bf]
 gi|237796895|ref|YP_002864447.1| thioredoxin [Clostridium botulinum Ba4 str. 657]
 gi|182674782|gb|EDT86743.1| thioredoxin [Clostridium botulinum Bf]
 gi|229262953|gb|ACQ53986.1| thioredoxin [Clostridium botulinum Ba4 str. 657]
          Length = 105

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 61/80 (76%)

Query: 11 FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
          F  EVL    PVVVDFWA+WC PC  L+P+++++++EL  KVK  K++++E+  IST+Y+
Sbjct: 10 FGEEVLNSEIPVVVDFWATWCGPCKMLAPVVEEVSEELGQKVKFVKVNVDENPVISTQYK 69

Query: 71 ISSIPTLILFKDGKVIDRMM 90
          I+SIPTL+ FK GK ++ ++
Sbjct: 70 IASIPTLMTFKAGKAVETLV 89


>gi|167749012|ref|ZP_02421139.1| hypothetical protein ANACAC_03793 [Anaerostipes caccae DSM 14662]
 gi|167651634|gb|EDR95763.1| hypothetical protein ANACAC_03793 [Anaerostipes caccae DSM 14662]
          Length = 106

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + +  ++F SEVLE   P++VDFWA WC  C ++SP +D I ++  D V+I K++I+
Sbjct: 1   MSIINITKENFQSEVLEAKKPILVDFWAPWCGYCRRISPALDQIGEDREDSVQIGKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ R+ + +IPT+ILFKDGK  + ++  A ++  I +W+
Sbjct: 61  EQMELAERFGVMTIPTMILFKDGKAGEPLV-AAQTRDQIEQWM 102


>gi|114798336|ref|YP_760583.1| thioredoxin [Hyphomonas neptunium ATCC 15444]
 gi|114738510|gb|ABI76635.1| thioredoxin [Hyphomonas neptunium ATCC 15444]
          Length = 106

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+ V+   FD  V E   PVVVDFWA WC PC ++SP ++ +++E+  KVKI K++++
Sbjct: 1   MAAINVNEDDFDGVVTESETPVVVDFWAEWCGPCKQMSPHLEAVSEEMTGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +   +  RY +  +PTL++FK GKV      GA ++  + +WI
Sbjct: 61  DYPLVGARYGVRGLPTLLMFKGGKVT-ATRNGAMNRQALTDWI 102


>gi|41410438|ref|NP_963274.1| TrxC [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|15808974|gb|AAL08576.1|AF418548_2 thioredoxin [Mycobacterium avium subsp. paratuberculosis]
 gi|41399272|gb|AAS06890.1| TrxC [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 117

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E  D + + KLD++ 
Sbjct: 9   ATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++
Sbjct: 69  NPETAQNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALL 106


>gi|302870717|ref|YP_003839354.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
 gi|302573576|gb|ADL49778.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
          Length = 107

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 73/106 (68%), Gaps = 2/106 (1%)

Query: 1   MSALKVDT-KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M A K  T  SF S+VL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I
Sbjct: 1   MGATKAVTDASFVSDVLQSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMKDQVTIVKLNI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +E+ E +  Y++ S+PTL +FK+G+ +  +  GA  + ++++ I S
Sbjct: 61  DENPETARAYRVMSVPTLTIFKNGQPVQSIA-GAKPKGELVKLIES 105


>gi|254281829|ref|ZP_04956797.1| thioredoxin [gamma proteobacterium NOR51-B]
 gi|219678032|gb|EED34381.1| thioredoxin [gamma proteobacterium NOR51-B]
          Length = 108

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+S+VL    PV+VDFWA WC PC  ++P++++IA E A K+K+ K+D++ + 
Sbjct: 6   VHVTDTSFESDVLTADEPVLVDFWAEWCGPCKMIAPVLEEIAAEYAGKLKVAKVDVDSNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTLILFKDG  +D  + GA S+S + E+I
Sbjct: 66  GTPEKFGIRGIPTLILFKDGNAVDTKV-GALSKSQLAEFI 104


>gi|134103805|ref|YP_001109466.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338]
 gi|291005737|ref|ZP_06563710.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338]
 gi|133916428|emb|CAM06541.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338]
          Length = 108

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 73/105 (69%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + VDT SF S VL+   PV+VDFWA+WC PC  ++P++++IA E  DK+ + KLDI++
Sbjct: 4   NTVTVDTDSFKSVVLDSDKPVLVDFWATWCGPCKMVAPVLEEIAGEHGDKLTVAKLDIDK 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDIIEWI 103
           +  + + YQ+ SIPTL+LF  G+ + +++   P A+  SD+ +++
Sbjct: 64  NPSLQSEYQVMSIPTLLLFSGGEPVKQIVGAKPKAALLSDLQDYL 108


>gi|298345827|ref|YP_003718514.1| thioredoxin [Mobiluncus curtisii ATCC 43063]
 gi|304390470|ref|ZP_07372423.1| thioredoxin [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|298235888|gb|ADI67020.1| thioredoxin [Mobiluncus curtisii ATCC 43063]
 gi|304326226|gb|EFL93471.1| thioredoxin [Mobiluncus curtisii subsp. curtisii ATCC 35241]
          Length = 108

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 65/91 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A++V   +F +EVLE   PV+VDFWA WC PC +++PI+D IA +  D++K+ K D+++
Sbjct: 3  AAIEVTESNFAAEVLESDVPVLVDFWAVWCGPCRQMAPIVDQIAADFGDRLKVAKCDVDK 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPG 92
          +  +  +Y +S+IPT  +FK GKV+ +++ G
Sbjct: 63 NPSLQAQYGVSAIPTFNIFKGGKVVHQIIGG 93


>gi|154485128|ref|ZP_02027576.1| hypothetical protein EUBVEN_02851 [Eubacterium ventriosum ATCC
           27560]
 gi|149734081|gb|EDM50200.1| hypothetical protein EUBVEN_02851 [Eubacterium ventriosum ATCC
           27560]
          Length = 102

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 77/103 (74%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+SEVL+    V+VDFWA+WC PC  +SPII+++ +EL D VK+ K+D++
Sbjct: 1   MAVLHLTKENFESEVLKSDKKVLVDFWATWCGPCQMVSPIIEELGEELTD-VKVCKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  EIS +Y I SIPTLI+F++G++ ++ + GA ++ +I++ +
Sbjct: 60  KEPEISIQYNIMSIPTLIVFENGEIANKTI-GACTKDEILDLL 101


>gi|18311337|ref|NP_563271.1| thioredoxin [Clostridium perfringens str. 13]
 gi|110798962|ref|YP_697044.1| thioredoxin [Clostridium perfringens ATCC 13124]
 gi|168205184|ref|ZP_02631189.1| thioredoxin [Clostridium perfringens E str. JGS1987]
 gi|168210341|ref|ZP_02635966.1| thioredoxin [Clostridium perfringens B str. ATCC 3626]
 gi|168213266|ref|ZP_02638891.1| thioredoxin [Clostridium perfringens CPE str. F4969]
 gi|168216680|ref|ZP_02642305.1| thioredoxin [Clostridium perfringens NCTC 8239]
 gi|182625786|ref|ZP_02953553.1| thioredoxin [Clostridium perfringens D str. JGS1721]
 gi|18146021|dbj|BAB82061.1| thioredoxin [Clostridium perfringens str. 13]
 gi|110673609|gb|ABG82596.1| thioredoxin [Clostridium perfringens ATCC 13124]
 gi|170663309|gb|EDT15992.1| thioredoxin [Clostridium perfringens E str. JGS1987]
 gi|170711561|gb|EDT23743.1| thioredoxin [Clostridium perfringens B str. ATCC 3626]
 gi|170715252|gb|EDT27434.1| thioredoxin [Clostridium perfringens CPE str. F4969]
 gi|177908942|gb|EDT71429.1| thioredoxin [Clostridium perfringens D str. JGS1721]
 gi|182381156|gb|EDT78635.1| thioredoxin [Clostridium perfringens NCTC 8239]
          Length = 104

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            ++ + F++EV+E S  VVVDFWA+WC PC  ++P+I+++A+E+ + VK  K+D++++  
Sbjct: 4   HINDQDFNTEVIEASEVVVVDFWATWCGPCKMIAPVIEELANEM-ENVKFVKVDVDKNPG 62

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +YQI SIPTL++FKDGKV+D ++ G   ++ ++E I   V
Sbjct: 63  SAGKYQIQSIPTLLIFKDGKVVDTLV-GFRPKAALVEAIKKYV 104


>gi|258545112|ref|ZP_05705346.1| thioredoxin-1 [Cardiobacterium hominis ATCC 15826]
 gi|258519631|gb|EEV88490.1| thioredoxin-1 [Cardiobacterium hominis ATCC 15826]
          Length = 107

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 74/104 (71%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F +EV+  + PV+VDFWA+WC PC  ++P ++ +A E   K+KI K+D++ ++
Sbjct: 5   IAVGEANFHAEVIASAVPVLVDFWATWCGPCKAIAPELEALAAETEGKLKIVKVDVDANN 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++ +Y I SIPTL+LFK+G+++D  + G +S+ D++ ++ S +
Sbjct: 65  DLAAQYGIRSIPTLLLFKNGELVDNHI-GLASKQDLLNFVQSHI 107


>gi|212550707|ref|YP_002309024.1| thioredoxin [Candidatus Azobacteroides pseudotrichonymphae
          genomovar. CFP2]
 gi|212548945|dbj|BAG83613.1| thioredoxin [Candidatus Azobacteroides pseudotrichonymphae
          genomovar. CFP2]
          Length = 104

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 74/97 (76%), Gaps = 2/97 (2%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A+++   +F+ E+L  + P++VDFWA WC PC  ++PII+++A E  ++V I K++++++
Sbjct: 2  AIQITDNNFN-ELLASTKPLIVDFWAEWCAPCRMIAPIIEELASEYKERVIIGKVNVDQN 60

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           E+S++Y I SIPTL+ FK+G+++D+ + G +S++DI
Sbjct: 61 EELSSKYNIRSIPTLLFFKNGELVDKQI-GGTSKNDI 96


>gi|83594762|ref|YP_428514.1| thioredoxin [Rhodospirillum rubrum ATCC 11170]
 gi|83577676|gb|ABC24227.1| Thioredoxin [Rhodospirillum rubrum ATCC 11170]
          Length = 104

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   SF+ +VL+   PV+VDFWA WC PC +++P ++++A  L DKV + K++I+E+ +
Sbjct: 3   QVSDASFEEDVLKADGPVLVDFWAEWCGPCRQIAPALEELATALGDKVTVAKINIDENPQ 62

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++Y +  IPTL++FKDG+V    + GA  ++ + EW+ + V
Sbjct: 63  TPSKYGVRGIPTLMIFKDGQVAATKI-GALPKTKLFEWVEASV 104


>gi|240949004|ref|ZP_04753358.1| thioredoxin [Actinobacillus minor NM305]
 gi|257465348|ref|ZP_05629719.1| thioredoxin [Actinobacillus minor 202]
 gi|240296591|gb|EER47209.1| thioredoxin [Actinobacillus minor NM305]
 gi|257451008|gb|EEV25051.1| thioredoxin [Actinobacillus minor 202]
          Length = 105

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 71/100 (71%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L+V   +F+ EVL+   PV++DFWA WC PC  ++PI+D++++E A + KI K++++E+ 
Sbjct: 3   LQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVAPILDELSEEFAGRAKIAKVNVDENQ 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I  ++ I SIPTLILFK+G+V+   + GA  +S +  ++
Sbjct: 63  QIPAQFGIRSIPTLILFKNGQVVATQV-GALPKSQLAAFV 101


>gi|237786644|ref|YP_002907349.1| thioredoxin [Corynebacterium kroppenstedtii DSM 44385]
 gi|237759556|gb|ACR18806.1| thioredoxin [Corynebacterium kroppenstedtii DSM 44385]
          Length = 107

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S + V T SF S V++   PV+VDFWA+WC PC  ++P++++IADE   K  I K++++E
Sbjct: 3  SPVNVTTDSFRSTVVDSDKPVLVDFWATWCGPCRTMNPVLEEIADEYDGKAVIAKVNVDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          ++ +++ +Q+ SIPT++LFKDGK ++ +  GA  +S I
Sbjct: 63 NAPLASMFQVMSIPTMLLFKDGKKVEEIH-GAHPKSHI 99


>gi|134298769|ref|YP_001112265.1| thioredoxin [Desulfotomaculum reducens MI-1]
 gi|134051469|gb|ABO49440.1| thioredoxin [Desulfotomaculum reducens MI-1]
          Length = 105

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 74/97 (76%), Gaps = 1/97 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL+++  +F++EVL+   PV+VDFWA+WC PC  ++P+++ ++ E A KVK+ K++++E+
Sbjct: 2  ALELNAANFEAEVLKSDIPVLVDFWAAWCGPCRAIAPVVEQLSTEYAGKVKVGKVNVDEN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           E++ ++ + SIPTLI  K+G+ +D+++ G + ++D+
Sbjct: 62 RELAQQFGVMSIPTLIFLKNGEKVDQVI-GFTGKADL 97


>gi|291525190|emb|CBK90777.1| thioredoxin [Eubacterium rectale DSM 17629]
          Length = 101

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F++EVL     V++DFWASWC PC ++ PI+++IADE  D +K+ K++++
Sbjct: 1   MSAININKNNFENEVLNSDKTVLLDFWASWCAPCRRVVPIVEEIADERRD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIVQQ-VSGARPKNAILEML 101


>gi|238923597|ref|YP_002937113.1| thiol-disulfide isomerase and thioredoxin [Eubacterium rectale ATCC
           33656]
 gi|238875272|gb|ACR74979.1| thiol-disulfide isomerase and thioredoxin [Eubacterium rectale ATCC
           33656]
 gi|291528214|emb|CBK93800.1| thioredoxin [Eubacterium rectale M104/1]
          Length = 101

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F++EVL     V++DFWASWC PC ++ PI+++IADE  D +K+ K++++
Sbjct: 1   MSAININKNNFENEVLNSDKTVLLDFWASWCAPCRRVVPIVEEIADERMD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIVQQ-VSGARPKNAILEML 101


>gi|220933543|ref|YP_002512442.1| thioredoxin [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994853|gb|ACL71455.1| thioredoxin [Thioalkalivibrio sp. HL-EbGR7]
          Length = 108

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SF+ EVL+   PV+VD+WA WC PC  ++PI+D+IA E  D+VKI KL+I+E+ 
Sbjct: 6   LHVTDASFEDEVLKSEQPVLVDYWAEWCGPCKMIAPILDEIASEYGDRVKIAKLNIDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               +Y I  IPTL+LFK G V +    GA S+S +  ++
Sbjct: 66  GTPPKYGIRGIPTLMLFKGGSV-EATKVGALSKSQLTAFL 104


>gi|157371981|ref|YP_001479970.1| thioredoxin 2 [Serratia proteamaculans 568]
 gi|157323745|gb|ABV42842.1| thioredoxin [Serratia proteamaculans 568]
          Length = 139

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 66/104 (63%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVVVDFWA WC PCV  +PI +D+A+E A KV+  K++ 
Sbjct: 33  FDGEVINATAATLDSLLQDGLPVVVDFWAPWCGPCVSFAPIFEDVAEERAGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R++I SIPT++LF++GK++D M+ GA  ++    W+
Sbjct: 93  EAEPELSARFRIRSIPTIMLFREGKMVD-MLNGAMPKTPFDNWL 135


>gi|1729953|sp|P52233|THIO_THIFE RecName: Full=Thioredoxin; Short=Trx
 gi|664829|gb|AAA88939.1| thioredoxin [Acidithiobacillus ferrooxidans]
          Length = 108

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SF+++VL+ S PV+VDFWA WC PC  ++PI+++IADE AD++++ K +I+E+ 
Sbjct: 6   LYVSDDSFETDVLKSSKPVLVDFWAEWCGPCKMIAPILEEIADEYADRLRVAKFNIDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               +Y I  IPTL+LFK GK ++    GA S++ +  ++ S++
Sbjct: 66  NTPPQYAIRGIPTLLLFKAGK-LEATKVGALSKAQLTAFLDSQL 108


>gi|83749757|ref|ZP_00946733.1| Thioredoxin [Ralstonia solanacearum UW551]
 gi|207723135|ref|YP_002253534.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum MolK2]
 gi|207743472|ref|YP_002259864.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum
           IPO1609]
 gi|300704441|ref|YP_003746044.1| thioredoxin [Ralstonia solanacearum CFBP2957]
 gi|83723577|gb|EAP70779.1| Thioredoxin [Ralstonia solanacearum UW551]
 gi|206588328|emb|CAQ35291.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum MolK2]
 gi|206594869|emb|CAQ61796.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum
           IPO1609]
 gi|299072105|emb|CBJ43437.1| thioredoxin [Ralstonia solanacearum CFBP2957]
          Length = 108

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 72/102 (70%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+++VL+   PV+VDFWA WC PC  ++PI+D+++ + ADKV+I KL+++E++ +
Sbjct: 8   VSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYADKVQIAKLNVDENAGV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ I  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 68  PAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|58039095|ref|YP_191059.1| thioredoxin [Gluconobacter oxydans 621H]
 gi|58001509|gb|AAW60403.1| Thioredoxin [Gluconobacter oxydans 621H]
          Length = 108

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 1   MSA--LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  + V   SF+++VL+   PV+VDFWA WC PC  ++P +++I  E   ++K+ K++
Sbjct: 1   MSANTVAVSDSSFEADVLKSEGPVLVDFWAEWCGPCKMIAPALEEIGAEYQGRLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I+ + E  T+Y + SIPTLI+FKDGK + + M GA  +S +  WI
Sbjct: 61  IDSNPEAPTKYGVRSIPTLIVFKDGKPVAQQM-GALPKSQLKAWI 104


>gi|317509440|ref|ZP_07967058.1| thioredoxin [Segniliparus rugosus ATCC BAA-974]
 gi|316252269|gb|EFV11721.1| thioredoxin [Segniliparus rugosus ATCC BAA-974]
          Length = 109

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 69/99 (69%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S L V   SF  +VL    PV+VDFWASWC PC  ++P++++IA E A K+ + KLD++ 
Sbjct: 7   STLTVTDSSFAQDVLASEQPVLVDFWASWCGPCRMVAPVLEEIAKEQAGKLVVAKLDVDA 66

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + + ST+Y+I SIP LILFK+G+ + +++ GA  ++ I+
Sbjct: 67  NPKTSTKYEIGSIPNLILFKNGEPVKQIV-GAKPKAAIL 104


>gi|169347076|ref|ZP_02866018.1| thioredoxin [Clostridium perfringens C str. JGS1495]
 gi|169296759|gb|EDS78888.1| thioredoxin [Clostridium perfringens C str. JGS1495]
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 74/99 (74%), Gaps = 2/99 (2%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            ++ + F++EV+E S  VVVDFWA+WC PC  ++P+I+++A+E+ + VK  K+D++++  
Sbjct: 4   HINDQDFNTEVIEASEVVVVDFWATWCGPCKMIAPVIEELANEM-ENVKFVKVDVDKNPG 62

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + +YQI SIPTL++FKDGKV+D ++ G   ++ ++E I
Sbjct: 63  SAGKYQIQSIPTLLIFKDGKVVDTLV-GFRPKAALVEAI 100


>gi|270265374|ref|ZP_06193635.1| thioredoxin 2 [Serratia odorifera 4Rx13]
 gi|270040778|gb|EFA13881.1| thioredoxin 2 [Serratia odorifera 4Rx13]
          Length = 139

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 60/83 (72%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PCV  +P+ +D+A+E A KV+  K++ E   E+S R++I SIPT++LF
Sbjct: 54  PVVVDFWAPWCGPCVNFAPVFEDVAEERAGKVRFVKVNTEAEPELSARFRIRSIPTIMLF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           ++GK++D M+ GA  ++    W+
Sbjct: 114 REGKMVD-MLNGAMPKTPFDNWL 135


>gi|257469080|ref|ZP_05633174.1| thioredoxin [Fusobacterium ulcerans ATCC 49185]
 gi|317063326|ref|ZP_07927811.1| thioredoxin [Fusobacterium ulcerans ATCC 49185]
 gi|313689002|gb|EFS25837.1| thioredoxin [Fusobacterium ulcerans ATCC 49185]
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EVL+   PV+VDFWA+WC PC  L PI+++   ELA  VKI K++I+
Sbjct: 1   MAILHITKENFEQEVLKSDVPVLVDFWAAWCGPCKALGPILEEAESELAPGVKIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E  +++ ++++ SIPTLILFK+G+ +++ + G  S+  ++E
Sbjct: 61  EQEDLAGQFRVMSIPTLILFKNGQPVEKSV-GLVSKDKVLE 100


>gi|225377057|ref|ZP_03754278.1| hypothetical protein ROSEINA2194_02701 [Roseburia inulinivorans DSM
           16841]
 gi|225211093|gb|EEG93447.1| hypothetical protein ROSEINA2194_02701 [Roseburia inulinivorans DSM
           16841]
          Length = 101

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F++EVL     V++DFWASWC PC  + PI+++IADE  D +K+ K++++
Sbjct: 1   MSAININKNNFENEVLNSDKTVLLDFWASWCAPCRMVVPIVEEIADERRD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E +E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EETELANKFSIMSIPTLVVMKNGKIVQQ-VSGARPKNAILEML 101


>gi|189219153|ref|YP_001939794.1| Thiol-disulfide isomerase or thioredoxin [Methylacidiphilum
           infernorum V4]
 gi|189186011|gb|ACD83196.1| Thiol-disulfide isomerase or thioredoxin [Methylacidiphilum
           infernorum V4]
          Length = 111

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V +K FD+EVL+    VVVDFWA WC PC  LSP++D++A EL  KVK  K+++++   +
Sbjct: 9   VTSKDFDNEVLKSPQVVVVDFWAEWCGPCHMLSPVLDELAKELDGKVKFVKVNVDQEPNL 68

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + ++ I SIPTL++FK G+V  + + G +S+S I+  I
Sbjct: 69  AYQFSIQSIPTLLIFKGGQVKGKQI-GVTSKSHILNKI 105


>gi|157964074|ref|YP_001498898.1| thioredoxin [Rickettsia massiliae MTU5]
 gi|157843850|gb|ABV84351.1| Thioredoxin [Rickettsia massiliae MTU5]
          Length = 109

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+    + Y
Sbjct: 13  SFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I SIPT++LFK+G+  D  + G   +  +++WI
Sbjct: 73  DIRSIPTIMLFKNGEQKDTKI-GLQQKKSLLDWI 105


>gi|198282942|ref|YP_002219263.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218668089|ref|YP_002425145.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247463|gb|ACH83056.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218520302|gb|ACK80888.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 108

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SF+++VL+ S PV+VDFWA WC PC  ++PI+++IADE AD++++ K +I+E+ 
Sbjct: 6   LYVSDDSFETDVLKSSKPVLVDFWAEWCGPCKMIAPILEEIADEYADRLRVAKFNIDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               +Y I  IPTL+LFK GK ++    GA S++ +  ++ S++
Sbjct: 66  NTPPQYGIRGIPTLLLFKAGK-LEATKVGALSKAQLTAFLDSQL 108


>gi|297569606|ref|YP_003690950.1| thioredoxin [Desulfurivibrio alkaliphilus AHT2]
 gi|296925521|gb|ADH86331.1| thioredoxin [Desulfurivibrio alkaliphilus AHT2]
          Length = 109

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 63/86 (73%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L++    FD++VL+ S PV+VDFWA WC PC  + P+I+ +A+E A KV I K+++++S 
Sbjct: 7  LEISDADFDAQVLKNSLPVLVDFWAPWCGPCKAIGPVIEQLAEEYAGKVAIAKMNVDDSP 66

Query: 64 EISTRYQISSIPTLILFKDGKVIDRM 89
              +Y I +IPTLI+FK+G+V+D++
Sbjct: 67 STPGKYGIRAIPTLIMFKNGEVVDQI 92


>gi|114568641|ref|YP_755321.1| thioredoxin [Maricaulis maris MCS10]
 gi|114339103|gb|ABI64383.1| thioredoxin [Maricaulis maris MCS10]
          Length = 106

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V  +SF+S+V+  S PV+VDFWA WC PC ++SP +++IA+E++  + + K++I+
Sbjct: 1   MATKAVSDESFESDVINASGPVLVDFWAEWCGPCKQISPALEEIAEEMSGSLTVAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +      +Y +  IPTL++FKDG+V+   + GA ++  I EW+
Sbjct: 61  DHPMTPGKYGVRGIPTLMIFKDGQVVSTKI-GAMAKGKISEWV 102


>gi|241765924|ref|ZP_04763853.1| thioredoxin [Acidovorax delafieldii 2AN]
 gi|241364121|gb|EER59336.1| thioredoxin [Acidovorax delafieldii 2AN]
          Length = 145

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +D  SF   V     PV+VDFWA WC PC +++P     A EL   V++ KLD E   
Sbjct: 43  LALDAASFSRHVGRSHIPVLVDFWAPWCGPCRQMAPAFAQAARELEPGVRLAKLDTEAHP 102

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +++  Y I SIPT++LFK G+ + R+  GA   +DI+ W+ S
Sbjct: 103 QVAAPYNIRSIPTMVLFKGGREVARIS-GALGAADIVRWVRS 143


>gi|237747651|ref|ZP_04578131.1| thioredoxin [Oxalobacter formigenes OXCC13]
 gi|229379013|gb|EEO29104.1| thioredoxin [Oxalobacter formigenes OXCC13]
          Length = 108

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI+D++A E A KV  TK+D++ +     ++
Sbjct: 12  SFEADVLKSDKPVLVDFWAEWCGPCKMIAPIVDEVASEYAGKVNFTKMDVDSNPATPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTLILFK+G ++ + + GA S+S +  +I S +
Sbjct: 72  GIRGIPTLILFKNGAIVSQKV-GALSKSQLTAFIDSNI 108


>gi|148381374|ref|YP_001255915.1| thioredoxin [Clostridium botulinum A str. ATCC 3502]
 gi|153930798|ref|YP_001385749.1| thioredoxin [Clostridium botulinum A str. ATCC 19397]
 gi|153937738|ref|YP_001389156.1| thioredoxin [Clostridium botulinum A str. Hall]
 gi|153941050|ref|YP_001392787.1| thioredoxin [Clostridium botulinum F str. Langeland]
 gi|168178879|ref|ZP_02613543.1| thioredoxin [Clostridium botulinum NCTC 2916]
 gi|170754340|ref|YP_001783074.1| thioredoxin [Clostridium botulinum B1 str. Okra]
 gi|170759245|ref|YP_001788774.1| thioredoxin [Clostridium botulinum A3 str. Loch Maree]
 gi|226950886|ref|YP_002805977.1| thioredoxin [Clostridium botulinum A2 str. Kyoto]
 gi|148290858|emb|CAL84994.1| thioredoxin [Clostridium botulinum A str. ATCC 3502]
 gi|152926842|gb|ABS32342.1| thioredoxin [Clostridium botulinum A str. ATCC 19397]
 gi|152933652|gb|ABS39151.1| thioredoxin [Clostridium botulinum A str. Hall]
 gi|152936946|gb|ABS42444.1| thioredoxin [Clostridium botulinum F str. Langeland]
 gi|169119552|gb|ACA43388.1| thioredoxin [Clostridium botulinum B1 str. Okra]
 gi|169406234|gb|ACA54645.1| thioredoxin [Clostridium botulinum A3 str. Loch Maree]
 gi|182669941|gb|EDT81917.1| thioredoxin [Clostridium botulinum NCTC 2916]
 gi|226840819|gb|ACO83485.1| thioredoxin [Clostridium botulinum A2 str. Kyoto]
 gi|295320767|gb|ADG01145.1| thioredoxin [Clostridium botulinum F str. 230613]
 gi|322807759|emb|CBZ05334.1| thioredoxin [Clostridium botulinum H04402 065]
          Length = 105

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 60/80 (75%)

Query: 11 FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
          F  EVL    PVVVDFWA+WC PC  L+P++++++ EL  KVK  K++++E+  IST+Y+
Sbjct: 10 FGEEVLNSEIPVVVDFWATWCGPCKMLAPVVEEVSQELGQKVKFVKVNVDENPVISTQYK 69

Query: 71 ISSIPTLILFKDGKVIDRMM 90
          I+SIPTL+ FK GK ++ ++
Sbjct: 70 IASIPTLMTFKAGKAVETLV 89


>gi|42523902|ref|NP_969282.1| thioredoxin [Bdellovibrio bacteriovorus HD100]
 gi|39576109|emb|CAE80275.1| thioredoxin [Bdellovibrio bacteriovorus HD100]
          Length = 108

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD+EVL  S PV+VDFWA WC PC  L+P ++++A EL  KVKI K++++E+  +  +Y
Sbjct: 12  SFDAEVLNSSTPVLVDFWAEWCGPCRALAPKLEEVAQELGAKVKIVKVNVDENPSVPGKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IP ++LFK G  + +++ G   +  I+E++   V
Sbjct: 72  GIRGIPAMLLFKGGSEVGQLV-GNHPKDAILEFLNKNV 108


>gi|256827316|ref|YP_003151275.1| thioredoxin [Cryptobacterium curtum DSM 15641]
 gi|256583459|gb|ACU94593.1| thioredoxin [Cryptobacterium curtum DSM 15641]
          Length = 102

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 69/95 (72%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A ++ ++ F+ +VL+   PV+VDF+A+WC PC  +SP+ID++A ++  K  + KLD++ES
Sbjct: 2  AQQISSQEFEEKVLKSDKPVLVDFFATWCGPCKMMSPVIDEVATDMEGKAAVYKLDVDES 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          S+I+ RY + SIPTLI+F++G+V ++ +     Q+
Sbjct: 62 SDIAQRYGVMSIPTLIVFENGEVKNQTLGAQPKQA 96


>gi|118575237|ref|YP_874980.1| thiol-disulfide isomerase [Cenarchaeum symbiosum A]
 gi|118193758|gb|ABK76676.1| thiol-disulfide isomerase [Cenarchaeum symbiosum A]
          Length = 110

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 65/91 (71%)

Query: 7  DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
          DTKS++S+V+    PV VDFWA WC PC  ++P+++++A +   KV   K++++E++E++
Sbjct: 8  DTKSWESDVMNSPTPVFVDFWAEWCGPCRMVTPVVEELASDYEGKVSFVKVNVDEANELA 67

Query: 67 TRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          +RY + SIPTL LF  GK+I + +  AS ++
Sbjct: 68 SRYNVFSIPTLALFSKGKIIGQQVGAASKEA 98


>gi|218885506|ref|YP_002434827.1| thioredoxin [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756460|gb|ACL07359.1| thioredoxin [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 107

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A+++   +F++ VL+ S PV++DFWA WC PC  + P+ID++A E   KV I K++++E+
Sbjct: 2   AVQITDANFEANVLKSSIPVLIDFWAPWCGPCRAMGPVIDELAAEYDGKVLIAKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               ++Y I +IPTLILFK G+V++++  GA S+S I + I  +
Sbjct: 62  PATPSKYGIRAIPTLILFKGGEVVEQIT-GAVSKSSIKDMIAQK 104


>gi|261415167|ref|YP_003248850.1| thioredoxin [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261371623|gb|ACX74368.1| thioredoxin [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302327996|gb|ADL27197.1| thioredoxin [Fibrobacter succinogenes subsp. succinogenes S85]
          Length = 102

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EVL+   PV++DFWA WC PC  LSP I +IA+E  DKVK+ K++++
Sbjct: 1   MAELNITRENFEQEVLKSDKPVLIDFWAQWCGPCRMLSPTISEIAEEYKDKVKVCKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  +++  +++SSIP L++ KDGKV +  + G   +  I++ I
Sbjct: 61  EEGDLAAMFRVSSIPLLVVMKDGKVTNSAV-GVRPKDQIVKMI 102


>gi|149922768|ref|ZP_01911193.1| Thioredoxin [Plesiocystis pacifica SIR-1]
 gi|149816388|gb|EDM75889.1| Thioredoxin [Plesiocystis pacifica SIR-1]
          Length = 107

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/85 (45%), Positives = 63/85 (74%), Gaps = 2/85 (2%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F+++V+  S PVVVDFWA+WC PC  + P ++   DE  D +KI KL++EE+  I+TR+
Sbjct: 11 TFETDVINSSTPVVVDFWATWCAPCKAMVPHLEKAQDEHGDALKIVKLNVEENPNIATRF 70

Query: 70 QISSIPTLILFKDGKVIDRMM--PG 92
          ++  +PTL++FKDG+ +D+M+  PG
Sbjct: 71 KVLKLPTLLVFKDGQKVDQMIGNPG 95


>gi|88812098|ref|ZP_01127350.1| thioredoxin [Nitrococcus mobilis Nb-231]
 gi|88790602|gb|EAR21717.1| thioredoxin [Nitrococcus mobilis Nb-231]
          Length = 107

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + L++  ++F +EVL+   PV++D+WA WC PC  + PII+ +A+E A + K+ KL++++
Sbjct: 3   AVLELTDQNFHAEVLQSDRPVLIDYWAEWCAPCKAIGPIIEALAEEYAGRAKVGKLNVDD 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +   RY + SIPTL+LFKDG+ I  +  GA S++++ + I + +
Sbjct: 63  NPDTPMRYGVRSIPTLMLFKDGE-IQALKIGADSKAELAQLIEAHL 107


>gi|253575342|ref|ZP_04852680.1| thioredoxin [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845339|gb|EES73349.1| thioredoxin [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 105

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 68/90 (75%), Gaps = 1/90 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  +SF++E+ E   PV+VDFWA WC PC  ++PI++++  E+ D VKI KL+++
Sbjct: 1  MAIVNVSDQSFNAEI-EGQGPVLVDFWAPWCGPCKMIAPILEELDAEVGDSVKIAKLNVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          ++ E ++R+ + SIPTLILFKDG+ +D+++
Sbjct: 60 DNPETASRFGVMSIPTLILFKDGQPVDKIV 89


>gi|87308247|ref|ZP_01090388.1| thioredoxin 1 [Blastopirellula marina DSM 3645]
 gi|87288804|gb|EAQ80697.1| thioredoxin 1 [Blastopirellula marina DSM 3645]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A + +  +F++EVL+ + PV+VDFWA WC PC +L+P+ID ++ E     K+ K+D +++
Sbjct: 2   AKEFNEANFETEVLQSTEPVLVDFWAPWCGPCRQLAPVIDQLSQEYESGAKVGKVDTDQN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             ++ +Y I SIPT+++FKDG+V+ + M G   +S + E I
Sbjct: 62  PSLARKYGIQSIPTVMIFKDGEVVSQFM-GVQPKSKLQEAI 101


>gi|135745|sp|P07887|THIO2_CORNE RecName: Full=Thioredoxin C-2
 gi|80613|pir||S02802 thioredoxin C-2 - coryneform bacterium
 gi|40539|emb|CAA32779.1| unnamed protein product [Corynebacterium nephridii]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 74/105 (70%), Gaps = 3/105 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T  ++F ++VL+   PV+VDFWA WC PC  ++P+++++++E A KVKI K+D
Sbjct: 1   MSATIVNTTDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEELSNEYAGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    + + +Y I +IP L++FKDG+V+ + + GA+ +S +  +I
Sbjct: 61  VTSCEDTAVKYNIRNIPALLMFKDGEVVAQQV-GAAPRSKLAAFI 104


>gi|323136619|ref|ZP_08071700.1| thioredoxin [Methylocystis sp. ATCC 49242]
 gi|322397936|gb|EFY00457.1| thioredoxin [Methylocystis sp. ATCC 49242]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 61/83 (73%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MS  K+   +F+ EVL+ + PVVVDFWA WC PC  ++P +++IA E+  KVK+ KL+I+
Sbjct: 1  MSTQKITDATFEQEVLKSAEPVVVDFWAEWCGPCRMIAPALEEIAAEMKGKVKVVKLNID 60

Query: 61 ESSEISTRYQISSIPTLILFKDG 83
          E+  ++++  I SIPTLI+FKDG
Sbjct: 61 ENPAVASKLGIRSIPTLIIFKDG 83


>gi|326204352|ref|ZP_08194210.1| thioredoxin [Clostridium papyrosolvens DSM 2782]
 gi|325985384|gb|EGD46222.1| thioredoxin [Clostridium papyrosolvens DSM 2782]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 71/97 (73%), Gaps = 1/97 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F+S+VL+   PVVVDFWASWC PC  ++PI++++ADE   K +I K++++E  E++ +++
Sbjct: 13  FESDVLKSDKPVVVDFWASWCGPCRMVAPIMEELADEFDGKAQIAKVNVDEEGELAAQFR 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I SIPT+++FK G+ +++++ GA S+ +  E I   +
Sbjct: 73  IMSIPTVMVFKGGEAVEKIV-GARSKDEFAELIQKHL 108


>gi|83859060|ref|ZP_00952581.1| thioredoxin [Oceanicaulis alexandrii HTCC2633]
 gi|83852507|gb|EAP90360.1| thioredoxin [Oceanicaulis alexandrii HTCC2633]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   +F+++VL+   PV+VDFWA WC PC ++ P +++IA E A K+ I K++I+
Sbjct: 1   MATQAVTDDTFENDVLKADGPVLVDFWAEWCGPCKQIGPALEEIASEKAGKLTIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+    ++Y +  IPTL++FK+G+ + R + GA ++S I EWI   V
Sbjct: 61  ENPMAPSKYGVRGIPTLLIFKNGEEVSRKV-GAMAKSKIEEWINEAV 106


>gi|114319530|ref|YP_741213.1| thioredoxin [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225924|gb|ABI55723.1| thioredoxin [Alkalilimnicola ehrlichii MLHE-1]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F+ EV++   PV+VD+WA WC PC  ++PI+D++A E A K+K+ KL+I+E+ E   +
Sbjct: 11  QNFEDEVIKAGEPVLVDYWADWCGPCKMITPILDEVASEYAGKLKVVKLNIDENPETPPK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           Y I  IPTL+LFK+G V +    GA S+S +  +I S +
Sbjct: 71  YGIRGIPTLMLFKNGGV-EATKVGALSKSQLTAFIDSNL 108


>gi|15640334|ref|NP_229961.1| thioredoxin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121591060|ref|ZP_01678373.1| thioredoxin [Vibrio cholerae 2740-80]
 gi|121729653|ref|ZP_01682130.1| thioredoxin [Vibrio cholerae V52]
 gi|147675356|ref|YP_001218576.1| thioredoxin [Vibrio cholerae O395]
 gi|153803142|ref|ZP_01957728.1| thioredoxin [Vibrio cholerae MZO-3]
 gi|153819602|ref|ZP_01972269.1| thioredoxin [Vibrio cholerae NCTC 8457]
 gi|153822823|ref|ZP_01975490.1| thioredoxin [Vibrio cholerae B33]
 gi|153827151|ref|ZP_01979818.1| thioredoxin [Vibrio cholerae MZO-2]
 gi|153831015|ref|ZP_01983682.1| thioredoxin [Vibrio cholerae 623-39]
 gi|227080520|ref|YP_002809071.1| thioredoxin [Vibrio cholerae M66-2]
 gi|229506897|ref|ZP_04396405.1| thioredoxin [Vibrio cholerae BX 330286]
 gi|229509270|ref|ZP_04398753.1| thioredoxin [Vibrio cholerae B33]
 gi|229512686|ref|ZP_04402154.1| thioredoxin [Vibrio cholerae TMA 21]
 gi|229516214|ref|ZP_04405662.1| thioredoxin [Vibrio cholerae RC9]
 gi|229520975|ref|ZP_04410396.1| thioredoxin [Vibrio cholerae TM 11079-80]
 gi|229524736|ref|ZP_04414141.1| thioredoxin [Vibrio cholerae bv. albensis VL426]
 gi|229527199|ref|ZP_04416592.1| thioredoxin [Vibrio cholerae 12129(1)]
 gi|229606410|ref|YP_002877058.1| thioredoxin [Vibrio cholerae MJ-1236]
 gi|254227020|ref|ZP_04920580.1| thioredoxin [Vibrio cholerae V51]
 gi|254286223|ref|ZP_04961182.1| thioredoxin [Vibrio cholerae AM-19226]
 gi|254851440|ref|ZP_05240790.1| thioredoxin [Vibrio cholerae MO10]
 gi|255744104|ref|ZP_05418058.1| thioredoxin [Vibrio cholera CIRS 101]
 gi|258620668|ref|ZP_05715705.1| thioredoxin [Vibrio mimicus VM573]
 gi|258623758|ref|ZP_05718716.1| thioredoxin [Vibrio mimicus VM603]
 gi|261210410|ref|ZP_05924704.1| thioredoxin reductase [Vibrio sp. RC341]
 gi|262161996|ref|ZP_06031013.1| thioredoxin [Vibrio cholerae INDRE 91/1]
 gi|262163842|ref|ZP_06031582.1| thioredoxin [Vibrio mimicus VM223]
 gi|262167973|ref|ZP_06035672.1| thioredoxin [Vibrio cholerae RC27]
 gi|262192567|ref|ZP_06050717.1| thioredoxin [Vibrio cholerae CT 5369-93]
 gi|262405029|ref|ZP_06081581.1| thioredoxin [Vibrio sp. RC586]
 gi|297581768|ref|ZP_06943690.1| thioredoxin [Vibrio cholerae RC385]
 gi|298500938|ref|ZP_07010740.1| thioredoxin [Vibrio cholerae MAK 757]
 gi|9654719|gb|AAF93480.1| thioredoxin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121547093|gb|EAX57228.1| thioredoxin [Vibrio cholerae 2740-80]
 gi|121628587|gb|EAX61066.1| thioredoxin [Vibrio cholerae V52]
 gi|124121333|gb|EAY40076.1| thioredoxin [Vibrio cholerae MZO-3]
 gi|125620456|gb|EAZ48830.1| thioredoxin [Vibrio cholerae V51]
 gi|126509858|gb|EAZ72452.1| thioredoxin [Vibrio cholerae NCTC 8457]
 gi|126519641|gb|EAZ76864.1| thioredoxin [Vibrio cholerae B33]
 gi|146317239|gb|ABQ21778.1| thioredoxin [Vibrio cholerae O395]
 gi|148873507|gb|EDL71642.1| thioredoxin [Vibrio cholerae 623-39]
 gi|149738948|gb|EDM53266.1| thioredoxin [Vibrio cholerae MZO-2]
 gi|150423638|gb|EDN15580.1| thioredoxin [Vibrio cholerae AM-19226]
 gi|227008408|gb|ACP04620.1| thioredoxin [Vibrio cholerae M66-2]
 gi|227012165|gb|ACP08375.1| thioredoxin [Vibrio cholerae O395]
 gi|229335207|gb|EEO00691.1| thioredoxin [Vibrio cholerae 12129(1)]
 gi|229338317|gb|EEO03334.1| thioredoxin [Vibrio cholerae bv. albensis VL426]
 gi|229341860|gb|EEO06861.1| thioredoxin [Vibrio cholerae TM 11079-80]
 gi|229346640|gb|EEO11610.1| thioredoxin [Vibrio cholerae RC9]
 gi|229350196|gb|EEO15148.1| thioredoxin [Vibrio cholerae TMA 21]
 gi|229353585|gb|EEO18522.1| thioredoxin [Vibrio cholerae B33]
 gi|229356002|gb|EEO20921.1| thioredoxin [Vibrio cholerae BX 330286]
 gi|229369065|gb|ACQ59488.1| thioredoxin [Vibrio cholerae MJ-1236]
 gi|254847145|gb|EET25559.1| thioredoxin [Vibrio cholerae MO10]
 gi|255738369|gb|EET93760.1| thioredoxin [Vibrio cholera CIRS 101]
 gi|258583955|gb|EEW08746.1| thioredoxin [Vibrio mimicus VM603]
 gi|258587183|gb|EEW11895.1| thioredoxin [Vibrio mimicus VM573]
 gi|260840468|gb|EEX67034.1| thioredoxin reductase [Vibrio sp. RC341]
 gi|262023506|gb|EEY42208.1| thioredoxin [Vibrio cholerae RC27]
 gi|262027822|gb|EEY46487.1| thioredoxin [Vibrio mimicus VM223]
 gi|262028374|gb|EEY47030.1| thioredoxin [Vibrio cholerae INDRE 91/1]
 gi|262031612|gb|EEY50200.1| thioredoxin [Vibrio cholerae CT 5369-93]
 gi|262348868|gb|EEY98009.1| thioredoxin [Vibrio sp. RC586]
 gi|297534175|gb|EFH73014.1| thioredoxin [Vibrio cholerae RC385]
 gi|297540442|gb|EFH76501.1| thioredoxin [Vibrio cholerae MAK 757]
 gi|327483176|gb|AEA77583.1| Thioredoxin [Vibrio cholerae LMA3894-4]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++V++ + PV+VDFWA WC PC  ++PI+D++ADE A K+ I KL+I+ ++
Sbjct: 6   LQLTDDGFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEVADEYAGKLTIGKLNIDHNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V+   + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGSVVATKV-GALSKTQLKEFL 104


>gi|313114720|ref|ZP_07800222.1| thioredoxin [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310622945|gb|EFQ06398.1| thioredoxin [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 102

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F+ EVL+ + PV++DFWASWC PC  LSP++D++A+E  D VK+ K++++
Sbjct: 1   MAVVTITKENFEQEVLQSAKPVLLDFWASWCGPCRMLSPVVDEVAEERTD-VKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ + SIPTL++F+ GK++ R   GA  ++ +++ +
Sbjct: 60  EQPELAGQFGVMSIPTLLVFEQGKLV-RQAVGARPKASVLDLL 101


>gi|146278982|ref|YP_001169141.1| thioredoxin [Rhodobacter sphaeroides ATCC 17025]
 gi|145557223|gb|ABP71836.1| thioredoxin [Rhodobacter sphaeroides ATCC 17025]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV +   PVVVDFWA WC PC ++ P ++++++E A KVKI K++++
Sbjct: 1   MSTVPVTDATFDTEVRKSDVPVVVDFWAEWCGPCRQIGPALEELSNEYAGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E      +  IP L LFKDG+V+   + GA+ ++ +  WI S
Sbjct: 61  ENPESPAMLGVRGIPALFLFKDGQVVSNKV-GAAPKAALASWIAS 104


>gi|300691833|ref|YP_003752828.1| thioredoxin [Ralstonia solanacearum PSI07]
 gi|299078893|emb|CBJ51554.1| thioredoxin [Ralstonia solanacearum PSI07]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ EVL+   PV+VDFWA WC PC  ++PI+D+++ +  DKV+I KL+++E++ +
Sbjct: 8   VSDASFEDEVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGDKVQIAKLNVDENAGV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ I  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 68  PAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|103485652|ref|YP_615213.1| thioredoxin [Sphingopyxis alaskensis RB2256]
 gi|98975729|gb|ABF51880.1| thioredoxin [Sphingopyxis alaskensis RB2256]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    +   SF ++VL+   PV+VDFWA WC PC  + P +++I+DELA KV I KL+I+
Sbjct: 1   MGTKAITDASFQADVLDSETPVLVDFWAEWCGPCKMIGPALEEISDELAGKVVIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +  ++Y +  IPT+ILFK+G++ D  + GA+ +S +  W+
Sbjct: 61  DHPDAPSKYGVRGIPTMILFKNGEIADTKV-GAAPKSALKGWL 102


>gi|294508688|ref|YP_003572747.1| Thioredoxin [Salinibacter ruber M8]
 gi|294345017|emb|CBH25795.1| Thioredoxin [Salinibacter ruber M8]
          Length = 114

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 62/87 (71%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EV+    PV+VDFWA+WC PC +++PI++++ADE   + KI K+D++E+ + +  Y
Sbjct: 14  NFEDEVIGADQPVLVDFWATWCGPCRQIAPIVEELADEYEGQAKIGKVDVDENPQTAQEY 73

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQ 96
            + SIPTL+ FKDG+  ++++  A  Q
Sbjct: 74  GVRSIPTLLFFKDGEAQEQVVGAAGKQ 100


>gi|56551993|ref|YP_162832.1| thioredoxin [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260752464|ref|YP_003225357.1| thioredoxin [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|56543567|gb|AAV89721.1| thioredoxin [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258551827|gb|ACV74773.1| thioredoxin [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 71/105 (67%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   SF+++VL+   PVVVDFWA WC PC +++P + +IA EL  K+ + K++++
Sbjct: 1   MSVINVTDASFEADVLKSPVPVVVDFWAEWCGPCRQIAPALGEIASELEGKMTLAKVEVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            + E ++R+ I +IPTL+LFK+G+V+     GA  +S +  WI S
Sbjct: 61  NNIETASRFGIRNIPTLLLFKNGEVVATRTGGA-PKSQLKSWIES 104


>gi|220909594|ref|YP_002484905.1| thioredoxin [Cyanothece sp. PCC 7425]
 gi|219866205|gb|ACL46544.1| thioredoxin [Cyanothece sp. PCC 7425]
          Length = 107

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +ALKV   +F  EVL+   PV+VDFWA WC PC  ++P++D+I+++ A +VK+ K++ +E
Sbjct: 3  AALKVTDSTFKQEVLDSEVPVLVDFWAPWCGPCRMVAPVVDEISEQYAGQVKVVKVNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +  ++++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPSVASQYGIRSIPTLMIFKGGQKVD-MVVGAVPKTTL 99


>gi|153853836|ref|ZP_01995192.1| hypothetical protein DORLON_01183 [Dorea longicatena DSM 13814]
 gi|149753586|gb|EDM63517.1| hypothetical protein DORLON_01183 [Dorea longicatena DSM 13814]
          Length = 102

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 72/99 (72%), Gaps = 2/99 (2%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + +   +F+ EVLE   PV+VDFWA+WC PC  ++PI+++IA+E  D +K+ K+D++
Sbjct: 1  MAVIHLSKDNFNEEVLESKVPVMVDFWATWCGPCKTMAPIVEEIAEERTD-IKVCKIDVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +  E++ +Y++ SIPT ++FKDG+V+ R M G  S+ ++
Sbjct: 60 QEPELARQYRVMSIPTFLVFKDGEVVKRDM-GVMSKDEL 97


>gi|119946797|ref|YP_944477.1| thioredoxin [Psychromonas ingrahamii 37]
 gi|119865401|gb|ABM04878.1| thioredoxin [Psychromonas ingrahamii 37]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +V+    PV+VDFWA WC PC  ++PI+ ++A E A KV I KL+I+E+S    ++
Sbjct: 12  SFEDDVVNAEGPVLVDFWAEWCGPCKMIAPILQEVAAEYAGKVTIGKLNIDENSATPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDGKV    + GA S++ ++E++
Sbjct: 72  GIRGIPTLLLFKDGKVAATKV-GALSKTQLVEFL 104


>gi|152997586|ref|YP_001342421.1| thioredoxin [Marinomonas sp. MWYL1]
 gi|150838510|gb|ABR72486.1| thioredoxin [Marinomonas sp. MWYL1]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++    F  EVL    PV+VDFWA WC PC  ++P+++D+A E A KVK+ KL+++E
Sbjct: 4   NTIQITDAQFAEEVLNSEIPVIVDFWAPWCGPCKMIAPVLEDVAAEYAGKVKVVKLNVDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E + +Y +  IPTL++ K G+V+   + GA S+S +++++ S +
Sbjct: 64  NQETAPKYNVRGIPTLLIVKGGEVVATKV-GAVSKSQLVDFVNSAI 108


>gi|221195071|ref|ZP_03568127.1| thioredoxin [Atopobium rimae ATCC 49626]
 gi|221184974|gb|EEE17365.1| thioredoxin [Atopobium rimae ATCC 49626]
          Length = 105

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A ++ T  FDS +     PV+VDFWASWC PC  L P+++ + +E++DK+ + K+++++ 
Sbjct: 2   AQQLTTAEFDSVLASADKPVLVDFWASWCGPCRALGPVVEQVGEEMSDKLSVYKVNVDDE 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
            +++TR++I SIPTLILFK G+ +  M+ G   +SD++
Sbjct: 62  PDLATRFRIVSIPTLILFKGGEPVHTMV-GNLPKSDLV 98


>gi|213966238|ref|ZP_03394422.1| thioredoxin [Corynebacterium amycolatum SK46]
 gi|213951090|gb|EEB62488.1| thioredoxin [Corynebacterium amycolatum SK46]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +F S+VLE   PV+VDFWA WC PC K++P++D++A EL  K  I K++++
Sbjct: 1   MAPVTVTANTFKSDVLESDKPVLVDFWAEWCGPCKKIAPVLDEVATELDGKAVIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   ++  +QI SIP+L+LFKDGK ++ +  G   + +I   I
Sbjct: 61  EERALAGMFQIMSIPSLLLFKDGKKVEEIR-GVRPKGEITTLI 102


>gi|220932648|ref|YP_002509556.1| thioredoxin [Halothermothrix orenii H 168]
 gi|219993958|gb|ACL70561.1| thioredoxin [Halothermothrix orenii H 168]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 57/76 (75%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F  EVL+   PVVVDFWA WC PC  L+P+I  IA E +DKVK+ KL+++E+   ++RY
Sbjct: 11 NFSREVLKSDKPVVVDFWAEWCAPCRMLTPVIKKIAREYSDKVKVCKLNVDENQSTASRY 70

Query: 70 QISSIPTLILFKDGKV 85
           + SIPT+ILF++GKV
Sbjct: 71 GVMSIPTIILFENGKV 86


>gi|256823807|ref|YP_003147770.1| thioredoxin [Kangiella koreensis DSM 16069]
 gi|256797346|gb|ACV28002.1| thioredoxin [Kangiella koreensis DSM 16069]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL    PV+VD+WA WC PC  ++PI++++A+    KVK+ KL+I+E+SE   +Y
Sbjct: 12  TFEAEVLNSDQPVLVDYWAEWCGPCKMIAPILNEVAEMYEGKVKVAKLNIDENSETPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK G  I+    GA S+S ++ +I S V
Sbjct: 72  GIRGIPTLMLFKGGN-IEATKVGALSKSQLMAFIDSNV 108


>gi|226954293|ref|ZP_03824757.1| thioredoxin C-2 [Acinetobacter sp. ATCC 27244]
 gi|294649381|ref|ZP_06726812.1| thioredoxin [Acinetobacter haemolyticus ATCC 19194]
 gi|226834964|gb|EEH67347.1| thioredoxin C-2 [Acinetobacter sp. ATCC 27244]
 gi|292824751|gb|EFF83523.1| thioredoxin [Acinetobacter haemolyticus ATCC 19194]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 73/105 (69%), Gaps = 3/105 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T  ++F ++VL+   PV+VDFWA WC PC  ++P+++D+++E   KVKI K+D
Sbjct: 1   MSATIVNTSDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSNEYEGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    E + +Y I +IP L++FK+G+V+ + + GA+ +S +  +I
Sbjct: 61  VTACEETAVKYNIRNIPALLMFKNGEVVAQQV-GAAPRSKLAAFI 104


>gi|73541805|ref|YP_296325.1| thioredoxin [Ralstonia eutropha JMP134]
 gi|113868368|ref|YP_726857.1| thioredoxin [Ralstonia eutropha H16]
 gi|194290037|ref|YP_002005944.1| thioredoxin 1 [Cupriavidus taiwanensis LMG 19424]
 gi|72119218|gb|AAZ61481.1| thioredoxin [Ralstonia eutropha JMP134]
 gi|113527144|emb|CAJ93489.1| Thioredoxin [Ralstonia eutropha H16]
 gi|193223872|emb|CAQ69881.1| thioredoxin 1 [Cupriavidus taiwanensis LMG 19424]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SFD++VL+   PV++DFWA WC PC  ++PI+D++A +  DK++I K++++E+ ++
Sbjct: 8   VSDASFDADVLQSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQQV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             ++ I  IPTLILFK+G V  + + GA S+S +  ++
Sbjct: 68  PAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFL 104


>gi|34497039|ref|NP_901254.1| thioredoxin [Chromobacterium violaceum ATCC 12472]
 gi|34330323|gb|AAQ59260.2| thioredoxin [Chromobacterium violaceum ATCC 12472]
          Length = 108

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SF++EVL+   PV+VD+WA WC PC  ++PI+D++A E   K+KI KL+I+++ 
Sbjct: 6   LHVTDDSFENEVLKADRPVLVDYWAEWCGPCKMIAPILDEVAKEYDGKLKIAKLNIDQNE 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   ++ I  IPTL+LFKDG+V    + GA S+S +  +I S++
Sbjct: 66  QTPPKFGIRGIPTLMLFKDGQVAATKV-GALSKSQLTAFIDSQL 108


>gi|293610420|ref|ZP_06692721.1| thioredoxin C-2 [Acinetobacter sp. SH024]
 gi|292827652|gb|EFF86016.1| thioredoxin C-2 [Acinetobacter sp. SH024]
          Length = 108

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T   +F ++VL+   PV+VDFWA WC PC  ++P+++D++ E A KVKI K+D
Sbjct: 1   MSATIVNTTDANFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSSEYAGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    + + +Y I +IP L+LFK+G+V+ + + GA  +S ++ +I
Sbjct: 61  VTSCEDTAVKYNIRNIPALLLFKNGEVVAQQI-GAVPRSKLVSFI 104


>gi|22298354|ref|NP_681601.1| thioredoxin [Thermosynechococcus elongatus BP-1]
 gi|22294533|dbj|BAC08363.1| thioredoxin [Thermosynechococcus elongatus BP-1]
          Length = 107

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SAL V   +F+ EVL    PV+VDFWA WC PC  ++P++D+IA+E   +VK+ K++ +E
Sbjct: 3  SALSVTDATFEEEVLNSDIPVLVDFWAPWCGPCRMVAPVVDEIANEYQGRVKVVKVNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +S+++T + I SIPTL++FK G+ +D ++ GA  ++ I
Sbjct: 63 NSKVATDFGIRSIPTLMIFKGGQKVD-ILVGAVPKTKI 99


>gi|225026479|ref|ZP_03715671.1| hypothetical protein EUBHAL_00728 [Eubacterium hallii DSM 3353]
 gi|224956167|gb|EEG37376.1| hypothetical protein EUBHAL_00728 [Eubacterium hallii DSM 3353]
          Length = 101

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 73/103 (70%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F +EVL    PV++DFWASWC PC  + PI+++IA E  D +K+ K++++
Sbjct: 1   MSAININKNNFQNEVLNSDKPVLLDFWASWCAPCRMVVPIVEEIASERRD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIVQQ-ISGARPKNAILEML 101


>gi|83816367|ref|YP_446755.1| thioredoxin [Salinibacter ruber DSM 13855]
 gi|83757761|gb|ABC45874.1| thioredoxin [Salinibacter ruber DSM 13855]
          Length = 114

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 62/87 (71%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EV+    PV+VDFWA+WC PC +++PI++++ADE   + KI K+D++E+ + +  Y
Sbjct: 14  NFEDEVIGADQPVLVDFWATWCGPCRQIAPIVEELADEYEGQAKIGKVDVDENPQTAQEY 73

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQ 96
            + SIPTL+ FKDG+  ++++  A  Q
Sbjct: 74  GVRSIPTLLFFKDGEAKEQVVGAAGKQ 100


>gi|254444085|ref|ZP_05057561.1| thioredoxin [Verrucomicrobiae bacterium DG1235]
 gi|198258393|gb|EDY82701.1| thioredoxin [Verrucomicrobiae bacterium DG1235]
          Length = 107

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 64/87 (73%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + ++ +SF+  +   + PV+VDFWA WC PC  ++P++++IADEL  K  ITK++++E+S
Sbjct: 5  INLNEQSFNDAISSANGPVLVDFWAPWCGPCKAIAPLLEEIADELDGKAAITKVNVDENS 64

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
           I+ +Y + +IPTLILFK G+ +D ++
Sbjct: 65 AIAAKYNVRAIPTLILFKGGEQVDTIV 91


>gi|223935105|ref|ZP_03627023.1| thioredoxin [bacterium Ellin514]
 gi|223895989|gb|EEF62432.1| thioredoxin [bacterium Ellin514]
          Length = 110

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 66/91 (72%), Gaps = 1/91 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F+ +VL+ + PV+VDFWA WC PC  + PI+D++ADE A +  I K++I++   ++T+
Sbjct: 12  ENFEQQVLQATAPVLVDFWAEWCGPCKMIGPILDELADEYAGRAIIAKVNIDDHQSLATQ 71

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           Y + +IPTL+LF  G+V ++M+ G  S+ D+
Sbjct: 72  YGVRAIPTLLLFHKGQVAEQMV-GLRSKRDL 101


>gi|154505020|ref|ZP_02041758.1| hypothetical protein RUMGNA_02530 [Ruminococcus gnavus ATCC 29149]
 gi|153794499|gb|EDN76919.1| hypothetical protein RUMGNA_02530 [Ruminococcus gnavus ATCC 29149]
          Length = 101

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+   +F+ EVL+   PV+VDF+A WC PC  LSPI+D++A+E  D +K+ K++++
Sbjct: 1   MAIIKLTKDNFEQEVLKSEKPVLVDFYADWCGPCQMLSPIVDEVAEE-RDDIKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ +Y + +IPTL++ K+G++ ++ + GA S+S +IE +
Sbjct: 60  EQMELAQKYGVMTIPTLLVIKNGEIANKHI-GALSKSGVIELL 101


>gi|304320181|ref|YP_003853824.1| thioredoxin [Parvularcula bermudensis HTCC2503]
 gi|303299084|gb|ADM08683.1| thioredoxin [Parvularcula bermudensis HTCC2503]
          Length = 109

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF+ +VL+ +  V+VDFWA+WC PC +++P +++IADE+ D + + KLDI+
Sbjct: 1   MATKTVTDASFEQDVLKGTGLVLVDFWATWCGPCRQIAPALEEIADEMGDDLTVAKLDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +Y +  +PTL+LFK+G+++   + GA ++  I+ W+
Sbjct: 61  ENPTTMMQYGVRGVPTLMLFKEGQLVSTKV-GADAKGAILAWV 102


>gi|153813087|ref|ZP_01965755.1| hypothetical protein RUMOBE_03495 [Ruminococcus obeum ATCC 29174]
 gi|253581201|ref|ZP_04858458.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|149830889|gb|EDM85979.1| hypothetical protein RUMOBE_03495 [Ruminococcus obeum ATCC 29174]
 gi|251847478|gb|EES75451.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
 gi|291545997|emb|CBL19105.1| thioredoxin [Ruminococcus sp. SR1/5]
          Length = 101

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 73/103 (70%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F +EVL    PV++DFWASWC PC  + PI+++IA E  D +K+ K++++
Sbjct: 1   MSAININKNNFQNEVLNSDKPVLLDFWASWCAPCRMVVPIVEEIASERRD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIVQQ-VSGARPKNAILEML 101


>gi|256370855|ref|YP_003108679.1| thioredoxin [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007439|gb|ACU53006.1| thioredoxin [Acidimicrobium ferrooxidans DSM 10331]
          Length = 110

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 69/93 (74%), Gaps = 1/93 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           K+FD  V     PV+VDFWA WC PC  + PI++++ADE++DK+ I KL+++ES EI+ R
Sbjct: 11  KNFDETVKASELPVLVDFWAEWCGPCKMIDPILEELADEMSDKLVIGKLNVDESLEIARR 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           ++I SIPTL+LFK+G+ + R++ GA  +  +++
Sbjct: 71  FEIMSIPTLMLFKEGEPVKRVI-GAMPKRALLK 102


>gi|303273358|ref|XP_003056040.1| thioredoxin [Micromonas pusilla CCMP1545]
 gi|226462124|gb|EEH59416.1| thioredoxin [Micromonas pusilla CCMP1545]
          Length = 163

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+SEVL+   PV+VDFWA WC PC  ++P+ID +A+E A K+K  KL+ +ES  ++T Y
Sbjct: 67  TFESEVLQSEVPVLVDFWAPWCGPCRMIAPLIDQLAEEYAGKLKAVKLNTDESPSVATEY 126

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I SIPT+++FK G+ +D ++ GA  +S +   I
Sbjct: 127 GIRSIPTVMIFKGGQKLDTVI-GAVPKSTLTGTI 159


>gi|119491324|ref|ZP_01623378.1| thioredoxin [Lyngbya sp. PCC 8106]
 gi|119453488|gb|EAW34650.1| thioredoxin [Lyngbya sp. PCC 8106]
          Length = 107

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A +V   SF  +VLE   PV+VDFWA WC PC  ++P++++IA++ A KVK+ KL+ +E
Sbjct: 3   AAPQVTDASFKQDVLESDVPVLVDFWAPWCGPCRMVAPVVEEIAEQYAGKVKVVKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  ++ +Y I SIPTL++FK+G+ +D M+ GA  ++ +   I
Sbjct: 63  NPTVANQYGIRSIPTLMIFKEGQRVD-MVVGAVPKTTLANTI 103


>gi|83643187|ref|YP_431622.1| thioredoxin [Hahella chejuensis KCTC 2396]
 gi|83631230|gb|ABC27197.1| thioredoxin [Hahella chejuensis KCTC 2396]
          Length = 108

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+SEVL+   PV+VD+WA WC PC  ++P++++IA+E  D++KI KL+I+E+ 
Sbjct: 6   VNVTDDSFESEVLKADGPVLVDYWAEWCGPCKMIAPVLEEIAEEYGDRLKICKLNIDENE 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   ++ I  IPTL+LFK+G V D    GA S+S +  ++ S +
Sbjct: 66  KTPPKFSIRGIPTLMLFKNGAV-DATKVGALSKSQLTAFLDSNL 108


>gi|88705508|ref|ZP_01103218.1| Thioredoxin [Congregibacter litoralis KT71]
 gi|88700021|gb|EAQ97130.1| Thioredoxin [Congregibacter litoralis KT71]
          Length = 109

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL    PV+VDFWA WC PC  ++P++D++A E A K+K+ K+D++ + 
Sbjct: 6   VHVSDASFEQDVLSSDVPVLVDFWAEWCGPCKMIAPVLDELAGEFAGKLKVCKVDVDANP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+  ++ I  IPTLILFKDG   +    GA S+S ++E++
Sbjct: 66  EVPGKFGIRGIPTLILFKDGNA-EATKVGALSKSQLVEFV 104


>gi|219555761|ref|ZP_03534837.1| thioredoxin trxC [Mycobacterium tuberculosis T17]
          Length = 121

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 8   ATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDT 67

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++ 
Sbjct: 68  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLR 106


>gi|254422668|ref|ZP_05036386.1| thioredoxin [Synechococcus sp. PCC 7335]
 gi|196190157|gb|EDX85121.1| thioredoxin [Synechococcus sp. PCC 7335]
          Length = 106

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MSA +V   +F  EVLE   PV+VDFWA WC PC  ++P++D+I+++   +VK+ K++ +
Sbjct: 1  MSAAQVTDSTFKQEVLENETPVLVDFWAPWCGPCRMVAPVVDEISEQYDGQVKVVKVNTD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          E+  ++++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 61 ENPSVASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTL 98


>gi|302336496|ref|YP_003801703.1| thioredoxin [Olsenella uli DSM 7084]
 gi|301320336|gb|ADK68823.1| thioredoxin [Olsenella uli DSM 7084]
          Length = 105

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 63/94 (67%), Gaps = 3/94 (3%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A  + T  FDS +     PV+VDFWASWC PC  L P+++ +ADE++D++ + K ++++ 
Sbjct: 2  ANAITTAEFDSVLANADKPVLVDFWASWCGPCRALGPVVEQVADEMSDQLALYKCNVDDE 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRM---MPGA 93
           +++ R+QI SIPT+ILFK GK +  M   MP A
Sbjct: 62 GDLAQRFQIVSIPTMILFKGGKPVHTMVGNMPKA 95


>gi|121604239|ref|YP_981568.1| thioredoxin [Polaromonas naphthalenivorans CJ2]
 gi|120593208|gb|ABM36647.1| thioredoxin [Polaromonas naphthalenivorans CJ2]
          Length = 159

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (59%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           +D  +FD  +     PV+VDFWA WC PC +++P  +  A +L  +V++ K+D E    +
Sbjct: 58  LDEAAFDKHISRNQIPVLVDFWAPWCGPCRQMAPAYEQAAAQLEPQVRLAKVDTEAVPSL 117

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             R+ I SIPTL LFK G+ I R  PGA   +DI+ W+ S +
Sbjct: 118 GARFNIRSIPTLALFKGGREIAR-QPGAMGAADIVRWVQSHL 158


>gi|304309757|ref|YP_003809355.1| Thioredoxin [gamma proteobacterium HdN1]
 gi|301795490|emb|CBL43688.1| Thioredoxin [gamma proteobacterium HdN1]
          Length = 108

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +   +F++EVL   +PV+VD+WA WC PC  ++PI++++A E A KVK+ KL+I+++ 
Sbjct: 6   LNITDSTFEAEVLSSDSPVLVDYWAEWCGPCKMIAPILEEVATEYAGKVKVAKLNIDQNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               RY I  IPTL+LFK+G V +    GA S+S +  ++ S +
Sbjct: 66  GTPPRYGIRGIPTLMLFKNGNV-EATKVGALSKSQLTAFLDSNI 108


>gi|152982671|ref|YP_001352313.1| thioredoxin [Janthinobacterium sp. Marseille]
 gi|151282748|gb|ABR91158.1| thioredoxin [Janthinobacterium sp. Marseille]
          Length = 108

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+   PV+VDFWA WC PC  ++PI++D+A E A K++ITK+D++ +  I  ++
Sbjct: 12  SFDTDVLKSDKPVLVDFWAEWCGPCKMIAPILEDVAKEYAGKIQITKMDVDANQAIPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTLILFK+G    + + GA ++  +  +I S +
Sbjct: 72  GIRGIPTLILFKNGAPAAQKV-GALAKGQLTAFIDSNI 108


>gi|293394749|ref|ZP_06639040.1| thioredoxin 2 [Serratia odorifera DSM 4582]
 gi|291422700|gb|EFE95938.1| thioredoxin 2 [Serratia odorifera DSM 4582]
          Length = 139

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           P+VVDFWA WC PC   +PI +D+A+E A KV+  K++ E   E+S R++I SIPT++LF
Sbjct: 54  PIVVDFWAPWCGPCRNFAPIFEDVAEERAGKVRFVKINTEAEPELSARFRIRSIPTIMLF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           +DGK++D M+ GA  ++    W+
Sbjct: 114 RDGKMVD-MLNGAMPKAPFDNWL 135


>gi|323497156|ref|ZP_08102176.1| Thioredoxin 2 [Vibrio sinaloensis DSM 21326]
 gi|323317731|gb|EGA70722.1| Thioredoxin 2 [Vibrio sinaloensis DSM 21326]
          Length = 144

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 59/89 (66%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           +L  S PVV+DFWA WC PCV  +P+  D+A+E A  V+  K+D E    I+ +YQI SI
Sbjct: 51  LLSSSQPVVIDFWAPWCNPCVGFAPVFSDVANERAGNVRFVKVDTEAQQNIAAKYQIRSI 110

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           PT+++FKDGK +D ++ GA  +    +W+
Sbjct: 111 PTIMVFKDGKRVD-VINGALPKGQFDQWL 138


>gi|330447221|ref|ZP_08310871.1| thioredoxin [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491412|dbj|GAA05368.1| thioredoxin [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 108

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++    ++
Sbjct: 12  SFDTDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNAGTPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|157368408|ref|YP_001476397.1| thioredoxin [Serratia proteamaculans 568]
 gi|157320172|gb|ABV39269.1| thioredoxin [Serratia proteamaculans 568]
          Length = 108

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+   P++VDFWA WC PC  ++PI+D+IA+E   K+ ITKL+I+++   + +Y
Sbjct: 12  SFDTDVLKAEGPILVDFWAEWCGPCKMIAPILDEIAEEFEGKLTITKLNIDQNPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + +++ + +
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKDFLNANL 108


>gi|319788360|ref|YP_004147835.1| thioredoxin [Pseudoxanthomonas suwonensis 11-1]
 gi|317466872|gb|ADV28604.1| thioredoxin [Pseudoxanthomonas suwonensis 11-1]
          Length = 105

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 57/82 (69%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + +    FDS VL+   PV+VDFWA WC PC  +SPIID++AD    KVK+ K++I+++ 
Sbjct: 1  MHIGDADFDSAVLQSQEPVLVDFWAEWCGPCKMISPIIDELADAYDGKVKVAKVNIDQNR 60

Query: 64 EISTRYQISSIPTLILFKDGKV 85
            + +Y + SIP L+LFKDG+V
Sbjct: 61 ATAIKYHVRSIPMLLLFKDGQV 82


>gi|294637930|ref|ZP_06716199.1| thioredoxin [Edwardsiella tarda ATCC 23685]
 gi|291088956|gb|EFE21517.1| thioredoxin [Edwardsiella tarda ATCC 23685]
          Length = 108

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
            F+++VL+   P++VDFWA WC PC  ++PI+D+IA E A K+ I KL+I+E+   + +Y
Sbjct: 12  GFEADVLKAEGPILVDFWAEWCGPCKMIAPILDEIAAEYAGKLTIAKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKDGAVAATKV-GALSKTQLKEFL 104


>gi|172038901|ref|YP_001805402.1| thioredoxin [Cyanothece sp. ATCC 51142]
 gi|171700355|gb|ACB53336.1| thioredoxin [Cyanothece sp. ATCC 51142]
          Length = 107

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A +V   SF ++VLE   PV+VDFWA WC PC  ++P++D+IA++ A +VK+ KL+ +E
Sbjct: 3  AAAQVTDSSFKADVLESDVPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQVKVVKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +   +++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTL 99


>gi|148071|gb|AAA24696.1| thioredoxin [Escherichia coli]
          Length = 110

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 64/94 (68%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V      GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVASATKVGALSKGQLKEFL 105


>gi|17545907|ref|NP_519309.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum
           GMI1000]
 gi|17428202|emb|CAD14890.1| probable thioredoxin 1 (redox factor) protein [Ralstonia
           solanacearum GMI1000]
 gi|299067240|emb|CBJ38437.1| thioredoxin [Ralstonia solanacearum CMR15]
          Length = 108

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+++VL+   PV+VDFWA WC PC  ++PI+D+++ +  DKV+I KL+++E++ +
Sbjct: 8   VSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGDKVQIAKLNVDENAGV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ I  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 68  PAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|307257131|ref|ZP_07538903.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306864293|gb|EFM96204.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 105

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 71/100 (71%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L+V   +F+ EVL+   PV++DFWA WC PC  ++PI+D++++E A + KI K++++E+ 
Sbjct: 3   LQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVTPILDELSEEFAGRAKIAKVNVDENQ 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I  ++ I SIPTLILFK+G+V+   + GA  +S +  ++
Sbjct: 63  QIPAQFGIRSIPTLILFKNGEVVATQV-GALPKSQLSAFV 101


>gi|32035159|ref|ZP_00135199.1| COG0526: Thiol-disulfide isomerase and thioredoxins [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208550|ref|YP_001053775.1| thioredoxin [Actinobacillus pleuropneumoniae L20]
 gi|165976501|ref|YP_001652094.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|190150405|ref|YP_001968930.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|303250174|ref|ZP_07336376.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|303253346|ref|ZP_07339495.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307245996|ref|ZP_07528078.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307249153|ref|ZP_07531158.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|307250332|ref|ZP_07532281.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307252714|ref|ZP_07534605.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307254975|ref|ZP_07536794.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307259413|ref|ZP_07541138.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|307261559|ref|ZP_07543227.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|307263748|ref|ZP_07545354.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|322513964|ref|ZP_08067039.1| thioredoxin [Actinobacillus ureae ATCC 25976]
 gi|126097342|gb|ABN74170.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|165876602|gb|ABY69650.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|189915536|gb|ACE61788.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|302648028|gb|EFL78235.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302651237|gb|EFL81391.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306852931|gb|EFM85154.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306854323|gb|EFM86521.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|306857607|gb|EFM89714.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306859746|gb|EFM91768.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306862093|gb|EFM94068.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306866349|gb|EFM98212.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306868682|gb|EFN00491.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306870869|gb|EFN02607.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|322120190|gb|EFX92148.1| thioredoxin [Actinobacillus ureae ATCC 25976]
          Length = 105

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 71/100 (71%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L+V   +F+ EVL+   PV++DFWA WC PC  ++PI+D++++E A + KI K++++E+ 
Sbjct: 3   LQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVAPILDELSEEFAGRAKIAKVNVDENQ 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I  ++ I SIPTLILFK+G+V+   + GA  +S +  ++
Sbjct: 63  QIPAQFGIRSIPTLILFKNGEVVATQV-GALPKSQLSAFV 101


>gi|294011637|ref|YP_003545097.1| thioredoxin 1 [Sphingobium japonicum UT26S]
 gi|292674967|dbj|BAI96485.1| thioredoxin 1 [Sphingobium japonicum UT26S]
          Length = 106

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF  +V+    PV+VDFWA WC PC  + P +++I+DELADKV I K++I+
Sbjct: 1   MATKAVTDLSFQQDVINADKPVLVDFWAEWCGPCKMIGPALEEISDELADKVVIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ +   RY +  IPT+ILFK+G+     + GA+ +S +  WI S
Sbjct: 61  ENPDAPGRYGVRGIPTMILFKNGEAAATKV-GAAPKSALKGWIES 104


>gi|50086050|ref|YP_047560.1| thioredoxin [Acinetobacter sp. ADP1]
 gi|49532026|emb|CAG69738.1| thioredoxin [Acinetobacter sp. ADP1]
          Length = 112

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T   +F ++VL+   PV+VDFWA WC PC  ++P+++D++ E   KVKI K+D
Sbjct: 5   MSANIVNTTDANFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSREYEGKVKIVKVD 64

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    + + +Y I +IP L+LFKDGKV+ + + GA+ +S +  +I
Sbjct: 65  VTACEDTAVKYNIRNIPALLLFKDGKVVAQQV-GAAPRSKLAAFI 108


>gi|325124576|gb|ADY84099.1| thioredoxin 1 [Acinetobacter calcoaceticus PHEA-2]
          Length = 108

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MSALKVDTK--SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T   +F ++VL+   PV+VDFWA WC PC  ++P+++D++ E A KVKI K+D
Sbjct: 1   MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSSEYAGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    + + +Y I +IP L+LFK+G+V+ + + GA  +S ++ +I
Sbjct: 61  VTSCEDTAVKYNIRNIPALLLFKNGEVVAQQI-GAVPRSKLVSFI 104


>gi|15611050|ref|NP_218431.1| thioredoxin trxC (TRX) (MPT46) [Mycobacterium tuberculosis H37Rv]
 gi|15843547|ref|NP_338584.1| thioredoxin [Mycobacterium tuberculosis CDC1551]
 gi|31795087|ref|NP_857580.1| thioredoxin trxC (TRX) (MPT46) [Mycobacterium bovis AF2122/97]
 gi|121635900|ref|YP_976123.1| thioredoxin trxC (TRX) (MPT46) [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|121639825|ref|YP_980049.1| thioredoxin trxC [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148663781|ref|YP_001285304.1| thioredoxin TrxC [Mycobacterium tuberculosis H37Ra]
 gi|148825122|ref|YP_001289876.1| thioredoxin trxC [Mycobacterium tuberculosis F11]
 gi|167969451|ref|ZP_02551728.1| thioredoxin trxC [Mycobacterium tuberculosis H37Ra]
 gi|215405972|ref|ZP_03418153.1| thioredoxin trxC [Mycobacterium tuberculosis 02_1987]
 gi|215413842|ref|ZP_03422507.1| thioredoxin trxC [Mycobacterium tuberculosis 94_M4241A]
 gi|215425176|ref|ZP_03423095.1| thioredoxin trxC [Mycobacterium tuberculosis T92]
 gi|215432895|ref|ZP_03430814.1| thioredoxin trxC [Mycobacterium tuberculosis EAS054]
 gi|215448261|ref|ZP_03435013.1| thioredoxin trxC [Mycobacterium tuberculosis T85]
 gi|218755706|ref|ZP_03534502.1| thioredoxin trxC [Mycobacterium tuberculosis GM 1503]
 gi|224992320|ref|YP_002647010.1| thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253800964|ref|YP_003033966.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 1435]
 gi|254366450|ref|ZP_04982494.1| thioredoxin trxC [Mycobacterium tuberculosis str. Haarlem]
 gi|254548918|ref|ZP_05139365.1| thioredoxin trxC [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|260184844|ref|ZP_05762318.1| thioredoxin trxC [Mycobacterium tuberculosis CPHL_A]
 gi|260198974|ref|ZP_05766465.1| thioredoxin trxC [Mycobacterium tuberculosis T46]
 gi|260203127|ref|ZP_05770618.1| thioredoxin trxC [Mycobacterium tuberculosis K85]
 gi|289441357|ref|ZP_06431101.1| thioredoxin [Mycobacterium tuberculosis T46]
 gi|289445515|ref|ZP_06435259.1| thioredoxin trxC [Mycobacterium tuberculosis CPHL_A]
 gi|289556182|ref|ZP_06445392.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 605]
 gi|289572566|ref|ZP_06452793.1| thioredoxin trxC [Mycobacterium tuberculosis K85]
 gi|289747758|ref|ZP_06507136.1| thioredoxin trxC [Mycobacterium tuberculosis 02_1987]
 gi|289748452|ref|ZP_06507830.1| thioredoxin trxC [Mycobacterium tuberculosis T92]
 gi|289756049|ref|ZP_06515427.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           tuberculosis EAS054]
 gi|289760087|ref|ZP_06519465.1| thioredoxin/thioredoxin reductase hybrid protein [Mycobacterium
           tuberculosis T85]
 gi|289764105|ref|ZP_06523483.1| thioredoxin trxC [Mycobacterium tuberculosis GM 1503]
 gi|294995597|ref|ZP_06801288.1| thioredoxin TrxC [Mycobacterium tuberculosis 210]
 gi|297636601|ref|ZP_06954381.1| thioredoxin TrxC [Mycobacterium tuberculosis KZN 4207]
 gi|297733596|ref|ZP_06962714.1| thioredoxin TrxC [Mycobacterium tuberculosis KZN R506]
 gi|298527386|ref|ZP_07014795.1| thioredoxin/thioredoxin reductase hybrid protein [Mycobacterium
           tuberculosis 94_M4241A]
 gi|306778278|ref|ZP_07416615.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu001]
 gi|306778808|ref|ZP_07417145.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu002]
 gi|306786835|ref|ZP_07425157.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu003]
 gi|306786964|ref|ZP_07425286.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu004]
 gi|306791519|ref|ZP_07429821.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu005]
 gi|306795584|ref|ZP_07433886.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu006]
 gi|306801559|ref|ZP_07438227.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu008]
 gi|306805768|ref|ZP_07442436.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu007]
 gi|306970165|ref|ZP_07482826.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu009]
 gi|306974397|ref|ZP_07487058.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu010]
 gi|307082105|ref|ZP_07491275.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu011]
 gi|307086716|ref|ZP_07495829.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu012]
 gi|313660927|ref|ZP_07817807.1| thioredoxin TrxC [Mycobacterium tuberculosis KZN V2475]
 gi|61248338|sp|P0A616|THIO_MYCTU RecName: Full=Thioredoxin; Short=Trx; AltName: Full=MPT46
 gi|61248339|sp|P0A617|THIO_MYCBO RecName: Full=Thioredoxin; Short=Trx; AltName: Full=MPT46
 gi|1213065|emb|CAA65071.1| thioredoxin reductase [Mycobacterium tuberculosis]
 gi|2808699|emb|CAA16227.1| THIOREDOXIN TRXC (TRX) (MPT46) [Mycobacterium tuberculosis H37Rv]
 gi|13883925|gb|AAK48398.1| thioredoxin [Mycobacterium tuberculosis CDC1551]
 gi|31620685|emb|CAD96131.1| THIOREDOXIN TRXC (TRX) (MPT46) [Mycobacterium bovis AF2122/97]
 gi|121491547|emb|CAL70004.1| Thioredoxin trxC (TRX) (MPT46) [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|121495473|emb|CAL73962.1| Thioredoxin trxC [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|134151962|gb|EBA44007.1| thioredoxin trxC [Mycobacterium tuberculosis str. Haarlem]
 gi|148507933|gb|ABQ75742.1| thioredoxin TrxC [Mycobacterium tuberculosis H37Ra]
 gi|148723649|gb|ABR08274.1| thioredoxin trxC [Mycobacterium tuberculosis F11]
 gi|224775436|dbj|BAH28242.1| thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253322468|gb|ACT27071.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 1435]
 gi|289414276|gb|EFD11516.1| thioredoxin [Mycobacterium tuberculosis T46]
 gi|289418473|gb|EFD15674.1| thioredoxin trxC [Mycobacterium tuberculosis CPHL_A]
 gi|289440814|gb|EFD23307.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 605]
 gi|289536997|gb|EFD41575.1| thioredoxin trxC [Mycobacterium tuberculosis K85]
 gi|289688286|gb|EFD55774.1| thioredoxin trxC [Mycobacterium tuberculosis 02_1987]
 gi|289689039|gb|EFD56468.1| thioredoxin trxC [Mycobacterium tuberculosis T92]
 gi|289696636|gb|EFD64065.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           tuberculosis EAS054]
 gi|289711611|gb|EFD75627.1| thioredoxin trxC [Mycobacterium tuberculosis GM 1503]
 gi|289715651|gb|EFD79663.1| thioredoxin/thioredoxin reductase hybrid protein [Mycobacterium
           tuberculosis T85]
 gi|298497180|gb|EFI32474.1| thioredoxin/thioredoxin reductase hybrid protein [Mycobacterium
           tuberculosis 94_M4241A]
 gi|308213428|gb|EFO72827.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu001]
 gi|308328145|gb|EFP16996.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu002]
 gi|308328607|gb|EFP17458.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu003]
 gi|308336262|gb|EFP25113.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu004]
 gi|308339868|gb|EFP28719.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu005]
 gi|308343880|gb|EFP32731.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu006]
 gi|308347664|gb|EFP36515.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu007]
 gi|308351582|gb|EFP40433.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu008]
 gi|308352289|gb|EFP41140.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu009]
 gi|308356292|gb|EFP45143.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu010]
 gi|308360179|gb|EFP49030.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu011]
 gi|308363866|gb|EFP52717.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu012]
 gi|323717330|gb|EGB26535.1| thioredoxin trxC [Mycobacterium tuberculosis CDC1551A]
 gi|326905747|gb|EGE52680.1| thioredoxin trxC [Mycobacterium tuberculosis W-148]
 gi|328460692|gb|AEB06115.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 4207]
          Length = 116

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 8   ATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDT 67

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++ 
Sbjct: 68  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLR 106


>gi|318040295|ref|ZP_07972251.1| thioredoxin [Synechococcus sp. CB0101]
          Length = 107

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 64/89 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+IA E   K+K+ KL+ +E
Sbjct: 3  SAAAVTDASFEQDVLKSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFEGKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FKDG+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMVFKDGQKVDTVV 91


>gi|227496617|ref|ZP_03926895.1| thioredoxin [Actinomyces urogenitalis DSM 15434]
 gi|226833897|gb|EEH66280.1| thioredoxin [Actinomyces urogenitalis DSM 15434]
          Length = 108

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 66/101 (65%), Gaps = 3/101 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +AL V   +F  EVL  + PVVVDFWA+WC PC +++PI+D++A EL D+VK  K+D++ 
Sbjct: 3   NALDVTDATFSDEVLSSTTPVVVDFWATWCGPCRQMAPIVDEVAAELGDRVKFVKVDVDA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDI 99
           +   +  Y I SIPT  + +DG+V  +     P AS ++++
Sbjct: 63  NPATARSYGIQSIPTFAVIRDGEVFHQFAGSRPKASFKAEV 103


>gi|241761924|ref|ZP_04760009.1| thioredoxin [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373604|gb|EER63176.1| thioredoxin [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 106

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 71/105 (67%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   SF+++VL+   PVVVDFWA WC PC +++P + +IA EL  K+ + K++++
Sbjct: 1   MSVINVTDASFEADVLKSPVPVVVDFWAEWCGPCRQIAPALGEIASELEGKMTLAKVEVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            + E ++R+ I +IPTL+LFK+G+++     GA  +S +  WI S
Sbjct: 61  NNIETASRFGIRNIPTLLLFKNGEIVATRTGGA-PKSQLKSWIES 104


>gi|307292808|ref|ZP_07572654.1| thioredoxin [Sphingobium chlorophenolicum L-1]
 gi|306880874|gb|EFN12090.1| thioredoxin [Sphingobium chlorophenolicum L-1]
          Length = 106

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF  +V++   PV+VDFWA WC PC  + P +++I+DELADKV I K++I+
Sbjct: 1   MATKAVTDLSFKQDVIDADKPVLVDFWAEWCGPCKMIGPALEEISDELADKVVIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ +   RY +  IPT+ILFK+G+     + GA+ +S +  WI S
Sbjct: 61  ENPDAPGRYGVRGIPTMILFKNGEAAATKV-GAAPKSALKGWIES 104


>gi|168335604|ref|ZP_02693661.1| Thioredoxin [Epulopiscium sp. 'N.t. morphotype B']
          Length = 104

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 70/98 (71%), Gaps = 4/98 (4%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F  E L+   PV+VDF+A WC PC  ++PII+++A+E  +KVKI KL+I+E SEIS RY
Sbjct: 7   NFQEEALDSDIPVMVDFYADWCAPCRMIAPIINELAEEYENKVKIGKLNIDEHSEISNRY 66

Query: 70  QISSIPTLILFKDGKVIDRMMPGA---SSQSDIIEWIL 104
            I SIPT++  K+G+VI+++  GA   +  +D I+ +L
Sbjct: 67  GIMSIPTILFIKNGEVINKVQ-GAVPKTKLNDTIQTVL 103


>gi|126661310|ref|ZP_01732379.1| thioredoxin [Cyanothece sp. CCY0110]
 gi|126617406|gb|EAZ88206.1| thioredoxin [Cyanothece sp. CCY0110]
          Length = 107

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A +V   SF ++VLE   PV+VDFWA WC PC  ++P++D+IA++ A ++K+ KL+ +E
Sbjct: 3  AAAQVTDSSFKADVLESEVPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQIKVVKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +   +++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTL 99


>gi|289567870|ref|ZP_06448097.1| LOW QUALITY PROTEIN: thioredoxin trxC [Mycobacterium tuberculosis
           T17]
 gi|289541623|gb|EFD45272.1| LOW QUALITY PROTEIN: thioredoxin trxC [Mycobacterium tuberculosis
           T17]
          Length = 114

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 8   ATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDT 67

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++ 
Sbjct: 68  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLR 106


>gi|260551927|ref|ZP_05825789.1| thioredoxin [Acinetobacter sp. RUH2624]
 gi|260405330|gb|EEW98825.1| thioredoxin [Acinetobacter sp. RUH2624]
          Length = 120

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MSALKVDTK--SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T   +F ++VL+   PV+VDFWA WC PC  ++P+++D++ E A KVKI K+D
Sbjct: 13  MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSSEYAGKVKIVKVD 72

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    + + +Y I +IP L+LFK+G+V+ + + GA  +S ++ +I
Sbjct: 73  VTSCEDTAVKYNIRNIPALLLFKNGEVVAQQI-GAVPRSKLVSFI 116


>gi|11465476|ref|NP_045133.1| thioredoxin [Cyanidium caldarium]
 gi|586100|sp|P37395|THIO_CYACA RecName: Full=Thioredoxin; Short=Trx
 gi|6466379|gb|AAF12961.1|AF022186_84 unknown [Cyanidium caldarium]
 gi|14403|emb|CAA79820.1| thioredoxin [Cyanidium caldarium]
          Length = 107

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S ++V   SF+ EV+     V+VDFWA WC PC  +SP+ID++A E  ++VKI K++ +E
Sbjct: 3  SPIQVTDFSFEKEVVNSEKLVLVDFWAPWCGPCRMISPVIDELAQEYVEQVKIVKINTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +  IS  Y I SIPTL+LFKDGK +D ++ GA  +S +
Sbjct: 63 NPSISAEYGIRSIPTLMLFKDGKRVDTVI-GAVPKSTL 99


>gi|317403446|gb|EFV83957.1| thioredoxin [Achromobacter xylosoxidans C54]
          Length = 108

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SFD++VL+   PV+VD+WA+WC PC  ++PI++++A E A ++ I KL+++E+  
Sbjct: 7   NVSDASFDADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVATEYAGRLTIAKLNVDENQG 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + +Y I  IPTL+LFKDG+     + GA S+S +  ++
Sbjct: 67  TAAKYGIRGIPTLMLFKDGQAAATKV-GALSKSQLTAFL 104


>gi|160894313|ref|ZP_02075090.1| hypothetical protein CLOL250_01866 [Clostridium sp. L2-50]
 gi|156864014|gb|EDO57445.1| hypothetical protein CLOL250_01866 [Clostridium sp. L2-50]
          Length = 101

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 74/103 (71%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F++EVL     V++DFWASWC PC  + PI+++IA E  D +K+ K++++
Sbjct: 1   MSAININKNNFENEVLNSDKTVLLDFWASWCAPCRMVVPIVEEIAGERRD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA S++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIVQQ-VSGARSKNAILEML 101


>gi|328951912|ref|YP_004369246.1| thioredoxin [Desulfobacca acetoxidans DSM 11109]
 gi|328452236|gb|AEB08065.1| thioredoxin [Desulfobacca acetoxidans DSM 11109]
          Length = 107

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 69/96 (71%), Gaps = 1/96 (1%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L+V   +F+ E+L+   P +VDFWA+WC PC  ++PI++++A +   +VK+ K++++E+S
Sbjct: 5  LQVTDTNFEEEILKSEMPALVDFWAAWCGPCRAIAPIVEELAKDYDGRVKVAKMNVDENS 64

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +   +Y I +IPTLILFK G V+D++  GA S++ I
Sbjct: 65 KTPVKYGIRAIPTLILFKSGAVVDQIT-GAVSKTQI 99


>gi|262273618|ref|ZP_06051432.1| thioredoxin [Grimontia hollisae CIP 101886]
 gi|262222596|gb|EEY73907.1| thioredoxin [Grimontia hollisae CIP 101886]
          Length = 108

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++   SFD++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   KV I KL+I++++
Sbjct: 6   LQLTDDSFDADVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKVTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 104


>gi|315654400|ref|ZP_07907308.1| thioredoxin [Mobiluncus curtisii ATCC 51333]
 gi|315491435|gb|EFU81052.1| thioredoxin [Mobiluncus curtisii ATCC 51333]
          Length = 108

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 65/91 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A++V   +F +EVL+   PV+VDFWA WC PC +++PI+D IA +  D++K+ K D+++
Sbjct: 3  AAIEVTESNFAAEVLDSDVPVLVDFWAVWCGPCRQMAPIVDQIAADFGDRLKVAKCDVDK 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPG 92
          +  +  +Y +S+IPT  +FK GKV+ +++ G
Sbjct: 63 NPSLQAQYGVSAIPTFNIFKGGKVVHQIIGG 93


>gi|47779353|gb|AAT38582.1| predicted thiol-disulfide isomerase/thioredoxin [uncultured gamma
           proteobacterium eBACHOT4E07]
          Length = 108

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 69/97 (71%), Gaps = 1/97 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F +EV+    PV+VDFWA WC PC +L+P+++D ++E  DK+K+ K+D++ + E +  Y 
Sbjct: 13  FQNEVINTEGPVLVDFWAEWCGPCKQLAPLVEDASEEFKDKIKVCKMDVDANRETAAEYG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I SIPTL++F++G+++   + GA S+  + E+I S++
Sbjct: 73  IRSIPTLMIFENGELVGTEI-GALSKLQLEEFIRSKI 108


>gi|189423576|ref|YP_001950753.1| thioredoxin [Geobacter lovleyi SZ]
 gi|189419835|gb|ACD94233.1| thioredoxin [Geobacter lovleyi SZ]
          Length = 109

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + L +   +FD +VL+   PV+VDFWA+WC PC  ++P+ID +A + A KVK+ K+++++
Sbjct: 5   AVLTLSDANFDRDVLQSDLPVLVDFWATWCAPCKAIAPLIDAVAADYAGKVKVGKVNVDD 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +     +Y +  IPTLILFK GKV+D+++ GA  +S +
Sbjct: 65  NPATPGKYGVRGIPTLILFKGGKVVDQVV-GAVPKSQL 101


>gi|302531345|ref|ZP_07283687.1| thioredoxin [Streptomyces sp. AA4]
 gi|302440240|gb|EFL12056.1| thioredoxin [Streptomyces sp. AA4]
          Length = 107

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 68/99 (68%), Gaps = 3/99 (3%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +KV  KSF  +VL    PV+VDFWA+WC PC  ++P++++IA E  DK+ + KLDI+E+ 
Sbjct: 5   VKVTDKSFVDDVLTSEKPVLVDFWATWCGPCKMVAPVLEEIAKENGDKITVAKLDIDENP 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDI 99
             +  YQ+ SIPTLILF+ GK + +++   P A+  SD+
Sbjct: 65  NTARDYQVMSIPTLILFQGGKPVKQIVGAKPKAALLSDL 103


>gi|310643791|ref|YP_003948549.1| thioredoxin [Paenibacillus polymyxa SC2]
 gi|309248741|gb|ADO58308.1| Thioredoxin [Paenibacillus polymyxa SC2]
          Length = 105

 Score = 94.0 bits (232), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  +SF++EV E +  V+VDFWA WC PC  ++PI++D++ E+ D VKI K++++
Sbjct: 1  MAIVNVSDQSFNAEV-EGTGTVLVDFWAPWCGPCKMIAPILEDLSTEVGDSVKIAKVNVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ E ++R+ + SIPTLI+FKDG+ +D+++
Sbjct: 60 ENPESASRFGVMSIPTLIVFKDGQPVDKVV 89


>gi|308070606|ref|YP_003872211.1| thioredoxin (TRX) [Paenibacillus polymyxa E681]
 gi|305859885|gb|ADM71673.1| Thioredoxin (TRX) [Paenibacillus polymyxa E681]
          Length = 105

 Score = 94.0 bits (232), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  +SF++EV E +  V+VDFWA WC PC  ++PI++D++ E+ D VKI K++++
Sbjct: 1  MAIVHVSDQSFNAEV-EGTGTVLVDFWAPWCGPCKMIAPILEDLSTEVGDSVKIAKVNVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ E ++R+ + SIPTLI+FKDG+ +D+++
Sbjct: 60 ENPESASRFGVMSIPTLIVFKDGQPVDKVV 89


>gi|122920507|pdb|2I1U|A Chain A, Mycobacterium Tuberculosis Thioredoxin C
          Length = 121

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 13  ATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDT 72

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++ 
Sbjct: 73  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLR 111


>gi|291561706|emb|CBL40505.1| thioredoxin [butyrate-producing bacterium SS3/4]
          Length = 101

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 72/100 (72%), Gaps = 2/100 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ V+  +F+ EVL    PV++DFWA WC PC  + P++++IA+E +D +K+ K++++
Sbjct: 1   MSAINVNKNNFNQEVLNSDKPVLMDFWAPWCGPCRMVVPLVEEIAEERSD-IKVVKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E  E++ ++ + SIPTL++ K+GKV+++   GA  ++ I+
Sbjct: 60  EEQELAMQFGVMSIPTLVVMKNGKVVNQAT-GARPKAQIL 98


>gi|283779363|ref|YP_003370118.1| thioredoxin [Pirellula staleyi DSM 6068]
 gi|283437816|gb|ADB16258.1| thioredoxin [Pirellula staleyi DSM 6068]
          Length = 110

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++   +F +EV+  S PV+VDFWA WC PC K++P+ID++A E A   KI K++I+ + 
Sbjct: 7   LELTDSNFQTEVISSSQPVLVDFWAPWCGPCRKIAPMIDELASENAGTAKIGKVNIDNNQ 66

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E + +Y I +IPT+I+F+DG+ + R   G  ++S + E
Sbjct: 67  EAAMQYGIEAIPTIIIFRDGQPVQRFQ-GIPAKSRVQE 103


>gi|237809399|ref|YP_002893839.1| thioredoxin [Tolumonas auensis DSM 9187]
 gi|237501660|gb|ACQ94253.1| thioredoxin [Tolumonas auensis DSM 9187]
          Length = 108

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+++VL  S PV+VDFWA WC PC  ++PI+D++A E A K+ I KL+I+++S
Sbjct: 6   VHVTDASFENDVLNASAPVLVDFWAEWCGPCKMIAPILDEVAGEYAGKLTIAKLNIDQNS 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKNGAVAATKV-GALSKTQLKEFL 104


>gi|325281576|ref|YP_004254118.1| thioredoxin [Odoribacter splanchnicus DSM 20712]
 gi|324313385|gb|ADY33938.1| thioredoxin [Odoribacter splanchnicus DSM 20712]
          Length = 105

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 70/101 (69%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A+ V+  +F+  VL+ + PV+VDFWA WC PC  + PI+++I++E A K+ + K+D++ S
Sbjct: 2   AIAVNDSNFEEVVLKSAQPVLVDFWAEWCGPCKMMLPIVEEISEEFAGKITVAKVDVDGS 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              + ++ I +IPT++ FKDGKV D+ + GA  ++ ++E I
Sbjct: 62  PSTAAKFGIRNIPTILFFKDGKVADKQV-GAVPKNSLVEKI 101


>gi|288959563|ref|YP_003449904.1| thioredoxin 1 [Azospirillum sp. B510]
 gi|288911871|dbj|BAI73360.1| thioredoxin 1 [Azospirillum sp. B510]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF+ +VL+   PV+VDFWA WC PC  ++P +D++A E   KV I KL+I+E
Sbjct: 3   TTIKVTDDSFEQDVLKADGPVLVDFWAEWCGPCKMIAPALDELAGEYDGKVTIAKLNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +  T+Y +  IPTL+LFK G V    + GA  +  + +W+
Sbjct: 63  NPDTPTKYGVRGIPTLMLFKGGSVAATKI-GALPKGALFQWV 103


>gi|271501803|ref|YP_003334829.1| thioredoxin [Dickeya dadantii Ech586]
 gi|270345358|gb|ACZ78123.1| thioredoxin [Dickeya dadantii Ech586]
          Length = 141

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PCV  +P+ + +ADE ADK++  K++ E    +S R++I SIPT++LF
Sbjct: 56  PVVVDFWAPWCGPCVNFAPVFESVADENADKIRFVKVNTEAEPALSARFRIRSIPTIMLF 115

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K GK++D M+ GA  ++    W+
Sbjct: 116 KQGKMVD-MLNGAMPKAPFESWL 137


>gi|320540199|ref|ZP_08039854.1| thioredoxin 1 [Serratia symbiotica str. Tucson]
 gi|320029865|gb|EFW11889.1| thioredoxin 1 [Serratia symbiotica str. Tucson]
          Length = 108

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 66/95 (69%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
            SFDS VL+    ++VDFWA WC PC  ++PI+D+IA+E A K+ ITKL+I+++   + +
Sbjct: 11  NSFDSNVLKAEGSILVDFWAEWCAPCKMIAPILDEIAEEFAGKLTITKLNIDQNPATAPK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y I  IPTL+LFK+G+V    + GA S+  + +++
Sbjct: 71  YGIRGIPTLLLFKNGEVAATKV-GALSKGQLKDFL 104


>gi|20807685|ref|NP_622856.1| Thiol-disulfide isomerase and thioredoxins [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516233|gb|AAM24460.1| Thiol-disulfide isomerase and thioredoxins [Thermoanaerobacter
           tengcongensis MB4]
          Length = 223

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + + +K+++ EV+    PV++DFWA WC PC  ++PII+++A E   K+K+ K++++
Sbjct: 1   MAEVVITSKNWEEEVVNSDVPVLIDFWAEWCMPCRLVAPIIEELAKEYEGKIKVGKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ +++I SIPT+ LFK+GK++ +++ GA  ++D +++I
Sbjct: 61  EEDELAMKFRIMSIPTIGLFKNGKMVGKLI-GARPKADFVKFI 102



 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +++ EV+    PV++DFWA WC PC  ++PI++++A E   ++K+ K++++E  E++ ++
Sbjct: 125 NWEEEVVNSDVPVLIDFWAEWCAPCRLVAPIVEELAHEYKGRLKVGKVNVDEEQELAMKF 184

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I SIPT+ LFK GK++D+++ GA  ++D + +I
Sbjct: 185 RIMSIPTIGLFKKGKMVDKII-GARPKADFVRFI 217


>gi|38234907|ref|NP_940674.1| thioredoxin [Corynebacterium diphtheriae NCTC 13129]
 gi|38201172|emb|CAE50896.1| thioredoxin [Corynebacterium diphtheriae]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A+ +   +F S V++   PV+VDFWA WC PC KL PIID+IA+EL D+V + K+D++ 
Sbjct: 3   NAIALTQDTFKSIVIDSDKPVLVDFWAQWCGPCKKLGPIIDEIAEELGDEVLVAKVDVDA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
              +   +QI SIPT+++FKDG+ +   + G   +S+I+
Sbjct: 63  ERNLGAMFQIMSIPTVLIFKDGQKVSEFV-GVRPKSEIV 100


>gi|291287183|ref|YP_003503999.1| thioredoxin [Denitrovibrio acetiphilus DSM 12809]
 gi|290884343|gb|ADD68043.1| thioredoxin [Denitrovibrio acetiphilus DSM 12809]
          Length = 105

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 63/88 (71%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A +++  SF +EVL+   PV++DFWA WC PC  L+P I+ +A E   KVK+ K++++E+
Sbjct: 2  ATELNEASFQTEVLDAETPVLIDFWAVWCGPCRMLTPTIESLASEYQGKVKVGKVNVDEN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           +++ +Y I SIPT+++F  GKV+++ +
Sbjct: 62 QQLAAKYGIMSIPTVMIFNGGKVVEQFI 89


>gi|222054402|ref|YP_002536764.1| thioredoxin [Geobacter sp. FRC-32]
 gi|221563691|gb|ACM19663.1| thioredoxin [Geobacter sp. FRC-32]
          Length = 109

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 66/90 (73%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++ VL+   PV+VDFWA+WC PC  ++P+ID IA+E   K+K+ K++++ES  +  +Y
Sbjct: 13  NFEAAVLQSEIPVLVDFWATWCAPCKAIAPLIDGIAEEYEGKIKVGKVNVDESPGMPGKY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            +  IPT+IL KDGKV+D+++ GA  ++ +
Sbjct: 73  GVRGIPTVILIKDGKVVDQVV-GAVPKAQL 101


>gi|254515492|ref|ZP_05127552.1| thioredoxin [gamma proteobacterium NOR5-3]
 gi|219675214|gb|EED31580.1| thioredoxin [gamma proteobacterium NOR5-3]
          Length = 109

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL    PV+VDFWA WC PC  ++P++D+IA E A K+K+ K+D++ + 
Sbjct: 6   VHVSDASFEKDVLGSDLPVLVDFWAEWCGPCKMIAPVLDEIAGEYAGKLKVCKVDVDANP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+  ++ I  IPTLILFKDG   +    GA S++ ++E++
Sbjct: 66  EVPGKFGIRGIPTLILFKDGNA-EATKVGALSKTQLVEFV 104


>gi|153873432|ref|ZP_02002017.1| thioredoxin [Beggiatoa sp. PS]
 gi|152070103|gb|EDN67984.1| thioredoxin [Beggiatoa sp. PS]
          Length = 108

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD EVL+ + PV+VD+WA WC PC  ++PI++ IA +   ++KI KL+I+E+     +Y
Sbjct: 12  TFDEEVLKSAIPVLVDYWAEWCGPCKMIAPILEGIAPDYVGRLKIAKLNIDENPNTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTLILFKDG+V++  + GA S+S +  +I S +
Sbjct: 72  GIRGIPTLILFKDGEVLNTKI-GALSKSQLTAFIDSNL 108


>gi|90414228|ref|ZP_01222208.1| putative thioredoxin [Photobacterium profundum 3TCK]
 gi|90324675|gb|EAS41216.1| putative thioredoxin [Photobacterium profundum 3TCK]
          Length = 108

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FDS+V+  + PV+VDFWA WC PC  ++PI+D+IA+E   KV I KL+I++++    ++
Sbjct: 12  TFDSDVVNAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGKVTIGKLNIDQNAATPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 104


>gi|289209628|ref|YP_003461694.1| thioredoxin [Thioalkalivibrio sp. K90mix]
 gi|288945259|gb|ADC72958.1| thioredoxin [Thioalkalivibrio sp. K90mix]
          Length = 108

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
            FD +VL+   PV+VD+WA WC PC  ++PI+D+IA+E A KVK+ KL+I+E+     +Y
Sbjct: 12  GFDEDVLKADQPVLVDYWAEWCGPCKMIAPILDEIAEEYAGKVKVAKLNIDENPSTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 72  GIRGIPTLMLFKNGDV-EATKVGALSKSQLTAFL 104


>gi|222873669|gb|EEF10800.1| predicted protein [Populus trichocarpa]
          Length = 223

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +D +SF   V     PVVVDFWA WC PC  ++P  +  A  LA  V++ KLD E   
Sbjct: 121 VALDAQSFARHVGRSQAPVVVDFWAPWCGPCRMMAPAFEQAAQALAPGVQLAKLDTEAHP 180

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + +  Y I SIPT+++FK+G+ I R+  GA    +I+ W+ S
Sbjct: 181 QAAAPYNIRSIPTMVVFKEGREIARVS-GALPAGEIVRWVRS 221


>gi|315657678|ref|ZP_07910560.1| thioredoxin [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|315492150|gb|EFU81759.1| thioredoxin [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 108

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 65/91 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A++V   +F +EVL+   PV+VDFWA WC PC +++PI+D IA +  D++K+ K D+++
Sbjct: 3  AAIEVTDSNFAAEVLDSDVPVLVDFWAVWCGPCRQMAPIVDQIAADFGDRLKVAKCDVDK 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPG 92
          +  +  +Y +S+IPT  +FK GKV+ +++ G
Sbjct: 63 NPSLQAQYGVSAIPTFNIFKGGKVVHQIIGG 93


>gi|226326725|ref|ZP_03802243.1| hypothetical protein PROPEN_00583 [Proteus penneri ATCC 35198]
 gi|225204946|gb|EEG87300.1| hypothetical protein PROPEN_00583 [Proteus penneri ATCC 35198]
          Length = 108

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +    FD++VL  + PV+VDFWA WC PC  ++PI+D++A E A K+ + KL+I+++ 
Sbjct: 6   LHLSDSKFDADVLNATGPVLVDFWAEWCGPCKMIAPILDEVATEYAGKLTVAKLNIDQNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             + +Y I  IPTLILFK+G V    + GA S++ + E++
Sbjct: 66  LTAPKYGIRGIPTLILFKNGAVAATKV-GALSKTQLKEFL 104


>gi|194477218|ref|YP_002049397.1| Thioredoxin [Paulinella chromatophora]
 gi|171192225|gb|ACB43187.1| Thioredoxin [Paulinella chromatophora]
          Length = 111

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA  V   SF++E+L  + PV+VDFWA WC PC  L+PI+D+IA E   K+K+ KL+ +E
Sbjct: 6   SAADVTDASFETEILMSNIPVLVDFWAPWCGPCRMLAPIVDEIAKEFEGKLKVFKLNTDE 65

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +  I+++Y I SIPTL++F +G+ +D ++ GA  +S +
Sbjct: 66  NPTIASQYGIRSIPTLMIFNEGQKVDTVV-GAVPKSTL 102


>gi|301165632|emb|CBW25203.1| thioredoxin [Bacteriovorax marinus SJ]
          Length = 107

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 58/80 (72%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
          K D  SFD++V+    PV+VDFWA WC PC  L+P++D++A E+ +  KI K++++E+ +
Sbjct: 6  KTDQASFDTDVINSDKPVLVDFWAEWCGPCRTLAPVLDEVAGEVGENAKILKVNVDENGD 65

Query: 65 ISTRYQISSIPTLILFKDGK 84
          ++ +Y I  IPT+I FK+G+
Sbjct: 66 LAQKYGIRGIPTMIFFKNGE 85


>gi|160942752|ref|ZP_02089993.1| hypothetical protein FAEPRAM212_00229 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445917|gb|EDP22920.1| hypothetical protein FAEPRAM212_00229 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103828|emb|CBL01372.1| thioredoxin [Faecalibacterium prausnitzii SL3/3]
          Length = 102

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F  EVL    PV++DFWASWC PC  LSP++D++A+E  D VK+ K++++
Sbjct: 1   MAVINITKENFAQEVLHSEKPVLLDFWASWCGPCRMLSPVVDEVAEERTD-VKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  +++ ++ + SIPTL++F+ GK++ R   GA  ++ ++E +
Sbjct: 60  EQPDLAAQFGVMSIPTLLVFEQGKLV-RQAVGARPKAGVLELL 101


>gi|119511940|ref|ZP_01631038.1| Thioredoxin [Nodularia spumigena CCY9414]
 gi|119463436|gb|EAW44375.1| Thioredoxin [Nodularia spumigena CCY9414]
          Length = 109

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 59/86 (68%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S   V   +F  EVLE   PV+VDFWA WC PC  ++P++D++A E A +VK+ KL+ ++
Sbjct: 3  SVTNVTEATFKKEVLESEIPVLVDFWAPWCGPCRMVTPVVDEVAGEYAGQVKVVKLNTDQ 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVID 87
          +  +++ Y I SIPTL++FK G+ +D
Sbjct: 63 NPTVASHYGIRSIPTLMVFKGGRQVD 88


>gi|332877003|ref|ZP_08444756.1| thioredoxin [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685111|gb|EGJ57955.1| thioredoxin [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 105

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 65/95 (68%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F+  VL+ S PV+VDFWA WC PC  L P+I++IA E   KV + KLD++ +
Sbjct: 2  ALEITDGNFEELVLKSSQPVLVDFWAVWCGPCRMLGPVIEEIAKEYEGKVVVGKLDVDNN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
           + + +Y I +IPT+++FKDG+V+ R +  A  ++
Sbjct: 62 QDFAGKYGIRNIPTVLVFKDGEVVGRQVGVAPKKT 96


>gi|323495930|ref|ZP_08100997.1| thioredoxin [Vibrio sinaloensis DSM 21326]
 gi|323319013|gb|EGA71957.1| thioredoxin [Vibrio sinaloensis DSM 21326]
          Length = 108

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++
Sbjct: 6   LQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 104


>gi|256381063|ref|YP_003104723.1| thioredoxin [Actinosynnema mirum DSM 43827]
 gi|255925366|gb|ACU40877.1| thioredoxin [Actinosynnema mirum DSM 43827]
          Length = 108

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + V  K+F  +VL    PV+VDFWA+WC PC  ++P++++IA E ADK+ + KLDI+ 
Sbjct: 4   STVVVSDKTFADDVLTSEKPVLVDFWATWCGPCKMVAPVLEEIAAEHADKITVAKLDIDA 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +  I+  YQI S+PTLILF+ G+ + +++ GA  ++ ++ 
Sbjct: 64  NPGIARDYQIMSVPTLILFQGGRAVKQIV-GAKPKAALLN 102


>gi|297616540|ref|YP_003701699.1| thioredoxin [Syntrophothermus lipocalidus DSM 12680]
 gi|297144377|gb|ADI01134.1| thioredoxin [Syntrophothermus lipocalidus DSM 12680]
          Length = 108

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 72/100 (72%), Gaps = 2/100 (2%)

Query: 1  MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
          MSA++      FD+EVL+   PV+VDFWA+WC PC  + P++++IA + A ++K+ K+++
Sbjct: 1  MSAVQQFGVNDFDAEVLKSDIPVLVDFWAAWCGPCRMVGPVVEEIAQDFAGRLKVGKVNV 60

Query: 60 EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +E+  ++ +Y I SIPTLI+FK+G+  +R++ G  S+ ++
Sbjct: 61 DENRTLAAKYGIMSIPTLIIFKNGQEEERLI-GYQSKGEL 99


>gi|261250045|ref|ZP_05942622.1| thioredoxin reductase [Vibrio orientalis CIP 102891]
 gi|260939549|gb|EEX95534.1| thioredoxin reductase [Vibrio orientalis CIP 102891]
          Length = 108

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++
Sbjct: 6   LQLTDDGFDADVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 104


>gi|123440564|ref|YP_001004558.1| thioredoxin 1 [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|332159794|ref|YP_004296371.1| thioredoxin 1 [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|122087525|emb|CAL10306.1| thioredoxin 1 [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|318607667|emb|CBY29165.1| thioredoxin [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325664024|gb|ADZ40668.1| thioredoxin 1 [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 108

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 68/94 (72%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+I+++   + +Y
Sbjct: 12  SFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLNIDDNQGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LF+DG+V+   + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFRDGEVVATKV-GALSKGQLKEFL 104


>gi|332798119|ref|YP_004459618.1| thioredoxin [Tepidanaerobacter sp. Re1]
 gi|332695854|gb|AEE90311.1| thioredoxin [Tepidanaerobacter sp. Re1]
          Length = 104

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 65/101 (64%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L +   +F  EVL+    V+VDFWA WC PC  + P+ID+IA E +D +K+ KL+++
Sbjct: 1   MKPLTITDDNFAQEVLQAEGKVLVDFWAPWCGPCRMMGPVIDEIAAEYSDSLKVGKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E+ + ++ Y + SIPTLILF++GKV  +++     Q  + E
Sbjct: 61  ENPKTASNYGVMSIPTLILFENGKVAKKLVGFRPKQELVAE 101


>gi|156630909|sp|P10472|THIO_CHLLT RecName: Full=Thioredoxin; Short=Trx
          Length = 108

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 60/82 (73%)

Query: 9  KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
          K+F +E+L+    V+VDFWASWC PC+ L P+I+ +AD+   K  I KL+++E+  I+ +
Sbjct: 10 KNFQTEILDSDKAVLVDFWASWCGPCMMLGPVIEQLADDYEGKAIIAKLNVDENPNIAGQ 69

Query: 69 YQISSIPTLILFKDGKVIDRMM 90
          Y I SIPT+++ K GKV+D+M+
Sbjct: 70 YGIRSIPTMLIIKGGKVVDQMV 91


>gi|303241857|ref|ZP_07328352.1| thioredoxin [Acetivibrio cellulolyticus CD2]
 gi|302590632|gb|EFL60385.1| thioredoxin [Acetivibrio cellulolyticus CD2]
          Length = 109

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EVL+    V+VDFWA WC PC  + PI+D++A E   K KI+KL++++ +E++ ++
Sbjct: 13  NFEQEVLKSEKAVLVDFWAPWCGPCRAVGPIVDELASEYNGKAKISKLNVQDENELAAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           ++ SIPT+++FK+G V+++++ GA S+S++
Sbjct: 73  RVMSIPTIMIFKNGDVVEKVV-GARSKSEL 101


>gi|317049241|ref|YP_004116889.1| thioredoxin [Pantoea sp. At-9b]
 gi|316950858|gb|ADU70333.1| thioredoxin [Pantoea sp. At-9b]
          Length = 139

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PCV  +P+  D+ADE   KV+  K++ E    +S+R++I SIPT++LF
Sbjct: 54  PVVVDFWAPWCGPCVNFAPVFKDVADERRGKVRFVKVNTEAEPALSSRFRIRSIPTIMLF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+++D M+ GA  ++   EW+
Sbjct: 114 KNGELVD-MLNGAMPKAPFNEWL 135


>gi|302879645|ref|YP_003848209.1| thioredoxin [Gallionella capsiferriformans ES-2]
 gi|302582434|gb|ADL56445.1| thioredoxin [Gallionella capsiferriformans ES-2]
          Length = 108

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +FD+EV++ + PV+VD+WA WC PC  ++PI+D+IA E A ++ I KL+++E+ + 
Sbjct: 8   VTDATFDAEVIQAALPVLVDYWAEWCGPCRMIAPILDEIAKEYAGRLTIAKLNVDENQQT 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ +  IPTL+LFK+G  I+    GA S+S +  +I S +
Sbjct: 68  PQKFGVRGIPTLMLFKNGN-IEATKVGALSKSQLTAFIDSHI 108


>gi|144901314|emb|CAM78178.1| Thioredoxin (TRX) [Magnetospirillum gryphiswaldense MSR-1]
          Length = 104

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V  ++F++EVL+   PV+VDFWA WC PC +++P ++D+A +L  K+ + K++I+E+  
Sbjct: 3   NVTDQTFETEVLKADGPVLVDFWAEWCGPCRQIAPALEDLAKDLEGKLTVAKINIDENPG 62

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
              +Y +  IPTL++FK G+V    + GA  +S ++EW+ S
Sbjct: 63  TPGKYGVRGIPTLMIFKGGQVAATKI-GALPKSKLVEWVNS 102


>gi|238759815|ref|ZP_04620972.1| Thioredoxin 1 [Yersinia aldovae ATCC 35236]
 gi|238701958|gb|EEP94518.1| Thioredoxin 1 [Yersinia aldovae ATCC 35236]
          Length = 108

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 59/77 (76%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IADE   ++ ITKL+I+++   + +Y
Sbjct: 12 SFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIADEYEGRLTITKLNIDDNQGTAPKY 71

Query: 70 QISSIPTLILFKDGKVI 86
           I  IPTL+LF+DG+V+
Sbjct: 72 GIRGIPTLLLFRDGEVV 88


>gi|121998835|ref|YP_001003622.1| thioredoxin [Halorhodospira halophila SL1]
 gi|121590240|gb|ABM62820.1| thioredoxin [Halorhodospira halophila SL1]
          Length = 108

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F+ EVL+ S PV+VD+WA WC PC  + PI+++IA +  D++K+ KL+I+E+ E   +
Sbjct: 11  QNFEQEVLQASVPVLVDYWAEWCGPCKMIGPILEEIAADYGDRLKVVKLNIDENPETPPK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           Y I  IPTL+LFK G V +    GA S+S +  +I S +
Sbjct: 71  YGIRGIPTLMLFKGGNV-EATKVGALSKSQLTAFIDSNL 108


>gi|331090541|ref|ZP_08339394.1| thioredoxin [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405884|gb|EGG85412.1| thioredoxin [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 102

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 74/103 (71%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M AL +   +F++EV++   PV++DFWA+WC PC  + PII ++A+E+    KI K++++
Sbjct: 1   MEALNITIDNFETEVMQSDKPVLIDFWATWCGPCQMVLPIIKELAEEVTH-AKICKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++++ SIPTL++ KDG+++ R + GA S+ +I+E I
Sbjct: 60  EQPELAKKFRVLSIPTLMVIKDGEIVKREV-GAKSKEEILELI 101


>gi|110598245|ref|ZP_01386521.1| thioredoxin [Chlorobium ferrooxidans DSM 13031]
 gi|110340160|gb|EAT58659.1| thioredoxin [Chlorobium ferrooxidans DSM 13031]
          Length = 109

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 67/96 (69%), Gaps = 1/96 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L    ++F +E+LE     +VDFWA+WC PC+ L P+ID++A E A +  + K++++E+ 
Sbjct: 6   LAATDQNFTTEILESDKVALVDFWATWCGPCMMLGPVIDELAGEYAGRAVVAKVNVDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
             + RY I SIP+L++FK+G+V+D+++ GA  ++ I
Sbjct: 66  ATAARYGIRSIPSLLIFKNGQVVDQLL-GAIPKNQI 100


>gi|261823429|ref|YP_003261535.1| thioredoxin [Pectobacterium wasabiae WPP163]
 gi|261607442|gb|ACX89928.1| thioredoxin [Pectobacterium wasabiae WPP163]
          Length = 108

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ +TKL+I+E+   + +Y
Sbjct: 12  SFDTKVLQADGATLVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLTANL 108


>gi|251788491|ref|YP_003003212.1| thioredoxin 2 [Dickeya zeae Ech1591]
 gi|247537112|gb|ACT05733.1| thioredoxin [Dickeya zeae Ech1591]
          Length = 141

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PCV  +P+ + +ADE ADK++  K++ E    +S R++I SIPT++LF
Sbjct: 56  PVVVDFWAPWCGPCVNFAPVFESVADENADKIRFIKVNTEAEPGLSARFRIRSIPTIMLF 115

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K GK++D M+ GA  ++    W+
Sbjct: 116 KQGKMVD-MLNGAMPKAPFESWL 137


>gi|91789225|ref|YP_550177.1| thioredoxin [Polaromonas sp. JS666]
 gi|91698450|gb|ABE45279.1| thioredoxin [Polaromonas sp. JS666]
          Length = 145

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           +D  +FD  +     PV+VDFWA WC PC +++P  + +A +L  +V++ K+D E    +
Sbjct: 44  LDEAAFDKHIGRNHIPVLVDFWAPWCGPCRQMAPAYEQVAAQLEPRVRVAKVDTEAVPNL 103

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             R+ I SIPTL LF++G+ + R   GA   +DI+ W+ S++
Sbjct: 104 GARFNIRSIPTLALFQNGREVARQA-GAMGAADIVRWVQSKL 144


>gi|238789357|ref|ZP_04633143.1| Thioredoxin 1 [Yersinia frederiksenii ATCC 33641]
 gi|238722500|gb|EEQ14154.1| Thioredoxin 1 [Yersinia frederiksenii ATCC 33641]
          Length = 108

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 59/77 (76%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+I+E+   + +Y
Sbjct: 12 SFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLNIDENQGTAPKY 71

Query: 70 QISSIPTLILFKDGKVI 86
           I  IPTL+LF+DG+V+
Sbjct: 72 GIRGIPTLLLFRDGEVV 88


>gi|157273326|gb|ABV27225.1| thioredoxin [Candidatus Chloracidobacterium thermophilum]
          Length = 110

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++   +F+ EVL+   PV+VDFWA+WC PC  L+P ++ +A++ A +V++ KL+++E
Sbjct: 4   NVIEITDSNFEREVLQSDRPVLVDFWAAWCAPCRMLAPTVESLANDYAGRVRVGKLNVDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +++ + R+ I  IPTLI+FK+G+  +R+  GA  +  I
Sbjct: 64  NNQTAARFGIRGIPTLIVFKNGREQERLT-GAHPKDTI 100


>gi|294142599|ref|YP_003558577.1| thioredoxin 1 [Shewanella violacea DSS12]
 gi|293329068|dbj|BAJ03799.1| thioredoxin 1 [Shewanella violacea DSS12]
          Length = 108

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 68/94 (72%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V++   PVVVDFWA WC PC  ++PI+DD+ADE A KV I KL+++++S    +Y
Sbjct: 12  SFENDVIKSELPVVVDFWAEWCGPCKMIAPILDDVADEYAGKVTIAKLNVDQNSVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL++FK+G++    + GA S++ + E+I
Sbjct: 72  GVRGIPTLLIFKNGELAGTKV-GALSKTQLKEFI 104


>gi|257455702|ref|ZP_05620931.1| thioredoxin [Enhydrobacter aerosaccus SK60]
 gi|257446985|gb|EEV21999.1| thioredoxin [Enhydrobacter aerosaccus SK60]
          Length = 107

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 61/89 (68%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S +  D  +F+  VL+   PV+VDFWA+WC PC  ++P++D+++ E   K +I K+D+++
Sbjct: 3  SVIHADEGTFEKAVLQSDTPVLVDFWATWCGPCKAIAPVLDELSSEFEGKARIVKIDVDQ 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++ +Y I SIPTL +FK+G+ +D  M
Sbjct: 63 NPNLAAQYGIRSIPTLFMFKNGEKVDATM 91


>gi|332975615|gb|EGK12504.1| thioredoxin [Psychrobacter sp. 1501(2011)]
          Length = 108

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 72/101 (71%), Gaps = 3/101 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS L  +T   +FD +V +   PV+VDFWA+WC PC  ++PI+++IA++   KVKI K+D
Sbjct: 1   MSDLITNTTDANFDQDVAQSDVPVLVDFWAAWCGPCKAIAPILEEIANDYNGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           ++E+ E ++R+ I SIPTL++FK G+ +D +M G   ++D+
Sbjct: 61  VDENPETASRFGIRSIPTLMVFKGGEKVDTVM-GLQPKADL 100


>gi|71282174|ref|YP_266943.1| thioredoxin [Colwellia psychrerythraea 34H]
 gi|71147914|gb|AAZ28387.1| thioredoxin [Colwellia psychrerythraea 34H]
          Length = 108

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+ S  V+VDFWA WC PC  ++P++DDIA E   KV + KL+I+++S    +Y
Sbjct: 12  SFEADVLKASGLVLVDFWAEWCGPCKMIAPVLDDIATEYDGKVTVGKLNIDQNSATPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFKDG++ D  + GA S++ + E++
Sbjct: 72  GVRGIPTLLLFKDGEIADTKV-GALSKTQLKEFL 104


>gi|291303861|ref|YP_003515139.1| thioredoxin [Stackebrandtia nassauensis DSM 44728]
 gi|290573081|gb|ADD46046.1| thioredoxin [Stackebrandtia nassauensis DSM 44728]
          Length = 106

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 1   MSALKVDT-KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M ++K  T  SF ++VL+   PV+VDFWA WC PC K+SP+++++A E++DKV++ K+D 
Sbjct: 1   MGSMKAVTDASFKADVLDADKPVLVDFWAEWCGPCRKVSPVLEELATEMSDKVRVVKVDT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + +     +YQI S+PT++LFK G+ +  ++ GA  +S+I + I S
Sbjct: 61  DANPNTMRQYQIMSVPTIMLFKGGEQVGAIV-GAKPKSEIRKLIES 105


>gi|152979502|ref|YP_001345131.1| thioredoxin [Actinobacillus succinogenes 130Z]
 gi|150841225|gb|ABR75196.1| thioredoxin [Actinobacillus succinogenes 130Z]
          Length = 107

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV++DFWA WC PC  + PI++++A E  DKVKI K++I+E+     ++
Sbjct: 11  SFEADVLKADVPVLLDFWAPWCGPCRMVGPILEELAAEYGDKVKIVKINIDENQGTPAQF 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + SIPTL+LFKDGKV+   + GA  ++ +  ++
Sbjct: 71  GVRSIPTLLLFKDGKVVGTQV-GALPKNQLANFV 103


>gi|289549127|ref|YP_003474115.1| thioredoxin [Thermocrinis albus DSM 14484]
 gi|289182744|gb|ADC89988.1| thioredoxin [Thermocrinis albus DSM 14484]
          Length = 108

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           ++ SEV+  S PVVVDFWA WC PC  ++PII+++A EL  KVK  KL+ +E+  I+ +Y
Sbjct: 12  NWHSEVINSSIPVVVDFWAPWCGPCRIIAPIIEELAAELEGKVKFGKLNTDENPNIAMQY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I +IPT++LFK+G+V+D  + G   +  + + ILS +
Sbjct: 72  GIRAIPTIMLFKNGEVVDTRI-GVQPKEALKQMILSHL 108


>gi|260062294|ref|YP_003195374.1| putative thioredoxin [Robiginitalea biformata HTCC2501]
 gi|88783856|gb|EAR15027.1| putative thioredoxin [Robiginitalea biformata HTCC2501]
          Length = 101

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 64/89 (71%), Gaps = 1/89 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S+++   NPV+VDF+A WC PC  L+PI+ ++  EL D++++ K+D++ + E++ RYQ+ 
Sbjct: 6   SDLIRSENPVLVDFYADWCGPCKTLAPILKEVKGELGDRLRVVKVDVDRNQEVAGRYQVR 65

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            +PT+ILFK+GKV+ R   G  S+ D++ 
Sbjct: 66  GVPTMILFKNGKVLWR-QSGVLSKPDLLR 93


>gi|218437805|ref|YP_002376134.1| thioredoxin [Cyanothece sp. PCC 7424]
 gi|218170533|gb|ACK69266.1| thioredoxin [Cyanothece sp. PCC 7424]
          Length = 107

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A  V   SF  EVL+   PV+VDFWA WC PC  ++P++D+IA++ A +VK+ KL+ +E
Sbjct: 3  AAAPVTDDSFKQEVLDSEIPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQVKVVKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +  ++++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPSVASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTL 99


>gi|6573652|pdb|1DBY|A Chain A, Nmr Structures Of Chloroplast Thioredoxin M Ch2 From The
           Green Alga Chlamydomonas Reinhardtii
          Length = 107

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M A  V+  +F + VLE S PV+VDFWA WC PC  ++P++D+IA E  DK+K  KL+ +
Sbjct: 1   MEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           ES  +++ Y I SIPT+++FK GK  + ++ GA  ++ I++
Sbjct: 61  ESPNVASEYGIRSIPTIMVFKGGKKCETII-GAVPKATIVQ 100


>gi|153813840|ref|ZP_01966508.1| hypothetical protein RUMTOR_00046 [Ruminococcus torques ATCC
          27756]
 gi|317501976|ref|ZP_07960160.1| thioredoxin [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088208|ref|ZP_08337127.1| thioredoxin [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145848236|gb|EDK25154.1| hypothetical protein RUMTOR_00046 [Ruminococcus torques ATCC
          27756]
 gi|316896656|gb|EFV18743.1| thioredoxin [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330408452|gb|EGG87918.1| thioredoxin [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 102

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (71%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K+ T +FD EVL+   PV+VDF+A WC PC  + P++++I+ EL D VK+ K++I+
Sbjct: 1  MAVVKLTTANFDQEVLQADRPVLVDFYADWCGPCKMMGPVVEEISGEL-DDVKVCKINID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ RY + SIPT I FK+G++  +
Sbjct: 60 EEMEVAQRYGVMSIPTFIAFKNGEMTGK 87


>gi|258655498|ref|YP_003204654.1| thioredoxin [Nakamurella multipartita DSM 44233]
 gi|258558723|gb|ACV81665.1| thioredoxin [Nakamurella multipartita DSM 44233]
          Length = 107

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 71/100 (71%), Gaps = 1/100 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF ++VL+   PV+VDFWA WC PC  ++PI+++IA +   KV + KLDI+
Sbjct: 1   MATVKVTDDSFTTDVLQSDKPVIVDFWAEWCGPCRMVAPILEEIATKHEGKVTVAKLDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
            + +I+ +YQI SIPT+++F+ GK + +++ GA  ++ ++
Sbjct: 61  ANPQIAQQYQILSIPTMLVFQGGKPVKQVV-GAKPKAALL 99


>gi|163856282|ref|YP_001630580.1| thioredoxin [Bordetella petrii DSM 12804]
 gi|163260010|emb|CAP42311.1| thioredoxin [Bordetella petrii]
          Length = 173

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SFD++V++ S PV+VD+WA+WC PC  ++PI++++A E + ++ + KL+++E+  
Sbjct: 72  NVSDASFDADVIKSSQPVLVDYWAAWCGPCKMIAPILEEVASEYSGRLTVAKLNVDENQG 131

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + +Y I  IPTL+LFKDG+     + GA S+S +  ++
Sbjct: 132 TAAKYGIRGIPTLMLFKDGQAAATKV-GALSKSQLTAFL 169


>gi|332712300|ref|ZP_08432228.1| thioredoxin [Lyngbya majuscula 3L]
 gi|332349106|gb|EGJ28718.1| thioredoxin [Lyngbya majuscula 3L]
          Length = 107

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 1/97 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A  V   SF  EVLE   PV+VDFWA WC PC  +SP++D+IAD+   +VK+ KL+ +E+
Sbjct: 4  AAPVTDSSFQKEVLESDIPVLVDFWAPWCGPCRMVSPVVDEIADQYEGQVKVVKLNTDEN 63

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +++  Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 64 PKVAGDYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTL 99


>gi|238918069|ref|YP_002931583.1| thioredoxin, [Edwardsiella ictaluri 93-146]
 gi|269137457|ref|YP_003294157.1| thioredoxin domain-containing protein [Edwardsiella tarda EIB202]
 gi|238867637|gb|ACR67348.1| thioredoxin, putative [Edwardsiella ictaluri 93-146]
 gi|267983117|gb|ACY82946.1| thioredoxin domain-containing protein [Edwardsiella tarda EIB202]
 gi|304557531|gb|ADM40195.1| thioredoxin domain-containing protein [Edwardsiella tarda FL6-60]
          Length = 108

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
            F+++VL+   P++VDFWA WC PC  ++PI+D+IA E A K+ I KL+I+E+   + +Y
Sbjct: 12  GFEADVLKAEGPILVDFWAEWCGPCKMIAPILDEIAAEYAGKLTIAKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKNGAVAATKV-GALSKTQLKEFL 104


>gi|315125229|ref|YP_004067232.1| thioredoxin [Pseudoalteromonas sp. SM9913]
 gi|315013742|gb|ADT67080.1| thioredoxin [Pseudoalteromonas sp. SM9913]
          Length = 108

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   SF+++VL+   PV+VDFWA WC PC  ++PI+ ++A+E   +V ITKL+I++++
Sbjct: 6   IQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILSEVAEEFDGRVTITKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               ++ I  IPTL+LFKDG+V    + GA S++ ++E++ + +
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLVEFLENNI 108


>gi|88812430|ref|ZP_01127679.1| thioredoxin [Nitrococcus mobilis Nb-231]
 gi|88790216|gb|EAR21334.1| thioredoxin [Nitrococcus mobilis Nb-231]
          Length = 108

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F+ EVL+ + PV+VD+WA WC PC  ++PI+D++A+  A K+K+ KL+I+++ E   +
Sbjct: 11  ETFEQEVLKAAEPVLVDYWAEWCGPCKMIAPILDEVAEAYAGKLKVIKLNIDDNPETPPK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           Y I  IPTL+LFK+G+V +    GA S+S +  ++ S +
Sbjct: 71  YGIRGIPTLMLFKNGEV-EATKVGAVSKSQLTAFLDSNL 108


>gi|271970542|ref|YP_003344738.1| thioredoxin [Streptosporangium roseum DSM 43021]
 gi|270513717|gb|ACZ91995.1| thioredoxin [Streptosporangium roseum DSM 43021]
          Length = 107

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 71/98 (72%), Gaps = 2/98 (2%)

Query: 1  MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
          M A+K V   SFD++VL+   PV+VDFWA WC PC +++PI+++IA+E ADK+ I KL++
Sbjct: 1  MGAIKNVTDASFDADVLKSDKPVIVDFWAEWCGPCRQVAPILEEIANEQADKLTIVKLNV 60

Query: 60 EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          +E+   +  Y +  IPTL ++K+G+V+ +++ GA  ++
Sbjct: 61 DENPSTAGNYGVLQIPTLNVYKNGEVVKQII-GAKPKA 97


>gi|126738526|ref|ZP_01754231.1| thioredoxin [Roseobacter sp. SK209-2-6]
 gi|126720325|gb|EBA17031.1| thioredoxin [Roseobacter sp. SK209-2-6]
          Length = 106

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V  ++FD+EV   S PVVVDFWA WC PC ++ P ++++A E  DKVKI K+D++
Sbjct: 1   MSTVAVTDETFDAEVKNSSVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGQVVSNRA-GAAPKAALQSWI 102


>gi|54310594|ref|YP_131614.1| putative thioredoxin [Photobacterium profundum SS9]
 gi|46915037|emb|CAG21812.1| putative thioredoxin [Photobacterium profundum SS9]
          Length = 112

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FDS+V+  + PV+VDFWA WC PC  ++PI+D+IA+E   KV I KL+I++++    ++
Sbjct: 16  TFDSDVVNAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGKVTIGKLNIDQNAATPPKF 75

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 76  GIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 108


>gi|88797353|ref|ZP_01112943.1| thioredoxin [Reinekea sp. MED297]
 gi|88780222|gb|EAR11407.1| thioredoxin [Reinekea sp. MED297]
          Length = 108

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SF+++VL   +PV+VD+WA WC PC  ++P+++++ADE A K+ + KL+I+++ 
Sbjct: 6   LNVTDDSFETDVLRNEHPVLVDYWAEWCGPCKMIAPVLEEVADEYAGKMVVAKLNIDDNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               +Y I  IPTL++FK G+V    + GA S+S ++E+I S 
Sbjct: 66  NTPPKYGIRGIPTLMIFKGGEVAATKV-GALSKSQLLEFIQSN 107


>gi|315506954|ref|YP_004085841.1| thioredoxin [Micromonospora sp. L5]
 gi|315413573|gb|ADU11690.1| thioredoxin [Micromonospora sp. L5]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 72/106 (67%), Gaps = 2/106 (1%)

Query: 1   MSALKVDT-KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M A K  T  SF  +VL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I
Sbjct: 1   MGATKAVTDASFVIDVLQSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMKDQVTIVKLNI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +E+ E +  Y++ S+PTL +FK+G+ +  +  GA  + ++++ I S
Sbjct: 61  DENPETARAYRVMSVPTLTIFKNGQPVQSIA-GAKPKGELVKLIES 105


>gi|260579550|ref|ZP_05847421.1| thioredoxin-1 [Corynebacterium jeikeium ATCC 43734]
 gi|258602321|gb|EEW15627.1| thioredoxin-1 [Corynebacterium jeikeium ATCC 43734]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 58/81 (71%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V   +F SEV+E + PV+VDFWA WCRPC+ ++PI+D++A E   K KI K++++E  
Sbjct: 5  VNVTQTTFKSEVVESTQPVLVDFWAEWCRPCLAMTPILDELAAEFDGKAKIAKVNVDEER 64

Query: 64 EISTRYQISSIPTLILFKDGK 84
           +   +Q+ SIP L++FKDG+
Sbjct: 65 MLGAMFQVMSIPALMVFKDGE 85


>gi|307154247|ref|YP_003889631.1| thioredoxin [Cyanothece sp. PCC 7822]
 gi|306984475|gb|ADN16356.1| thioredoxin [Cyanothece sp. PCC 7822]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A  V   SF  EVLE   PV+VDFWA WC PC  ++P++D+IA++ A ++K+ KL+ ++
Sbjct: 3  AAAAVTDDSFKQEVLESEIPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQIKVVKLNTDD 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +  I+++Y I SIPTL++FK G  +D M+ GA  ++ +
Sbjct: 63 NPNIASQYGIRSIPTLMIFKGGNKVD-MVVGAVPKTTL 99


>gi|93007116|ref|YP_581553.1| thioredoxin [Psychrobacter cryohalolentis K5]
 gi|92394794|gb|ABE76069.1| thioredoxin [Psychrobacter cryohalolentis K5]
          Length = 120

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 66/92 (71%), Gaps = 2/92 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS L V+T   +FD +VL+   PV+VDFWA+WC PC  ++PI++D+A E   KVKI K+D
Sbjct: 13  MSDLIVNTTDANFDQDVLQSDVPVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVD 72

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMM 90
           ++ + + ++R+ I +IPTL +FK G+ +D +M
Sbjct: 73  VDNNPQAASRFGIRNIPTLFVFKGGEKVDSVM 104


>gi|221133952|ref|ZP_03560257.1| thioredoxin [Glaciecola sp. HTCC2999]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (67%), Gaps = 1/93 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F+++VL    PV+VDFWA WC PC  ++PI+ +IAD    KVKI KL+++E SE   ++ 
Sbjct: 13  FEADVLNAEGPVLVDFWAEWCGPCKMIAPILSEIADTYEGKVKIGKLNVDEFSETPKKFG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 73  IRGIPTLLLFKDGNVAGTKV-GALSKAQLEEFL 104


>gi|21244554|ref|NP_644136.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
 gi|21110229|gb|AAM38672.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
          Length = 113

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 57/81 (70%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++++++  
Sbjct: 7  HVGDADFDTAVLQAGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRA 66

Query: 65 ISTRYQISSIPTLILFKDGKV 85
          ++ +Y + SIP L+LFKDG+V
Sbjct: 67 LAIKYHVRSIPMLLLFKDGQV 87


>gi|260901494|ref|ZP_05909889.1| thioredoxin-2 [Vibrio parahaemolyticus AQ4037]
 gi|308107681|gb|EFO45221.1| thioredoxin-2 [Vibrio parahaemolyticus AQ4037]
 gi|328470730|gb|EGF41641.1| thioredoxin 2 [Vibrio parahaemolyticus 10329]
          Length = 144

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +LE S PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E   +++ ++ I 
Sbjct: 49  SALLESSTPVVVDFWAPWCNPCVGFAPVFSDVAQEQAGTARFVKIDTEAQQQLAAQFGIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  +S   +W+
Sbjct: 109 SIPTIMVFKNGQRVD-MLNGALPKSQFDQWL 138


>gi|144989|gb|AAA23305.1| thioredoxin C-2 [Corynebacterium nephridii]
          Length = 123

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 73/104 (70%), Gaps = 3/104 (2%)

Query: 2   SALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           SA  V+T  ++F ++VL+   PV+VDFWA WC PC  ++P+++++++E A KVKI K+D+
Sbjct: 17  SATIVNTTDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEELSNEYAGKVKIVKVDV 76

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               + + +Y I +IP L++FKDG+V+ + + GA+ +S +  +I
Sbjct: 77  TSCEDTAVKYNIRNIPALLMFKDGEVVAQQV-GAAPRSKLAAFI 119


>gi|269103751|ref|ZP_06156448.1| thioredoxin [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163649|gb|EEZ42145.1| thioredoxin [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFDS+V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+I++++    ++
Sbjct: 12  SFDSDVVNAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDQNAGTPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 104


>gi|238793925|ref|ZP_04637544.1| Thioredoxin 2 [Yersinia intermedia ATCC 29909]
 gi|238726692|gb|EEQ18227.1| Thioredoxin 2 [Yersinia intermedia ATCC 29909]
          Length = 146

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 65/104 (62%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E A KV+  K++ 
Sbjct: 33  FDGEVINATTETLDKLLQDDLPVVIDFWAPWCGPCRSFAPIFEDVAAERAGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+STR++I SIPT++L+++GK+ID M+ GA  ++    W+
Sbjct: 93  EAEPELSTRFRIRSIPTIMLYRNGKMID-MLSGALPKAPFDHWL 135


>gi|186685639|ref|YP_001868835.1| thioredoxin [Nostoc punctiforme PCC 73102]
 gi|186468091|gb|ACC83892.1| thioredoxin [Nostoc punctiforme PCC 73102]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A +V   SF  EVL+   PV+VDFWA WC PC  ++P++D+I+++   ++K+ K++ +E
Sbjct: 3  TAAQVTDSSFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEISEQYKGQIKVVKVNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          + +++++Y I SIPTL++FKDG+ +D M+ GA  +S +
Sbjct: 63 NPQVASQYGIRSIPTLMIFKDGQKVD-MVVGAVPKSTL 99


>gi|298531010|ref|ZP_07018411.1| thioredoxin [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509033|gb|EFI32938.1| thioredoxin [Desulfonatronospira thiodismutans ASO3-1]
          Length = 105

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F+ EVL+C  PV+VDFWA WC PC  + P+++++A E   ++K+ K++++E+   
Sbjct: 5   VTDNNFEEEVLKCELPVLVDFWAPWCGPCRAIGPVVEELAQEYTGRLKVLKMNVDENPGT 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             +Y I +IPTLIL+K G V++++  GA S++++ + I
Sbjct: 65  PGKYGIRAIPTLILYKGGDVMEQVT-GAVSKANLKQMI 101


>gi|121605095|ref|YP_982424.1| thioredoxin [Polaromonas naphthalenivorans CJ2]
 gi|120594064|gb|ABM37503.1| thioredoxin [Polaromonas naphthalenivorans CJ2]
          Length = 110

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD++VL+ S PV+VD+WA WC PC  ++PI+D++A     K++I K++++E+ EI  ++
Sbjct: 13  TFDADVLKSSTPVLVDYWAEWCGPCKMIAPILDEVATGYEGKLQIAKMNVDENREIPAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG++    + GA S+S +  +I
Sbjct: 73  GIRGIPTLMLFKDGQLAATKV-GALSKSQLTAFI 105


>gi|33602206|ref|NP_889766.1| thioredoxin 1 [Bordetella bronchiseptica RB50]
 gi|33576644|emb|CAE33722.1| thioredoxin 1 [Bordetella bronchiseptica RB50]
          Length = 141

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+++VL+   PV+VD+WA+WC PC  ++PI++++A E A ++ + KL+++E+ +
Sbjct: 40  NVSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVASEYAGRLTVAKLNVDENQD 99

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + +Y +  IPTL+LFKDG+     + GA S+S +  ++
Sbjct: 100 TAAKYGVRGIPTLMLFKDGQAAATKV-GALSKSQLTAFL 137


>gi|117929356|ref|YP_873907.1| thioredoxin [Acidothermus cellulolyticus 11B]
 gi|117649819|gb|ABK53921.1| thioredoxin [Acidothermus cellulolyticus 11B]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 71/96 (73%), Gaps = 1/96 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V  ++F+SEVL    PV+VDFWA WC PC  ++P++++IA E  DK++I KL+++E+ + 
Sbjct: 7   VTDETFESEVLASDKPVLVDFWAEWCGPCRMVAPVLEEIAAEYGDKLRIVKLNVDENPKT 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +  Y I SIPTL +F++G+V+ +++ GA S++ +++
Sbjct: 67  TQAYSILSIPTLNVFQNGQVVKQIV-GAKSKAALLK 101


>gi|119469629|ref|ZP_01612498.1| thioredoxin 1, redox factor [Alteromonadales bacterium TW-7]
 gi|119446876|gb|EAW28147.1| thioredoxin 1, redox factor [Alteromonadales bacterium TW-7]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 71/100 (71%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   SF+++VL+   PV+VDFWA WC PC  ++PI++++ADE   +V + KL+I++++
Sbjct: 6   IQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILNEVADEYDGRVAVAKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG+V    + GA S++ +IE++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLIEFL 104


>gi|308272035|emb|CBX28643.1| Thioredoxin [uncultured Desulfobacterium sp.]
          Length = 121

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 67/96 (69%), Gaps = 1/96 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++  +SF++EV++   PV+VDFWA WC PC  + PI++++A E  DK+K  K +I+ + 
Sbjct: 19  LEISDESFEAEVMKSEKPVLVDFWAPWCGPCKAIGPIVEELATEFGDKIKFAKCNIDNNP 78

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
               ++ I +IPTLI+FK GKV+D++  G +++S +
Sbjct: 79  LSPAKFGIKAIPTLIIFKQGKVVDQIT-GMTAKSKL 113


>gi|330470819|ref|YP_004408562.1| thioredoxin [Verrucosispora maris AB-18-032]
 gi|328813790|gb|AEB47962.1| thioredoxin [Verrucosispora maris AB-18-032]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 72/106 (67%), Gaps = 2/106 (1%)

Query: 1   MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M A K V   SF  +VL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I
Sbjct: 1   MGATKSVTDASFVVDVLKSDKPVLVDFWAEWCGPCRKVSPLLEEIAREMGDQVSIVKLNI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +E+ E +  Y++ S+PTL +FK+G+ +  +  GA  + ++++ I S
Sbjct: 61  DENPETARAYRVMSVPTLTVFKNGEPVQSIA-GAKPKGELVKLIQS 105


>gi|68537189|ref|YP_251894.1| thioredoxin [Corynebacterium jeikeium K411]
 gi|68264788|emb|CAI38276.1| thioredoxin [Corynebacterium jeikeium K411]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 58/81 (71%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V   +F SEV+E + PV+VDFWA WCRPC+ ++PI+D++A E   K KI K++++E  
Sbjct: 5  VNVTQTTFRSEVVESTQPVLVDFWAEWCRPCLAMTPILDELAAEFDGKAKIAKVNVDEER 64

Query: 64 EISTRYQISSIPTLILFKDGK 84
           +   +Q+ SIP L++FKDG+
Sbjct: 65 MLGAMFQVMSIPALMVFKDGE 85


>gi|73748494|ref|YP_307733.1| thioredoxin [Dehalococcoides sp. CBDB1]
 gi|289432542|ref|YP_003462415.1| thioredoxin [Dehalococcoides sp. GT]
 gi|73660210|emb|CAI82817.1| thioredoxin [Dehalococcoides sp. CBDB1]
 gi|288946262|gb|ADC73959.1| thioredoxin [Dehalococcoides sp. GT]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++  +SF +EVL+   PV+VDFWA WC PC  ++PIID ++ + A K K  KL+++E+ 
Sbjct: 3   MEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYAGKFKFCKLNVDENK 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             +T+Y++ SIPTL+ FK G+V D M+ GA  +S + + I
Sbjct: 63  TTATQYRVMSIPTLLFFKGGQVAD-MVVGAVPESALSQKI 101


>gi|325265746|ref|ZP_08132435.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Kingella
           denitrificans ATCC 33394]
 gi|324982877|gb|EGC18500.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Kingella
           denitrificans ATCC 33394]
          Length = 123

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 61/83 (73%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F++EVL+ + PV++DFWA WC PC  ++PI+D +A E A KVK+ K++++E+ 
Sbjct: 19  IHVTDATFEAEVLKAAEPVLLDFWAPWCGPCKMIAPILDQLAQEWAGKVKVVKMNVDENQ 78

Query: 64  EISTRYQISSIPTLILFKDGKVI 86
            +  ++ I SIPTL++ KDGKV+
Sbjct: 79  VVPAQFGIRSIPTLVVLKDGKVL 101


>gi|307322543|ref|ZP_07601888.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|306891805|gb|EFN22646.1| thioredoxin [Sinorhizobium meliloti AK83]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L ++T +F  EVL  + PVVVDFWA WC PC K++  +++ + ELA KVK+ K++ +
Sbjct: 1   MATLNINTSNFQKEVLNSAEPVVVDFWAPWCGPCKKIALSLEEFSTELAGKVKVVKVNCD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E+   Y + SIP L +FK G+V D  + G + ++ +  WIL+ +
Sbjct: 61  ENPELVAEYDVRSIPMLAIFKAGEVADIKI-GDAPKTALSSWILNAI 106


>gi|187478869|ref|YP_786893.1| thioredoxin 1 [Bordetella avium 197N]
 gi|115423455|emb|CAJ49989.1| thioredoxin 1 [Bordetella avium 197N]
          Length = 114

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+ +VL+ S PV+VD+WA+WC PC  ++PI++++A E A ++ + KL+++E+  
Sbjct: 13  NVSDASFEGDVLKSSQPVLVDYWAAWCGPCKMIAPILEEVASEYAGRLTVAKLNVDENQG 72

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + +Y I  IPTL+LFKDG+     + GA S+S +  ++
Sbjct: 73  TAAKYGIRGIPTLMLFKDGQAAATKV-GALSKSQLTAFL 110


>gi|319949442|ref|ZP_08023503.1| thioredoxin reductase [Dietzia cinnamea P4]
 gi|319436904|gb|EFV91963.1| thioredoxin reductase [Dietzia cinnamea P4]
          Length = 114

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 61/82 (74%), Gaps = 1/82 (1%)

Query: 18  CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTL 77
            S PV+VDFWA+WCRPC  ++P+++++A   ADK+ + K+D+E + E++  YQI++IP L
Sbjct: 24  ASKPVLVDFWATWCRPCTMMAPVLNELAGAEADKLTVAKVDVEANQELAAEYQITAIPAL 83

Query: 78  ILFKDGKVIDRMMPGASSQSDI 99
           +LF +G+ + R+  GA S+S +
Sbjct: 84  LLFSEGQPVKRLT-GAKSKSAL 104


>gi|183600258|ref|ZP_02961751.1| hypothetical protein PROSTU_03810 [Providencia stuartii ATCC
          25827]
 gi|188020046|gb|EDU58086.1| hypothetical protein PROSTU_03810 [Providencia stuartii ATCC
          25827]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 60/83 (72%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + +   SF+SEVL  S+PV+VDFWA+WC PC  ++PI+D++ +E   K+ I KL+I+++ 
Sbjct: 6  IHITDASFESEVLNASSPVLVDFWAAWCGPCKMIAPILDEVVEEYTGKLTIAKLNIDDNP 65

Query: 64 EISTRYQISSIPTLILFKDGKVI 86
            + +Y I  IPTL+LFK+G V+
Sbjct: 66 ATAPKYGIRGIPTLLLFKNGNVV 88


>gi|2541892|dbj|BAA22827.1| thioredoxin m [Cyanidium caldarium]
          Length = 101

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 70/100 (70%), Gaps = 3/100 (3%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++D  SFD+EVL+    V+VDFWA WC PC  ++PI+D+IA EL   +K+ KL+ +E+ 
Sbjct: 1   MQIDELSFDTEVLQSHQLVLVDFWAPWCGPCRMIAPILDEIAQEL--DIKVVKLNTDENP 58

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++T Y I SIPTL+LFK G+ +D ++ GA  +S ++  I
Sbjct: 59  NLATEYGIRSIPTLMLFKKGQRLDTVI-GAVPKSTLMNTI 97


>gi|238061898|ref|ZP_04606607.1| thioredoxin [Micromonospora sp. ATCC 39149]
 gi|237883709|gb|EEP72537.1| thioredoxin [Micromonospora sp. ATCC 39149]
          Length = 124

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 68/96 (70%), Gaps = 1/96 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  +VL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I+E+ E +  Y
Sbjct: 28  SFAIDVLKSDKPVLVDFWAEWCAPCRKISPLLEEIAGEMGDQVSIVKLNIDENPETARAY 87

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           ++ S+PTL +F++G+ +  +  GA  + ++++ I S
Sbjct: 88  RVMSVPTLTVFRNGEPVQSIA-GAKPKGELVKLIQS 122


>gi|28900827|ref|NP_800482.1| thioredoxin 2 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260362561|ref|ZP_05775481.1| thioredoxin-2 [Vibrio parahaemolyticus K5030]
 gi|260879193|ref|ZP_05891548.1| thioredoxin-2 [Vibrio parahaemolyticus AN-5034]
 gi|260896728|ref|ZP_05905224.1| thioredoxin-2 [Vibrio parahaemolyticus Peru-466]
 gi|28809273|dbj|BAC62315.1| thioredoxin 2 [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087292|gb|EFO36987.1| thioredoxin-2 [Vibrio parahaemolyticus Peru-466]
 gi|308094036|gb|EFO43731.1| thioredoxin-2 [Vibrio parahaemolyticus AN-5034]
 gi|308115249|gb|EFO52789.1| thioredoxin-2 [Vibrio parahaemolyticus K5030]
          Length = 144

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +LE S PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E   +++ ++ I 
Sbjct: 49  SALLESSTPVVVDFWAPWCNPCVGFAPVFSDVAQEQAGTARFVKIDTEAQQQLAAQFGIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  +S   +W+
Sbjct: 109 SIPTIMVFKNGQRVD-MLNGALPKSQFDQWL 138


>gi|109900520|ref|YP_663775.1| thioredoxin [Pseudoalteromonas atlantica T6c]
 gi|332308442|ref|YP_004436293.1| thioredoxin [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|109702801|gb|ABG42721.1| thioredoxin [Pseudoalteromonas atlantica T6c]
 gi|332175771|gb|AEE25025.1| thioredoxin [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V+  + PV+VDFWA WC PC  ++PI+ +IADE   K+ + KL+++E++E   +Y
Sbjct: 12  SFEADVINATGPVLVDFWAEWCGPCKMIAPILHEIADEFDGKLTVGKLNVDENNETPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK G V    + GA S+S + E++   +
Sbjct: 72  GIRGIPTLLLFKGGNVAATKV-GALSKSQLEEFLNENI 108


>gi|255020936|ref|ZP_05292992.1| Thioredoxin [Acidithiobacillus caldus ATCC 51756]
 gi|254969727|gb|EET27233.1| Thioredoxin [Acidithiobacillus caldus ATCC 51756]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SF+++VL+ S PV+VDFWA WC PC  ++PI++++A E AD+V + K +I+E+ 
Sbjct: 6   LYVSDDSFENDVLKSSKPVLVDFWAEWCGPCKMIAPILEEVAKEYADRVTVAKFNIDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               +Y I  IPTL+LFK+GK ++    GA S++ +  ++ S++
Sbjct: 66  ATPPQYGIRGIPTLLLFKNGK-LEATKVGALSKAQLQAFLDSQL 108


>gi|46580248|ref|YP_011056.1| thioredoxin [Desulfovibrio vulgaris str. Hildenborough]
 gi|120602368|ref|YP_966768.1| thioredoxin [Desulfovibrio vulgaris DP4]
 gi|46449665|gb|AAS96315.1| thioredoxin [Desulfovibrio vulgaris str. Hildenborough]
 gi|120562597|gb|ABM28341.1| thioredoxin [Desulfovibrio vulgaris DP4]
 gi|311233767|gb|ADP86621.1| thioredoxin [Desulfovibrio vulgaris RCH1]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A ++   +F++ VL+ + PV++DFWA WC PC  + P+ID++A E   KV I K++++++
Sbjct: 2   AAQITDATFEASVLKSAIPVLIDFWAPWCGPCRAMGPVIDELAAEYEGKVLIVKMNVDDN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               ++Y I +IPTLILFK+G+V++++  GA S+S I + I  +
Sbjct: 62  PATPSKYGIRAIPTLILFKNGEVVEQVT-GAVSKSSIKDMIAQK 104


>gi|305681631|ref|ZP_07404437.1| thioredoxin [Corynebacterium matruchotii ATCC 14266]
 gi|305658791|gb|EFM48292.1| thioredoxin [Corynebacterium matruchotii ATCC 14266]
          Length = 106

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  ++V   +F S V+E   PV+VDFWA WC PC KL+P+ID +A+E   +V + K++++
Sbjct: 1   MKPIEVTETTFRSVVVESDKPVLVDFWAEWCGPCKKLAPVIDQVAEEFDGQVVVAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
               +   +QI SIPTL++FKDGK +++ +    S+++I+
Sbjct: 61  NERNLGAMFQIMSIPTLLIFKDGKKVEQFI-ARGSKTEIV 99


>gi|227114352|ref|ZP_03828008.1| thioredoxin [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
 gi|253690373|ref|YP_003019563.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756951|gb|ACT15027.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF ++VL+    ++VDFWA WC PC  ++PI+D+IA+E   K+ +TKL+I+E+   + +Y
Sbjct: 12  SFGTKVLQAEGAILVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLTANL 108


>gi|21233205|ref|NP_639122.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC
          33913]
 gi|66770147|ref|YP_244909.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|188993354|ref|YP_001905364.1| thioredoxin [Xanthomonas campestris pv. campestris str. B100]
 gi|21115553|gb|AAM43477.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC
          33913]
 gi|66575479|gb|AAY50889.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|167735114|emb|CAP53326.1| thioredoxin [Xanthomonas campestris pv. campestris]
          Length = 113

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    K+K+ K++++++  
Sbjct: 7  HVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGKLKVAKVNVDQNRA 66

Query: 65 ISTRYQISSIPTLILFKDGKV 85
          ++ +Y + SIP L+LFKDG+V
Sbjct: 67 LAIKYHVRSIPMLLLFKDGEV 87


>gi|119946270|ref|YP_943950.1| thioredoxin 2 [Psychromonas ingrahamii 37]
 gi|119864874|gb|ABM04351.1| thioredoxin [Psychromonas ingrahamii 37]
          Length = 144

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           +E++    PVV+DFWA WC PC+  +P+ + +A E  DK++  K+D E   EI+ +Y+I 
Sbjct: 49  AELINSEKPVVIDFWAPWCSPCINFAPVFEQVAMEEKDKLRFVKVDTEAQQEIAAQYKIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPTL++F+ G++ID +  GA  +S   EW+
Sbjct: 109 SIPTLMMFRKGRLIDSLN-GALPKSQFKEWV 138


>gi|284052125|ref|ZP_06382335.1| thioredoxin [Arthrospira platensis str. Paraca]
 gi|291568589|dbj|BAI90861.1| thioredoxin [Arthrospira platensis NIES-39]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 72/98 (73%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A++V   +F+ +VLE + PV+VDFWA WC PC  ++P++++IA +   ++K+ KL+ +E
Sbjct: 3  TAVEVTDSTFEQDVLESALPVLVDFWAPWCGPCRMVAPVVEEIAQQYDGQIKVVKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          + +++++Y I SIPTL++FK G+ +D M+ GA  +S +
Sbjct: 63 NPQVASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKSTL 99


>gi|317970450|ref|ZP_07971840.1| thioredoxin [Synechococcus sp. CB0205]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 64/89 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E
Sbjct: 3  SAAAVTDASFEQDVLKSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FKDG+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMIFKDGQKVDTVV 91


>gi|284928733|ref|YP_003421255.1| thioredoxin [cyanobacterium UCYN-A]
 gi|284809192|gb|ADB94897.1| thioredoxin [cyanobacterium UCYN-A]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 2/100 (2%)

Query: 1  MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
          MSA  +V   SF ++VLE   PV+VDFWA WC PC  ++P++D+IA++ A ++K+ KL+ 
Sbjct: 1  MSATAQVTDSSFKTDVLESEVPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQIKVVKLNT 60

Query: 60 EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +E+   +++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 61 DENPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTL 99


>gi|260770665|ref|ZP_05879596.1| thioredoxin [Vibrio furnissii CIP 102972]
 gi|260614391|gb|EEX39579.1| thioredoxin [Vibrio furnissii CIP 102972]
 gi|315178383|gb|ADT85297.1| thiol-disulfide isomerase and thioredoxin [Vibrio furnissii NCTC
           11218]
          Length = 108

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++  + F+++V++ + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I+ ++
Sbjct: 6   LQLSDEGFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDHNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 104


>gi|255324017|ref|ZP_05365142.1| thioredoxin [Corynebacterium tuberculostearicum SK141]
 gi|311741709|ref|ZP_07715531.1| thioredoxin [Corynebacterium pseudogenitalium ATCC 33035]
 gi|255298874|gb|EET78166.1| thioredoxin [Corynebacterium tuberculostearicum SK141]
 gi|311303230|gb|EFQ79311.1| thioredoxin [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           KV T +F  +V+E   PV+VDFWA WC PC KLSPI++++A+EL  +V + K++++E   
Sbjct: 6   KVTTDTFRKDVIESDKPVIVDFWAEWCGPCKKLSPILEEVAEELDGQVTVAKVNVDEERN 65

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +   +QI SIP +++F  G+ +D  + G  S+ DI+
Sbjct: 66  LGAMFQIMSIPNVLIFNHGEKVDEFV-GLRSKDDIV 100


>gi|268315755|ref|YP_003289474.1| thioredoxin [Rhodothermus marinus DSM 4252]
 gi|262333289|gb|ACY47086.1| thioredoxin [Rhodothermus marinus DSM 4252]
          Length = 115

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 65/92 (70%), Gaps = 1/92 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EVL+   PV+VDFWA WC PC  ++PII+++A E   + K+ KLD++ +   + +Y
Sbjct: 14  NFEQEVLQSDVPVLVDFWAVWCGPCRMIAPIIEELAAEYEGRAKVGKLDVDHNPRTAMQY 73

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            I SIPTL+ FK+G+V+D+++ GA  +  ++E
Sbjct: 74  GIRSIPTLLFFKNGQVVDQLI-GAVPKKVLVE 104


>gi|67924828|ref|ZP_00518225.1| Thioredoxin [Crocosphaera watsonii WH 8501]
 gi|67853315|gb|EAM48677.1| Thioredoxin [Crocosphaera watsonii WH 8501]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A++V   +F ++VL+   PV+VDFWA WC PC  ++P++++IAD+ A +VK+ KL+ +E
Sbjct: 3  AAVQVTDGTFKADVLDSDVPVLVDFWAPWCGPCRMVAPVVEEIADQYAGQVKVVKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +   +++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTL 99


>gi|332883627|gb|EGK03908.1| thioredoxin [Dysgonomonas mossii DSM 22836]
          Length = 105

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 73/101 (72%), Gaps = 2/101 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   SF+ +VL+   PVV+DFWA WC PC  + PI++++A E A KV I K+D++ +
Sbjct: 2   ALEITDASFE-DVLKSDKPVVIDFWAEWCGPCRMVGPIVEELAGEYAGKVTIGKVDVDNN 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            EI+++Y I +IPT++  K+G+V+D+ + GA+ +S +++ I
Sbjct: 61  DEITSKYGIRNIPTILFIKNGEVVDKQV-GAAQKSVLVDKI 100


>gi|77462067|ref|YP_351571.1| thioredoxin [Rhodobacter sphaeroides 2.4.1]
 gi|126460956|ref|YP_001042070.1| thioredoxin [Rhodobacter sphaeroides ATCC 17029]
 gi|221641020|ref|YP_002527282.1| Thioredoxin [Rhodobacter sphaeroides KD131]
 gi|332559994|ref|ZP_08414316.1| thioredoxin [Rhodobacter sphaeroides WS8N]
 gi|135778|sp|P08058|THIO_RHOSH RecName: Full=Thioredoxin; Short=Trx
 gi|152045|gb|AAA26182.1| thioredoxin (trxA) [Rhodobacter sphaeroides]
 gi|77386485|gb|ABA77670.1| Thioredoxin [Rhodobacter sphaeroides 2.4.1]
 gi|126102620|gb|ABN75298.1| thioredoxin [Rhodobacter sphaeroides ATCC 17029]
 gi|221161801|gb|ACM02781.1| Thioredoxin [Rhodobacter sphaeroides KD131]
 gi|332277706|gb|EGJ23021.1| thioredoxin [Rhodobacter sphaeroides WS8N]
          Length = 106

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV +   PVVVDFWA WC PC ++ P +++++ E A KVKI K++++
Sbjct: 1   MSTVPVTDATFDTEVRKSDVPVVVDFWAEWCGPCRQIGPALEELSKEYAGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E      +  IP L LFK+G+V+   + GA+ ++ +  WI S
Sbjct: 61  ENPESPAMLGVRGIPALFLFKNGQVVSNKV-GAAPKAALATWIAS 104


>gi|300023818|ref|YP_003756429.1| thioredoxin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525639|gb|ADJ24108.1| thioredoxin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 110

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 64/98 (65%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD EVL+ + PV+VDF A+WC PC  ++P +D +A E+  K+K+ K+D++E+  ++  Y
Sbjct: 9   SFDDEVLKSNEPVLVDFHATWCGPCKAMAPALDQVAKEMTGKIKVVKVDVDENPRVTGTY 68

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I ++PTL++FK GKV  +       +  + +WI S V
Sbjct: 69  GIRAMPTLLIFKAGKVAAQHTGAIVQKKKLEDWINSSV 106


>gi|315181759|gb|ADT88672.1| thioredoxin [Vibrio furnissii NCTC 11218]
          Length = 144

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 64/94 (68%), Gaps = 2/94 (2%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD+ +L+ S PVVVDFWA WC PCV  +PI  D+A+    +V+  K+D E    ++ ++
Sbjct: 47  NFDA-LLQSSQPVVVDFWAPWCNPCVGFAPIFSDVAEARKGQVRFVKIDTESQQNLAAKF 105

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           QI SIPT+++FK+G+ +D M+ GA  +S   +W+
Sbjct: 106 QIRSIPTIMVFKNGQRVD-MINGALPKSQFDQWL 138


>gi|256838874|ref|ZP_05544384.1| thioredoxin [Parabacteroides sp. D13]
 gi|256739793|gb|EEU53117.1| thioredoxin [Parabacteroides sp. D13]
          Length = 105

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 72/101 (71%), Gaps = 2/101 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+ E++    P+V+DFWA WC PC  +SPIID++A E   +V I K++++E+
Sbjct: 2   ALQITDANFE-ELVNSGKPMVLDFWAEWCGPCRMVSPIIDELATEYEGRVTIGKMNVDEN 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++  R+ I +IPT++ FKDGK++D+++ GA+++   +E I
Sbjct: 61  DDVVGRFGIRNIPTVLFFKDGKMVDKVV-GATAKDKFVEKI 100


>gi|261250981|ref|ZP_05943555.1| thioredoxin 2 [Vibrio orientalis CIP 102891]
 gi|260937854|gb|EEX93842.1| thioredoxin 2 [Vibrio orientalis CIP 102891]
          Length = 144

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 63/94 (67%), Gaps = 2/94 (2%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD+ +L    PVVVDFWA+WC PCV  +P+  D+A+E A  V+  K+D E    ++ +Y
Sbjct: 47  NFDA-ILNSPVPVVVDFWATWCNPCVGFAPVFSDVANERAKNVRFVKIDTEAQQNLAAKY 105

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           QI SIPT+++FK+GK +D ++ GA  +    +W+
Sbjct: 106 QIRSIPTIMVFKNGKRVD-VINGALPKGQFDQWL 138


>gi|120437351|ref|YP_863037.1| thioredoxin [Gramella forsetii KT0803]
 gi|117579501|emb|CAL67970.1| thioredoxin [Gramella forsetii KT0803]
          Length = 105

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A+++   +F+ +VL+   PVVVDFWA+WC PC  + PIID+I+ E   K  + KLD++ +
Sbjct: 2   AVEITDANFEEQVLKSDKPVVVDFWAAWCGPCRMVGPIIDEISTEYEGKAVVGKLDVDAN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS--DIIEWIL 104
            E + +Y + +IPT+++F++G+V+ R +  A  Q+  D I+ +L
Sbjct: 62  QEFAAKYGVRNIPTVLVFQNGEVVGRQVGVAPKQTYADAIDQLL 105


>gi|148654106|ref|YP_001281199.1| thioredoxin [Psychrobacter sp. PRwf-1]
 gi|148573190|gb|ABQ95249.1| thioredoxin [Psychrobacter sp. PRwf-1]
          Length = 108

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 73/101 (72%), Gaps = 3/101 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS L V++   +F+ +V +   PV+VDFWA+WC PC  ++P+++++AD+   KVKI K+D
Sbjct: 1   MSDLIVNSTDSNFEQDVAQSDVPVLVDFWAAWCGPCKAIAPVLEELADDYNGKVKIVKID 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           ++E+ E ++R+ I SIPTL++FK G+ +D +M G   +SD+
Sbjct: 61  VDENPETASRFGIRSIPTLMVFKGGEKVDTVM-GLQPKSDL 100


>gi|33592390|ref|NP_880034.1| thioredoxin 1 [Bordetella pertussis Tohama I]
 gi|33596499|ref|NP_884142.1| thioredoxin 1 [Bordetella parapertussis 12822]
 gi|33566268|emb|CAE37179.1| thioredoxin 1 [Bordetella parapertussis]
 gi|33572035|emb|CAE41559.1| thioredoxin 1 [Bordetella pertussis Tohama I]
 gi|332381806|gb|AEE66653.1| thioredoxin 1 [Bordetella pertussis CS]
          Length = 141

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+++VL+   PV+VD+WA+WC PC  ++PI++++A E A ++ + KL+++E+ +
Sbjct: 40  NVSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVAAEYAGRLTVAKLNVDENQD 99

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + +Y +  IPTL+LFKDG+     + GA S+S +  ++
Sbjct: 100 TAAKYGVRGIPTLMLFKDGQAAATKV-GALSKSQLTAFL 137


>gi|212702985|ref|ZP_03311113.1| hypothetical protein DESPIG_01023 [Desulfovibrio piger ATCC 29098]
 gi|212673573|gb|EEB34056.1| hypothetical protein DESPIG_01023 [Desulfovibrio piger ATCC 29098]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A ++   +FDS VL    PV++DFWA WC PC  + PIID++A E   KV+I K++++E+
Sbjct: 2   AEQISDATFDSVVLNSDIPVLLDFWAPWCGPCRAVGPIIDELAAEYEGKVRIVKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               T++ I +IPTL+LFK+G+ ID++  GA ++  I+  + ++
Sbjct: 62  PATPTKFGIRAIPTLMLFKNGQAIDQVT-GAVNKDAIVNILQTK 104


>gi|261409220|ref|YP_003245461.1| thioredoxin [Paenibacillus sp. Y412MC10]
 gi|329926890|ref|ZP_08281293.1| thioredoxin [Paenibacillus sp. HGF5]
 gi|261285683|gb|ACX67654.1| thioredoxin [Paenibacillus sp. Y412MC10]
 gi|328938877|gb|EGG35250.1| thioredoxin [Paenibacillus sp. HGF5]
          Length = 105

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 65/90 (72%), Gaps = 1/90 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  ++F +EV E    VVVDFWA WC PC  L+PI+D+++ EL D VKI K++++
Sbjct: 1  MAIVNVTDQTFVNEV-EGQGTVVVDFWAPWCGPCKMLAPILDELSSELGDDVKIAKVNVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ E + R+ + SIPT+I FKDG+ +D+++
Sbjct: 60 ENPESAARFGVMSIPTMIFFKDGQPVDKVV 89


>gi|84393642|ref|ZP_00992393.1| thioredoxin [Vibrio splendidus 12B01]
 gi|84375710|gb|EAP92606.1| thioredoxin [Vibrio splendidus 12B01]
          Length = 108

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+I++++
Sbjct: 6   LQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|209524681|ref|ZP_03273228.1| thioredoxin [Arthrospira maxima CS-328]
 gi|209494825|gb|EDZ95133.1| thioredoxin [Arthrospira maxima CS-328]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 72/98 (73%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A++V   +F+ +VLE   PV+VDFWA WC PC  ++P++++IA++   ++K+ KL+ +E
Sbjct: 3  TAVEVTDSTFEQDVLESELPVLVDFWAPWCGPCRMVAPVVEEIAEQYDGQIKVVKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          + +++++Y I SIPTL++FK G+ +D M+ GA  +S +
Sbjct: 63 NPQVASQYGIRSIPTLMIFKGGQKVD-MVVGAVPKSTL 99


>gi|147669275|ref|YP_001214093.1| thioredoxin [Dehalococcoides sp. BAV1]
 gi|146270223|gb|ABQ17215.1| thioredoxin [Dehalococcoides sp. BAV1]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++  +SF +EVL+   PV+VDFWA WC PC  ++PIID ++ + A K K  KL+++E+ 
Sbjct: 3   MELTDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYAGKFKFCKLNVDENK 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             +T+Y++ SIPTL+ FK G+V D M+ GA  +S + + I
Sbjct: 63  TTATQYRVMSIPTLLFFKGGQVAD-MVVGAVPESALSQKI 101


>gi|71066543|ref|YP_265270.1| thioredoxin [Psychrobacter arcticus 273-4]
 gi|71039528|gb|AAZ19836.1| thioredoxin [Psychrobacter arcticus 273-4]
          Length = 108

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 66/92 (71%), Gaps = 2/92 (2%)

Query: 1  MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
          MS L ++T   +FD +VL+   PV+VDFWA+WC PC  ++PI++D+A E   KVKI K+D
Sbjct: 1  MSDLIINTTDANFDQDVLQSDVPVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVD 60

Query: 59 IEESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          ++ + + ++R+ I +IPTL +FK G+ +D +M
Sbjct: 61 VDNNPQAASRFGIRNIPTLFVFKGGEKVDSVM 92


>gi|146305349|ref|YP_001185814.1| thioredoxin [Pseudomonas mendocina ymp]
 gi|330501282|ref|YP_004378151.1| thioredoxin [Pseudomonas mendocina NK-01]
 gi|145573550|gb|ABP83082.1| thioredoxin [Pseudomonas mendocina ymp]
 gi|328915568|gb|AEB56399.1| thioredoxin [Pseudomonas mendocina NK-01]
          Length = 108

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SFD +V++   PV+VD+WA WC PC  ++P++D+IA +   K+KI KL+I+E+ E
Sbjct: 7   NVSDASFDQDVIQAEGPVLVDYWAEWCGPCKMIAPVLDEIAKDYQGKLKICKLNIDENQE 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +Y +  IPTL+LFK+G V +    GA S+S +  ++ S +
Sbjct: 67  TPPKYGVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFLDSNI 108


>gi|311897297|dbj|BAJ29705.1| putative thioredoxin [Kitasatospora setae KM-6054]
          Length = 108

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 67/102 (65%), Gaps = 3/102 (2%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   +FD+EVL+   PV+VDFWA+WC PC +++P+++DIA E  DK+ + KLD++ + E
Sbjct: 7   EVTDATFDAEVLKSDKPVLVDFWATWCGPCRQVAPVLEDIAAEHGDKLTVVKLDVDANQE 66

Query: 65  ISTRYQISSIPTLILFKDG---KVIDRMMPGASSQSDIIEWI 103
            +  Y + SIPTL ++K G   K I    P A+   ++ E++
Sbjct: 67  TAAAYNVISIPTLNVYKGGELVKTITGARPKAALLRELAEYL 108


>gi|78049511|ref|YP_365686.1| thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|294626525|ref|ZP_06705124.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
          11122]
 gi|294665092|ref|ZP_06730396.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
          10535]
 gi|325920133|ref|ZP_08182097.1| thioredoxin [Xanthomonas gardneri ATCC 19865]
 gi|325928805|ref|ZP_08189972.1| thioredoxin [Xanthomonas perforans 91-118]
 gi|78037941|emb|CAJ25686.1| thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|292599215|gb|EFF43353.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
          11122]
 gi|292605134|gb|EFF48481.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
          10535]
 gi|325540778|gb|EGD12353.1| thioredoxin [Xanthomonas perforans 91-118]
 gi|325549384|gb|EGD20274.1| thioredoxin [Xanthomonas gardneri ATCC 19865]
          Length = 113

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 57/81 (70%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++++++  
Sbjct: 7  HVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRA 66

Query: 65 ISTRYQISSIPTLILFKDGKV 85
          ++ +Y + SIP L+LFKDG+V
Sbjct: 67 LAIKYHVRSIPMLLLFKDGQV 87


>gi|332534396|ref|ZP_08410236.1| thioredoxin 1, redox factor [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036130|gb|EGI72605.1| thioredoxin 1, redox factor [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 108

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   SF+++VL+   PV+VDFWA WC PC  ++PI+ ++ADE   +V + KL+I++++
Sbjct: 6   IQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILHEVADEYDSRVTVAKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               ++ I  IPTL+LFKDG+V    + GA S++ +IE++ + +
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLIEFLENNI 108


>gi|293393865|ref|ZP_06638172.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Serratia odorifera
           DSM 4582]
 gi|291423692|gb|EFE96914.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Serratia odorifera
           DSM 4582]
          Length = 108

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF +EVL+   P++VDFWA WC PC  ++PI+++IADE   K+ I+KL+I+E+   + +Y
Sbjct: 12  SFATEVLQADGPILVDFWAEWCGPCKMIAPILNEIADEFDGKLTISKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + +++ + +
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKDFLNANL 108


>gi|197121768|ref|YP_002133719.1| thioredoxin [Anaeromyxobacter sp. K]
 gi|220916562|ref|YP_002491866.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-1]
 gi|196171617|gb|ACG72590.1| thioredoxin [Anaeromyxobacter sp. K]
 gi|219954416|gb|ACL64800.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 109

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 58/81 (71%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F+ EVL+   PV+VDFWA WC PC  ++P++DD+A     K+K+ K+D+++   +  +Y
Sbjct: 13 TFEQEVLKSETPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQNVPQQY 72

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           I SIPTL++FK G+V+D ++
Sbjct: 73 GIRSIPTLLVFKGGRVVDTVI 93


>gi|149191364|ref|ZP_01869616.1| thioredoxin [Vibrio shilonii AK1]
 gi|148834781|gb|EDL51766.1| thioredoxin [Vibrio shilonii AK1]
          Length = 108

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++
Sbjct: 6   LQLTDDGFETDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|114328675|ref|YP_745832.1| thioredoxin [Granulibacter bethesdensis CGDNIH1]
 gi|114316849|gb|ABI62909.1| thioredoxin [Granulibacter bethesdensis CGDNIH1]
          Length = 115

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+++VL  S PV+VDFWA WC PC  ++P ++++A E   ++ + K++I+E+ +   RY
Sbjct: 19  TFETDVLGASGPVLVDFWAEWCGPCRMIAPALEEVAAENTGRLTVAKVNIDENPDSPNRY 78

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++ IPTLILFKDG+ I + + GA  +S + +W+   +
Sbjct: 79  GVTGIPTLILFKDGQPIAKQV-GALPKSALKQWVSGNI 115


>gi|269215993|ref|ZP_06159847.1| thioredoxin [Slackia exigua ATCC 700122]
 gi|269130252|gb|EEZ61330.1| thioredoxin [Slackia exigua ATCC 700122]
          Length = 102

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           ++  +F+ +VL+ S PV+VDF+A+WC PC  +SP+ID+IA E A  V + K+D++E+  I
Sbjct: 5   INAANFEEKVLKNSKPVLVDFFATWCGPCKMMSPVIDEIAAEKAGVVDVFKIDVDENQSI 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +YQ+ SIPTLI+F+ G+V  + + GA  ++ +++ +
Sbjct: 65  AQKYQVMSIPTLIVFEHGQVKKQTL-GAQPKAAVLDLL 101


>gi|255012662|ref|ZP_05284788.1| thioredoxin [Bacteroides sp. 2_1_7]
          Length = 104

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 72/101 (71%), Gaps = 2/101 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+ E++    P+V+DFWA WC PC  +SPIID++A E   +V I K++++E+
Sbjct: 2   ALQITDANFE-ELVNSGKPMVLDFWAEWCGPCRMVSPIIDELATEYEGRVTIGKMNVDEN 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++  R+ I +IPT++ FKDGK++D+++ GA+++   +E I
Sbjct: 61  DDVVGRFGIRNIPTVLFFKDGKMVDKVV-GATAKDKFVEKI 100


>gi|149241876|pdb|2H6Z|A Chain A, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal
           (P61) Space Group
 gi|149241877|pdb|2H6Z|B Chain B, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+DDIADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDDIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|153836887|ref|ZP_01989554.1| thioredoxin [Vibrio parahaemolyticus AQ3810]
 gi|149749845|gb|EDM60590.1| thioredoxin [Vibrio parahaemolyticus AQ3810]
          Length = 144

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +LE S PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E   +++ ++ + 
Sbjct: 49  SALLESSTPVVVDFWAPWCNPCVGFAPVFSDVAQEQAGTARFVKIDTEAQQQLAAQFGVR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  +S   +W+
Sbjct: 109 SIPTIMVFKNGQRVD-MLNGALPKSQFDQWL 138


>gi|163803185|ref|ZP_02197067.1| transcription termination factor Rho [Vibrio sp. AND4]
 gi|159173006|gb|EDP57840.1| transcription termination factor Rho [Vibrio sp. AND4]
          Length = 108

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 68/104 (65%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I+ + 
Sbjct: 6   LQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDHNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANI 108


>gi|86605476|ref|YP_474239.1| thioredoxin [Synechococcus sp. JA-3-3Ab]
 gi|86554018|gb|ABC98976.1| thioredoxin [Synechococcus sp. JA-3-3Ab]
          Length = 113

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 63/86 (73%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A+ V   +F++EVL    PV+VDFWA WC PC  ++P++ +IA++ A KVK+ K++ +E
Sbjct: 3  AAIDVADATFEAEVLRSDIPVLVDFWAPWCGPCRMVAPVVQEIAEQYAGKVKVVKINTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVID 87
          + + +++Y I SIPTL+LFK G+ +D
Sbjct: 63 NPQTASQYGIRSIPTLMLFKGGQKVD 88


>gi|33240589|ref|NP_875531.1| thioredoxin family protein [Prochlorococcus marinus subsp.
          marinus str. CCMP1375]
 gi|33238117|gb|AAQ00184.1| Thioredoxin family protein [Prochlorococcus marinus subsp.
          marinus str. CCMP1375]
          Length = 107

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ EVL+   PV+VDFWA WC PC  +SPI+D+I+ +   K+K+ KL+ +E
Sbjct: 3  SAAAVTDSSFEQEVLQSDLPVLVDFWAPWCGPCRMVSPIVDEISKDFEGKIKVCKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMIFKGGQKVDTVV 91


>gi|83313385|ref|YP_423649.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum
           magneticum AMB-1]
 gi|82948226|dbj|BAE53090.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum
           magneticum AMB-1]
          Length = 118

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF++EVL+   PV+VDFWA WC PC +++P +++++ + ADK+ I K++I+E+   
Sbjct: 18  VTDSSFEAEVLKAPGPVLVDFWAEWCGPCRQIAPALEELSKDRADKITIAKINIDENPGT 77

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             +Y +  IPTL++FK+G+V    + GA  +S + EW+
Sbjct: 78  PGKYGVRGIPTLMIFKNGQVAATKI-GALPKSKLYEWV 114


>gi|260774367|ref|ZP_05883281.1| thioredoxin [Vibrio metschnikovii CIP 69.14]
 gi|260610494|gb|EEX35699.1| thioredoxin [Vibrio metschnikovii CIP 69.14]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++  +SF+++V++ + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+I+ ++
Sbjct: 6   LQLSDESFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTIGKLNIDHNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 104


>gi|124514173|gb|EAY55688.1| Thioredoxin [Leptospirillum rubarum]
 gi|206602299|gb|EDZ38780.1| Thioredoxin [Leptospirillum sp. Group II '5-way CG']
          Length = 110

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V+   +D  VL     V+VDFWA WC PC  ++PI++++++E   KV   KL+ ++
Sbjct: 4   NVVEVNAPEWDKSVLGAGGLVMVDFWAPWCGPCRTVAPIVEELSEEYKGKVSFMKLNTDD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           + EI+ +YQ+  IPTL+ FKDGK++D+++ GA S+ + 
Sbjct: 64  NQEIAVKYQVMGIPTLMFFKDGKIVDKIV-GAQSKKNF 100


>gi|241767094|ref|ZP_04764867.1| thioredoxin [Acidovorax delafieldii 2AN]
 gi|241362341|gb|EER58331.1| thioredoxin [Acidovorax delafieldii 2AN]
          Length = 110

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VD+WA WC PC  ++PI+D++A     K++I K++++E+ EI  ++
Sbjct: 13  SFEADVLKAGTPVLVDYWAEWCGPCKMIAPILDEVAGTYQGKLQIAKMNVDENREIPAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG++    + GA S++ +  +I
Sbjct: 73  GIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFI 105


>gi|78047869|ref|YP_364044.1| putative thioredoxin [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|121593759|ref|YP_985655.1| thioredoxin [Acidovorax sp. JS42]
 gi|78036299|emb|CAJ23990.1| putative thioredoxin [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|120605839|gb|ABM41579.1| thioredoxin [Acidovorax sp. JS42]
          Length = 106

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +++  +FD+ + +      V FWA WC PC  +SPI  D+A ++ D+    ++DI+++ E
Sbjct: 4   ELNNDNFDTTLGQVPGVYAVRFWAEWCGPCRVMSPIFKDVARDMQDRAHFGEVDIDQAPE 63

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ R+ + SIPT++LFKDG+VIDRM  GA+ + +++ +I + +
Sbjct: 64  LAGRFGVQSIPTVVLFKDGQVIDRMT-GAAPKPNVLRFINNHL 105


>gi|325003244|ref|ZP_08124356.1| thioredoxin [Pseudonocardia sp. P1]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V T SFD +VL+    V+VDFWA+WC PC  ++P++D+IA E  +K+ + KLDI+ 
Sbjct: 3   NTIDVTTGSFDQDVLKSDKAVLVDFWATWCGPCKMVAPVLDEIAGENTEKLTVAKLDIDA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDIIEWI 103
           + E++  YQ+ S+PT+ILF  GK + +++   P A+  +D+ + I
Sbjct: 63  NPEVARDYQVMSVPTMILFSGGKPVKQIVGAKPKAALLADLADHI 107


>gi|315649370|ref|ZP_07902459.1| thioredoxin [Paenibacillus vortex V453]
 gi|315275358|gb|EFU38727.1| thioredoxin [Paenibacillus vortex V453]
          Length = 105

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 65/90 (72%), Gaps = 1/90 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  ++F +EV E    VVVDFWA WC PC  L+PI+D+++ EL D VKI K++++
Sbjct: 1  MAIVNVTDQTFVNEV-EGEGTVVVDFWAPWCGPCKMLAPILDELSSELGDDVKIAKVNVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ E + R+ + SIPT+I FKDG+ +D+++
Sbjct: 60 ENPESAARFGVMSIPTMIFFKDGQPVDKVV 89


>gi|225420323|ref|ZP_03762626.1| hypothetical protein CLOSTASPAR_06666 [Clostridium asparagiforme
           DSM 15981]
 gi|225041009|gb|EEG51255.1| hypothetical protein CLOSTASPAR_06666 [Clostridium asparagiforme
           DSM 15981]
          Length = 112

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 71/96 (73%), Gaps = 1/96 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +K  +++FD+E L+   PV+VDF+A WC PC  ++P+++ +A E   K  + KL+++++S
Sbjct: 10  MKFTSENFDNEALKSDKPVLVDFFADWCGPCKMMAPVVEALASEYEGKAVVGKLNVDDAS 69

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +I+ RY + SIPTLI+FK+G++ D+ + G +S++++
Sbjct: 70  DIAGRYGVMSIPTLIVFKNGQISDKFV-GVTSKNEL 104


>gi|139438801|ref|ZP_01772285.1| Hypothetical protein COLAER_01289 [Collinsella aerofaciens ATCC
           25986]
 gi|133775881|gb|EBA39701.1| Hypothetical protein COLAER_01289 [Collinsella aerofaciens ATCC
           25986]
          Length = 110

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           ++  ++FDS ++  S PV+VDFWA WC PC  LSPI+D++ADELA K+ + K +++++ +
Sbjct: 10  QITPENFDS-IVNDSLPVLVDFWAPWCGPCRSLSPIVDEVADELAGKLAVAKCNVDDNQD 68

Query: 65  ISTRYQISSIPTLILFKDGKVIDR---MMPGASSQS 97
           ++ +Y + SIPTL++FK+G+ IDR    +P A  Q+
Sbjct: 69  LAMKYGVMSIPTLVVFKNGEEIDRSVGALPKARLQA 104


>gi|23015726|ref|ZP_00055494.1| COG0526: Thiol-disulfide isomerase and thioredoxins
           [Magnetospirillum magnetotacticum MS-1]
          Length = 104

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF++EVL+   PV+VDFWA WC PC +++P +++++ + ADK+ I K++I+E+     +Y
Sbjct: 8   SFEAEVLKAPGPVLVDFWAEWCGPCRQIAPALEELSKDRADKITIAKINIDENPGTPGKY 67

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL++FK+G+V    + GA  +S + EW+
Sbjct: 68  GVRGIPTLMIFKNGQVAATKI-GALPKSKLYEWV 100


>gi|294461486|gb|ADE76304.1| unknown [Picea sitchensis]
          Length = 181

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           + A K    SFD  + +   PV+VDF+A+WC PC  + PI++D+   L DK+++ K+D E
Sbjct: 72  VQAAKQTFSSFDDMLQKSDQPVLVDFYATWCGPCQYMVPILEDVGHRLKDKIRVVKIDTE 131

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +   +++RY + ++PT ILF+DG+  DR + GA   + +IE I
Sbjct: 132 KYPNVASRYGVQALPTFILFRDGQPFDR-LEGAIPANQLIERI 173


>gi|148978451|ref|ZP_01814925.1| thioredoxin [Vibrionales bacterium SWAT-3]
 gi|145962358|gb|EDK27638.1| thioredoxin [Vibrionales bacterium SWAT-3]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++
Sbjct: 6   LQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|220923832|ref|YP_002499134.1| thioredoxin [Methylobacterium nodulans ORS 2060]
 gi|219948439|gb|ACL58831.1| thioredoxin [Methylobacterium nodulans ORS 2060]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   SF  +VLE S PVVV FWA  C  C  +SP +++I+ E+  +VKI KL+++
Sbjct: 1   MPTVMVTDASFKQDVLEASEPVVVVFWAEGCVSCQAISPALEEISSEMQGRVKIAKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I + Y I+ +PTL++FKDGK++ +   GA S+  ++ WI S
Sbjct: 61  ENPGIVSEYGIAGVPTLMIFKDGKLVSQKF-GALSKGALLRWIQS 104


>gi|134093952|ref|YP_001099027.1| thioredoxin [Herminiimonas arsenicoxydans]
 gi|133737855|emb|CAL60900.1| thioredoxin [Herminiimonas arsenicoxydans]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+   PV+VDFWA WC PC  ++PI++D+A E A K++I K+D++ +  I  ++
Sbjct: 12  SFDTDVLKSDTPVLVDFWAEWCGPCKMIAPILEDVAKEYAGKIRIAKMDVDANQAIPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTLILFK+G V      GA ++  +  +I S +
Sbjct: 72  GIRGIPTLILFKNG-VPAAQKVGALAKGQLTAFIDSNI 108


>gi|300718027|ref|YP_003742830.1| Thioredoxin 2 [Erwinia billingiae Eb661]
 gi|299063863|emb|CAX60983.1| Thioredoxin 2 [Erwinia billingiae Eb661]
          Length = 139

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVV+DFWA WC PCV  +P+ +++ADE   KV+  K++ E   E+S R++I SIPT++++
Sbjct: 54  PVVIDFWAPWCGPCVNFAPVYENVADERNGKVRFIKVNTEAEPELSARFRIRSIPTIMVY 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K GK++D M+ GA  ++   EW+
Sbjct: 114 KQGKMVD-MLNGAMPKTQFDEWL 135


>gi|163748719|ref|ZP_02155972.1| thioredoxin 1 [Shewanella benthica KT99]
 gi|161331829|gb|EDQ02633.1| thioredoxin 1 [Shewanella benthica KT99]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V++ + PVVVDFWA WC PC  ++P +DD+A++ A KV I KL+++++S I  +Y
Sbjct: 12  SFENDVIKSALPVVVDFWAEWCGPCKMIAPFLDDVAEDYAGKVTIAKLNVDQNSVIPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL++FK+G++    + GA S++ + E+I
Sbjct: 72  GVRGIPTLLIFKNGELAGTKV-GALSKTQLKEFI 104


>gi|332291995|ref|YP_004430604.1| thioredoxin [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170081|gb|AEE19336.1| thioredoxin [Krokinobacter diaphorus 4H-3-7-5]
          Length = 105

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 67/101 (66%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+ +VL    PV+VDFWA+WC PC  + P+I++IA E   K  I K+D++ +
Sbjct: 2   ALEITDATFEEQVLNSDKPVLVDFWAAWCGPCRMVGPVIEEIAGEYEGKAVIGKVDVDAN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            E + +Y + +IPT+++FK+G+V+ R + G + ++   E I
Sbjct: 62  QEFAAKYGVRNIPTVLMFKNGEVVGRQV-GVAPKATYTEAI 101


>gi|91228020|ref|ZP_01262105.1| thioredoxin [Vibrio alginolyticus 12G01]
 gi|153834681|ref|ZP_01987348.1| thioredoxin [Vibrio harveyi HY01]
 gi|156972679|ref|YP_001443586.1| thioredoxin [Vibrio harveyi ATCC BAA-1116]
 gi|262392871|ref|YP_003284725.1| thioredoxin [Vibrio sp. Ex25]
 gi|269962285|ref|ZP_06176637.1| thioredoxin [Vibrio harveyi 1DA3]
 gi|269964530|ref|ZP_06178769.1| thioredoxin [Vibrio alginolyticus 40B]
 gi|91188249|gb|EAS74548.1| thioredoxin [Vibrio alginolyticus 12G01]
 gi|148868877|gb|EDL67937.1| thioredoxin [Vibrio harveyi HY01]
 gi|156524273|gb|ABU69359.1| hypothetical protein VIBHAR_00337 [Vibrio harveyi ATCC BAA-1116]
 gi|262336465|gb|ACY50260.1| thioredoxin [Vibrio sp. Ex25]
 gi|269830657|gb|EEZ84877.1| thioredoxin [Vibrio alginolyticus 40B]
 gi|269832988|gb|EEZ87095.1| thioredoxin [Vibrio harveyi 1DA3]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I+ ++
Sbjct: 6   LQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDHNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGNVAATKV-GALSKTQLKEFL 104


>gi|149184294|ref|ZP_01862612.1| thiol-disulfide isomerase [Erythrobacter sp. SD-21]
 gi|148831614|gb|EDL50047.1| thiol-disulfide isomerase [Erythrobacter sp. SD-21]
          Length = 106

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V    F  +VL+   PV+VDFWA WC PC  ++P +++++DEL DKV I K+DI 
Sbjct: 1   MATINVTDDGFQKDVLDSDKPVLVDFWADWCGPCKMIAPALEELSDELGDKVTIAKMDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E++ +     + SIP L+LFK+G+    M  GA+ +  + +W+
Sbjct: 61  ENTGVPGAMGVQSIPYLVLFKNGEPAAHMR-GAAPKGQLKQWL 102


>gi|114769727|ref|ZP_01447337.1| Thioredoxin [alpha proteobacterium HTCC2255]
 gi|114549432|gb|EAU52314.1| Thioredoxin [alpha proteobacterium HTCC2255]
          Length = 106

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +F +EV   + PVVVDFWA WC PC ++ P +++++DE   KVKI K++++
Sbjct: 1   MATVKVTDDTFTAEVTNSNIPVVVDFWAEWCGPCKQIGPALEELSDEYEGKVKIVKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L LFKDG+ I     GA+ ++ + +WI S +
Sbjct: 61  ENPNSPAQMGVRGIPALFLFKDGQAIANKT-GAAPKAALADWITSSI 106


>gi|85860040|ref|YP_462242.1| thioredoxin [Syntrophus aciditrophicus SB]
 gi|85723131|gb|ABC78074.1| thioredoxin [Syntrophus aciditrophicus SB]
          Length = 110

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S L V   +F+ E+++   P +VDFWA+WC PC  + P+++ +A+    +VKI+KL+++E
Sbjct: 6  SLLHVTDANFEEEIIKSDKPALVDFWATWCGPCRAIGPLVEGLAETYKGRVKISKLNVDE 65

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          + + +  + + SIPTLILFKDGKV+D ++
Sbjct: 66 NPKTAADFGVRSIPTLILFKDGKVMDTLV 94


>gi|331006629|ref|ZP_08329914.1| Thioredoxin [gamma proteobacterium IMCC1989]
 gi|330419568|gb|EGG93949.1| Thioredoxin [gamma proteobacterium IMCC1989]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SFD +VL    PV+VDFWA+WC PC  ++P++D +A E A K+ I K+D++ + E
Sbjct: 7   HVTDASFDQDVLAADGPVLVDFWAAWCGPCKMIAPVLDQLAGEYAGKLTICKMDVDGNKE 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++ I  IPTL++FK+G  ++    GA S+ D+ E+I + +
Sbjct: 67  TPAKFGIRGIPTLMIFKNGN-MEAQTVGALSKPDLEEFIKTNL 108


>gi|296118594|ref|ZP_06837172.1| thioredoxin [Corynebacterium ammoniagenes DSM 20306]
 gi|295968493|gb|EFG81740.1| thioredoxin [Corynebacterium ammoniagenes DSM 20306]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 64/89 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          + + V   +F SEV++    VVVDFWA WC PC KLSP++D+IA+E+ D+V I K++++E
Sbjct: 3  NVIDVTKDTFRSEVIDSDKLVVVDFWAEWCGPCKKLSPLLDEIAEEIGDEVTIAKINVDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
            E+   +Q+ SIP++++FK+G+ +D  +
Sbjct: 63 ERELGAMFQVMSIPSVLMFKNGEKVDEFI 91


>gi|94677026|ref|YP_588646.1| thioredoxin 1 [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|94220176|gb|ABF14335.1| thioredoxin 1 [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +  ++F  +VL+     +VDFWA WC PC  ++PI+ +IA+E   KV I KL+I+E+ 
Sbjct: 6   INISQENFTQQVLQNEGLFLVDFWAEWCAPCKSITPILAEIANEFNGKVTIVKLNIDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I+ +Y + SIP+L+LF++G+V+   + GA S+  +IE++ + +
Sbjct: 66  AIAQKYNVRSIPSLLLFRNGEVVATKV-GALSKGQLIEFLNANI 108


>gi|254508580|ref|ZP_05120697.1| thioredoxin [Vibrio parahaemolyticus 16]
 gi|219548522|gb|EED25530.1| thioredoxin [Vibrio parahaemolyticus 16]
          Length = 120

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++
Sbjct: 18  LQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNA 77

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 78  GTPPKFGIRGIPTLLLFKDGNVAATKV-GALSKTQLKEFL 116


>gi|218778087|ref|YP_002429405.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
 gi|218759471|gb|ACL01937.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
          Length = 149

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF +EVL    PV++D WA WC PC  ++P++D+IA E A  +K+ KL+++ +   ++ +
Sbjct: 53  SFQNEVLASPIPVLLDCWAPWCGPCKMVAPVLDEIAREYAGTIKVAKLNVDNNPATASHF 112

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  SIPT+ILFK+G+ +DR++ GA+ +  II ++ +++
Sbjct: 113 RTQSIPTMILFKNGREVDRLV-GAAPKQQIINFVQNQL 149


>gi|52425681|ref|YP_088818.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307733|gb|AAU38233.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L     SF+++VL    PV+VD WA WC PC  ++PI+DD+A ELA KVKI K++I+E+ 
Sbjct: 5   LHATDASFEADVLRSDVPVLVDLWAPWCGPCRMVAPILDDLAAELAGKVKIVKINIDENQ 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ + SIPTL++FKDG+++   + GA  ++ +  ++
Sbjct: 65  GTPAQFGVRSIPTLLMFKDGQLVGTQV-GALPKNQLAAFV 103


>gi|254000026|ref|YP_003052089.1| thioredoxin [Methylovorus sp. SIP3-4]
 gi|313202002|ref|YP_004040660.1| thioredoxin [Methylovorus sp. MP688]
 gi|253986705|gb|ACT51562.1| thioredoxin [Methylovorus sp. SIP3-4]
 gi|312441318|gb|ADQ85424.1| thioredoxin [Methylovorus sp. MP688]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EVL+   PV+VD+WA WC PC  ++PI+D++A E   ++K+ KL+I+E+ +   +Y
Sbjct: 12  AFEQEVLQSQVPVLVDYWAEWCGPCKMIAPILDEVAKEYEGRLKVAKLNIDENQQTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G V +    GA S+S +  +I S +
Sbjct: 72  GIRGIPTLMLFKNGNV-EATKVGALSKSQLTAFIDSNI 108


>gi|218676469|ref|YP_002395288.1| Thioredoxin 2 [Vibrio splendidus LGP32]
 gi|218324737|emb|CAV26384.1| Thioredoxin 2 [Vibrio splendidus LGP32]
          Length = 144

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 58/89 (65%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           +L  S PVVVDFWA+WC PCV  +P+  D+A E +  ++  K+D E   +++  YQI SI
Sbjct: 51  ILNSSQPVVVDFWATWCNPCVGFAPVFSDVAKERSGNIRFVKIDTEAQQQLAAMYQIRSI 110

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           PT+++FKDGK +D +  GA  +    +W+
Sbjct: 111 PTVMVFKDGKRVDTIN-GALPKGQFDQWL 138


>gi|282600077|ref|ZP_05972913.2| thioredoxin [Providencia rustigianii DSM 4541]
 gi|282566968|gb|EFB72503.1| thioredoxin [Providencia rustigianii DSM 4541]
          Length = 122

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF S+VL  ++PV+VDFWA+WC PC  ++PI+D++A+E   KV I KL+I+++   + ++
Sbjct: 26  SFASDVLNANSPVLVDFWAAWCGPCKMIAPILDEVAEEYTGKVTIAKLNIDDNPATAPKF 85

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 86  GIRGIPTLLLFKNGSVAATKV-GALSKTQLKEFL 118


>gi|87124808|ref|ZP_01080656.1| Thioredoxin [Synechococcus sp. RS9917]
 gi|86167687|gb|EAQ68946.1| Thioredoxin [Synechococcus sp. RS9917]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E
Sbjct: 3   SAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRM---MPGASSQSDIIEWI 103
           +  ++++Y I SIPTL++FK G+ +D +   +P A+    I ++I
Sbjct: 63  NPNVASQYGIRSIPTLMVFKGGQKVDTVVGAVPKATLSGTISKYI 107


>gi|238784756|ref|ZP_04628759.1| Thioredoxin 1 [Yersinia bercovieri ATCC 43970]
 gi|238798894|ref|ZP_04642360.1| Thioredoxin 1 [Yersinia mollaretii ATCC 43969]
 gi|238714352|gb|EEQ06361.1| Thioredoxin 1 [Yersinia bercovieri ATCC 43970]
 gi|238717248|gb|EEQ09098.1| Thioredoxin 1 [Yersinia mollaretii ATCC 43969]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 60/78 (76%)

Query: 9  KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
          +SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+I+++   + +
Sbjct: 11 ESFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLNIDDNQGTAPK 70

Query: 69 YQISSIPTLILFKDGKVI 86
          Y I  IPTL+LF+DG+V+
Sbjct: 71 YGIRGIPTLLLFRDGEVV 88


>gi|296120516|ref|YP_003628294.1| thioredoxin [Planctomyces limnophilus DSM 3776]
 gi|296012856|gb|ADG66095.1| thioredoxin [Planctomyces limnophilus DSM 3776]
          Length = 109

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 61/87 (70%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L++   +F SEVL+ S   +VDFWA WC PC  L+P ID++A E A KVKI KL+ +E+ 
Sbjct: 7  LEITDANFQSEVLDSSTLTLVDFWAPWCGPCRMLAPTIDELATEYAGKVKIGKLNTDENP 66

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
           I + + ISSIPT+++FK G ++D+ +
Sbjct: 67 RIPSMHGISSIPTVLMFKGGIIVDKFV 93


>gi|282855388|ref|ZP_06264711.1| thioredoxin [Pyramidobacter piscolens W5455]
 gi|282586768|gb|EFB92013.1| thioredoxin [Pyramidobacter piscolens W5455]
          Length = 102

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%), Gaps = 2/100 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + + +++F SEVL+ S PV++DFWA WC PC   SP++D+IA E A   K+ K++++
Sbjct: 1   MTPIVLTSENFQSEVLQSSEPVLIDFWAPWCAPCRAFSPVLDEIAAE-ASGFKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E  E++   +I SIPTLILFK+G    R + G  S+ +++
Sbjct: 60  EQPELAASLRIMSIPTLILFKNGAPAGRTV-GVQSKENVL 98


>gi|260775115|ref|ZP_05884014.1| thioredoxin [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609032|gb|EEX35192.1| thioredoxin [Vibrio coralliilyticus ATCC BAA-450]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++VL  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+I++++
Sbjct: 6   LQLTDDGFEADVLNAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|225020850|ref|ZP_03710042.1| hypothetical protein CORMATOL_00858 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946332|gb|EEG27541.1| hypothetical protein CORMATOL_00858 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 106

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  ++V   +F S V+E   PV+VDFWA WC PC KL+P+ID +A+E   ++ + K++++
Sbjct: 1   MKPIEVTETTFRSVVVESDKPVLVDFWAEWCGPCKKLAPVIDQVAEEFDGQIVVAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
               +   +QI SIPTL++FKDGK +++ +    S+++I+
Sbjct: 61  NERNLGAMFQIMSIPTLLIFKDGKKVEQFI-ARGSKTEIV 99


>gi|257481842|ref|ZP_05635883.1| thioredoxin [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|330986781|gb|EGH84884.1| thioredoxin [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331009477|gb|EGH89533.1| thioredoxin [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 109

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+    V+VD+WA WC PC  ++P++D+IAD  A K+ I KL+I+E+ E   ++
Sbjct: 13  NFEAEVLKAEGAVLVDYWAEWCGPCKMIAPVLDEIADTYAGKLTIAKLNIDENQETPAKH 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFKDG V +    GA S+S +  ++
Sbjct: 73  GVRGIPTLMLFKDGNV-EATKVGALSKSQLAAFL 105


>gi|322831469|ref|YP_004211496.1| thioredoxin [Rahnella sp. Y9602]
 gi|321166670|gb|ADW72369.1| thioredoxin [Rahnella sp. Y9602]
          Length = 139

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PCV  +PI +D+A E A K++  K++ E   E+S R++I SIPT+++F
Sbjct: 54  PVVVDFWAPWCGPCVNFAPIFEDVAQERAGKIRFIKVNTEAEPELSARFRIRSIPTIMVF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
            +GK++D M+ GA  ++    W+
Sbjct: 114 NEGKMVD-MLSGAMPKAPFNNWL 135


>gi|42520712|ref|NP_966627.1| thioredoxin [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|42410452|gb|AAS14561.1| thioredoxin [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 69/102 (67%), Gaps = 3/102 (2%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+ ++F SEV +    V+VDFWA WC PC  L P I+ +A +   K+KI K DI+E +E+
Sbjct: 8   VNDQNFKSEVTDYKGFVLVDFWAEWCGPCKSLMPRIEQLAKDRKGKIKICKFDIDEGTEV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++Y + SIPTLI+F+DGK I R + GA+  +D++ W+ S +
Sbjct: 68  PSKYGVQSIPTLIIFQDGKEIARKI-GAT--NDLLSWVDSEI 106


>gi|302388656|ref|YP_003824477.1| thioredoxin [Thermosediminibacter oceani DSM 16646]
 gi|302199284|gb|ADL06854.1| thioredoxin [Thermosediminibacter oceani DSM 16646]
          Length = 104

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L +   +F+ EVL+   PV+VDFWA WC PC  ++P+ID++A E   K+K+ KL+++
Sbjct: 1   MKPLTLTDDNFEQEVLKSDVPVLVDFWAPWCGPCRMMAPVIDELAAEYEGKIKVGKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E+   +  Y + SIPTLILFKDG+  D+ + G   + +II
Sbjct: 61  ENPNSAAAYGVMSIPTLILFKDGQP-DKKLIGFRPKREII 99


>gi|74316054|ref|YP_313794.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
 gi|74055549|gb|AAZ95989.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ EVL+   PV+VD+WA WC PC  +SPI+D++A E A K+K+ KL+I+E+     ++
Sbjct: 12  SFEQEVLQAGVPVLVDYWADWCGPCKMISPILDEVAKEYAGKLKVCKLNIDENQATPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL++FK+G V +    GA S+S +  ++ S +
Sbjct: 72  GIRGIPTLMIFKNGNV-EATKVGALSKSQLTAFVDSNI 108


>gi|50123132|ref|YP_052299.1| thioredoxin [Pectobacterium atrosepticum SCRI1043]
 gi|49613658|emb|CAG77109.1| thioredoxin [Pectobacterium atrosepticum SCRI1043]
          Length = 108

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF ++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ +TKL+I+E+   + +Y
Sbjct: 12  SFGTKVLQAEGATLVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLTANL 108


>gi|166030513|ref|ZP_02233342.1| hypothetical protein DORFOR_00174 [Dorea formicigenerans ATCC
           27755]
 gi|166029675|gb|EDR48432.1| hypothetical protein DORFOR_00174 [Dorea formicigenerans ATCC
           27755]
          Length = 101

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F +EVL    PV++DFWASWC PC  +  I+++IA E  D +K+ K++++
Sbjct: 1   MSAININKNNFQNEVLNSDKPVLLDFWASWCAPCRMVVSIVEEIASERRD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E I
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIVQQ-VSGARPKNAILEMI 101


>gi|323494190|ref|ZP_08099305.1| thioredoxin [Vibrio brasiliensis LMG 20546]
 gi|323311584|gb|EGA64733.1| thioredoxin [Vibrio brasiliensis LMG 20546]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++
Sbjct: 6   LQLTDDGFEADVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFL 104


>gi|332530636|ref|ZP_08406569.1| thioredoxin [Hylemonella gracilis ATCC 19624]
 gi|332039919|gb|EGI76312.1| thioredoxin [Hylemonella gracilis ATCC 19624]
          Length = 111

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+++VL  S PV+VD+WA WC PC  ++P++D++A     K++I KL+++E+ +
Sbjct: 8   HVSDASFEADVLNASQPVLVDYWAEWCGPCKMIAPVLDEVAGTYQGKLQIAKLNVDENRD 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I  ++ I  IPTL+LFKDG++    + GA S++ +  +I
Sbjct: 68  IPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFI 105


>gi|209693768|ref|YP_002261696.1| thioredoxin 1 [Aliivibrio salmonicida LFI1238]
 gi|208007719|emb|CAQ77832.1| thioredoxin 1 [Aliivibrio salmonicida LFI1238]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+  V+  S PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++
Sbjct: 6   LQLTDDGFEESVINASGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|325913812|ref|ZP_08176171.1| thioredoxin [Xanthomonas vesicatoria ATCC 35937]
 gi|325539887|gb|EGD11524.1| thioredoxin [Xanthomonas vesicatoria ATCC 35937]
          Length = 113

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 57/81 (70%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++++++  
Sbjct: 7  HVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRA 66

Query: 65 ISTRYQISSIPTLILFKDGKV 85
          ++ +Y + SIP L+LFKDG+V
Sbjct: 67 LAIKYHVRSIPMLLLFKDGEV 87


>gi|307321475|ref|ZP_07600871.1| Thioredoxin domain protein [Sinorhizobium meliloti AK83]
 gi|306892860|gb|EFN23650.1| Thioredoxin domain protein [Sinorhizobium meliloti AK83]
          Length = 122

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 4/106 (3%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +KVDT +F  EVL+ + PV+VDFW + C+PC  + P ++ IA ELA KVK+ K++  E+ 
Sbjct: 14  VKVDTSNFSEEVLQSAEPVIVDFWKNGCQPCDMIVPFLEQIATELAGKVKVVKINKAENP 73

Query: 64  EISTRYQISSIPTLILFKDGKV----IDRMMPGASSQSDIIEWILS 105
           E+  RY +   PTL LFKDG+V    ID      S +S I E + S
Sbjct: 74  ELVARYGVRGYPTLALFKDGEVAVADIDYDYEPGSLRSSISEALAS 119


>gi|135777|sp|P10473|THIO_RHORU RecName: Full=Thioredoxin; Short=Trx
          Length = 104

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   SF+ +VL+   P  VDFWA WC PC + +P ++++A  L DKV + K++I+E+ +
Sbjct: 3   QVSDASFEEDVLKADGPNXVDFWAEWCGPCRQXAPALEELATALGDKVTVAKINIDENPQ 62

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++Y +  IPTL++FKDG+V    + GA  ++ + EW+ + V
Sbjct: 63  TPSKYGVRGIPTLMIFKDGQVAATKI-GALPKTKLFEWVEASV 104


>gi|297170420|gb|ADI21452.1| thiol-disulfide isomerase and thioredoxins [uncultured gamma
           proteobacterium HF0070_10G19]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MSAL--KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS L  ++  ++FD EV     PV++DFWA WC PC +++PI+D++A +  + +K+ K+D
Sbjct: 1   MSELVKEITDENFDDEVTNSDKPVLIDFWAEWCGPCKQIAPIVDEVAKDYVENLKVCKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ + +I+ ++ I SIPTL++FK+G+ +   + GA S+  ++E+I S +
Sbjct: 61  IDSNRDIAVQFGIRSIPTLMIFKNGQPVGTQI-GAISKQQLLEFIQSEI 108


>gi|309702968|emb|CBJ02299.1| thioredoxin 2 [Escherichia coli ETEC H10407]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A EL+ KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQELSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+R+ I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 135


>gi|289664842|ref|ZP_06486423.1| thioredoxin [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289671092|ref|ZP_06492167.1| thioredoxin [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 113

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 57/81 (70%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++++++  
Sbjct: 7  HVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRA 66

Query: 65 ISTRYQISSIPTLILFKDGKV 85
          ++ +Y + SIP L+LFKDG+V
Sbjct: 67 LAIKYHVRSIPMLLLFKDGEV 87


>gi|238765158|ref|ZP_04626091.1| Thioredoxin 1 [Yersinia kristensenii ATCC 33638]
 gi|238696648|gb|EEP89432.1| Thioredoxin 1 [Yersinia kristensenii ATCC 33638]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           +SF ++VLE    V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+I+++   + +
Sbjct: 11  ESFGTKVLEADGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLNIDDNQATAPK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y I  IPTL+LF+DG+V+   + GA S+  + E++
Sbjct: 71  YGIRGIPTLLLFRDGEVVATKV-GALSKGQLKEFL 104


>gi|160872103|ref|ZP_02062235.1| thioredoxin [Rickettsiella grylli]
 gi|159120902|gb|EDP46240.1| thioredoxin [Rickettsiella grylli]
          Length = 117

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 63/87 (72%), Gaps = 1/87 (1%)

Query: 2  SALKVDTKSFDSEVLEC-SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          S + ++  SF+SEVL+  + P++VDFWA WC PC  +SPI+D ++++   K+KI KL+++
Sbjct: 5  SIVTLNDASFESEVLQFNATPILVDFWAEWCGPCKAISPILDKLSEKYRGKIKIGKLNVD 64

Query: 61 ESSEISTRYQISSIPTLILFKDGKVID 87
          E+ +   +Y +  IPTLILFKDGK ++
Sbjct: 65 ENPKTPAKYGVRGIPTLILFKDGKAVE 91


>gi|325677535|ref|ZP_08157199.1| thioredoxin [Rhodococcus equi ATCC 33707]
 gi|325551782|gb|EGD21480.1| thioredoxin [Rhodococcus equi ATCC 33707]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + ++  SF  EVL+   PV+VDFWA+WC PC  ++P++++IA E  DK+ I KLDI++
Sbjct: 3   NTITINDDSFKQEVLDAEKPVLVDFWATWCGPCKMVAPVLEEIAGEHGDKLTIAKLDIDQ 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +   +  +Q+ SIPT+ILF+ GK + + + GA  ++ +++
Sbjct: 63  NPGAARDFQVMSIPTMILFQGGKPV-KTIVGAKGKAALLK 101


>gi|300779339|ref|ZP_07089197.1| thioredoxin [Chryseobacterium gleum ATCC 35910]
 gi|300504849|gb|EFK35989.1| thioredoxin [Chryseobacterium gleum ATCC 35910]
          Length = 132

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 62/88 (70%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   SF   VL+   PV+VDFWA WC PC  L PII+++A +   K  + K+D++ +
Sbjct: 29  ALEITDSSFQDTVLKSDKPVLVDFWAVWCGPCRTLGPIIEEVASDFEGKAVVGKVDVDNN 88

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMM 90
            EIS +Y I +IPT+++FK+G+V+D+++
Sbjct: 89  QEISMQYGIRNIPTVLIFKNGEVVDKLV 116


>gi|296167153|ref|ZP_06849560.1| thioredoxin [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295897475|gb|EFG77074.1| thioredoxin [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 117

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF +EVL  + PV+VDFWA+WC PC  ++P++++IA E A ++ + KLD++ 
Sbjct: 9   ATIEVSDASFSNEVLSSNKPVLVDFWATWCGPCKMVAPVLEEIASERAGQLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +   +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++
Sbjct: 69  NPVTARDFQVVSIPTMILFKDGQPVKRIV-GAKGKAALL 106


>gi|158319046|ref|YP_001511554.1| thioredoxin [Frankia sp. EAN1pec]
 gi|158114451|gb|ABW16648.1| thioredoxin [Frankia sp. EAN1pec]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 69/95 (72%), Gaps = 1/95 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F +EVL+   PV+VDFWA WC PC  ++P++++IA E  +K++I KL+I+E+ E+
Sbjct: 8   VTDGTFAAEVLKSDKPVLVDFWAEWCGPCKMVAPVLEEIAKEHGEKLRIVKLNIDENPEV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + +YQI SIPT+ +F +G+ ID+ + GA  ++ ++
Sbjct: 68  ARQYQIMSIPTMAVFVNGE-IDKSIVGAKPKAALL 101


>gi|148982246|ref|ZP_01816669.1| thioredoxin 2 [Vibrionales bacterium SWAT-3]
 gi|145960580|gb|EDK25934.1| thioredoxin 2 [Vibrionales bacterium SWAT-3]
          Length = 144

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           +L  S PVVVDFWA+WC PCV  +P+  D+A E +  V+  K+D E   +++  YQI SI
Sbjct: 51  ILNSSQPVVVDFWATWCNPCVGFAPVFSDVAKERSGDVRFVKIDTEAQQQLAAMYQIRSI 110

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           PT+++FKDGK +D +  GA  +    +W+
Sbjct: 111 PTVMVFKDGKRVDTIN-GALPKGQFDQWL 138


>gi|59710664|ref|YP_203440.1| thioredoxin [Vibrio fischeri ES114]
 gi|197334006|ref|YP_002154826.1| thioredoxin [Vibrio fischeri MJ11]
 gi|59478765|gb|AAW84552.1| thioredoxin [Vibrio fischeri ES114]
 gi|197315496|gb|ACH64943.1| thioredoxin [Vibrio fischeri MJ11]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+  V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I++++
Sbjct: 6   LQLTDGGFEESVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|84394536|ref|ZP_00993244.1| thioredoxin 2 [Vibrio splendidus 12B01]
 gi|84374838|gb|EAP91777.1| thioredoxin 2 [Vibrio splendidus 12B01]
          Length = 144

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           +L  S PVVVDFWA+WC PCV  +P+  D+A E +  V+  K+D E   +++  YQI SI
Sbjct: 51  ILNSSQPVVVDFWATWCNPCVGFAPVFSDVAKERSGDVRFVKIDTEAQQQLAAMYQIRSI 110

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           PT+++FKDGK +D +  GA  +    +W+
Sbjct: 111 PTVMVFKDGKRVDTIN-GALPKGQFDQWL 138


>gi|238750654|ref|ZP_04612153.1| Thioredoxin 1 [Yersinia rohdei ATCC 43380]
 gi|238794286|ref|ZP_04637899.1| Thioredoxin 1 [Yersinia intermedia ATCC 29909]
 gi|238711044|gb|EEQ03263.1| Thioredoxin 1 [Yersinia rohdei ATCC 43380]
 gi|238726370|gb|EEQ17911.1| Thioredoxin 1 [Yersinia intermedia ATCC 29909]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 59/77 (76%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+I+++   + +Y
Sbjct: 12 SFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLNIDDNQGTAPKY 71

Query: 70 QISSIPTLILFKDGKVI 86
           I  IPTL+LF+DG+V+
Sbjct: 72 GIRGIPTLLLFRDGEVV 88


>gi|317494808|ref|ZP_07953219.1| thioredoxin [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917133|gb|EFV38481.1| thioredoxin [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
            SFD++VL+   P++VDFWA WC PC  ++PI+D+IA E   K+ I KL+I+E+   + +
Sbjct: 11  NSFDTDVLKAEGPILVDFWAEWCGPCKMIAPILDEIATEYEGKLTIAKLNIDENPATAPK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 71  FGIRGIPTLLLFKNGAVAATKV-GALSKTQLKEFL 104


>gi|254491599|ref|ZP_05104778.1| thioredoxin [Methylophaga thiooxidans DMS010]
 gi|224463077|gb|EEF79347.1| thioredoxin [Methylophaga thiooxydans DMS010]
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 66/97 (68%), Gaps = 1/97 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           FDS+VL+   PV+VD+WA WC PC  ++P++++I  E A K+KI KL+I+E+ +   RY 
Sbjct: 13  FDSQVLQSDMPVLVDYWAEWCGPCKMIAPVLEEIGSEYAGKLKICKLNIDENQDTPPRYG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I  IPTL+LFK G+V +    GA ++S +  ++ S +
Sbjct: 73  IRGIPTLMLFKGGEV-EATKVGALTKSQLTAFLDSNI 108


>gi|159903670|ref|YP_001551014.1| Thiol-disulfide isomerase and thioredoxin [Prochlorococcus marinus
           str. MIT 9211]
 gi|159888846|gb|ABX09060.1| Thiol-disulfide isomerase and thioredoxin [Prochlorococcus marinus
           str. MIT 9211]
          Length = 148

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 61/86 (70%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA  V   SF+ EVL+   PV+VDFWA WC PC  ++PI+D+I+ +   K+K+ KL+ +E
Sbjct: 44  SAAAVTDSSFEQEVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKDFEGKIKVCKLNTDE 103

Query: 62  SSEISTRYQISSIPTLILFKDGKVID 87
           +  ++++Y I SIPTL++FK G+ +D
Sbjct: 104 NPNVASQYGIRSIPTLMIFKGGQKVD 129


>gi|301064499|ref|ZP_07204902.1| thioredoxin [delta proteobacterium NaphS2]
 gi|300441388|gb|EFK05750.1| thioredoxin [delta proteobacterium NaphS2]
          Length = 150

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 64/90 (71%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF SE++    PV++D WA WC PC  + P+I+ +A E A +V+I KL+++E+ + ++RY
Sbjct: 53  SFQSEIINVPGPVLIDCWAPWCGPCRTVGPVIEQLASEYAGRVRIAKLNVDENPQTASRY 112

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            I SIPT++LFK+G +++ ++ GA  + +I
Sbjct: 113 SIRSIPTMLLFKNGDLVNSLV-GALPKGEI 141


>gi|297563775|ref|YP_003682749.1| thioredoxin [Nocardiopsis dassonvillei subsp. dassonvillei DSM
          43111]
 gi|296848223|gb|ADH70243.1| thioredoxin [Nocardiopsis dassonvillei subsp. dassonvillei DSM
          43111]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 67/97 (69%), Gaps = 2/97 (2%)

Query: 1  MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
          MSA+K V   +F  EVL    PV+VDFWA WC PC +++P++D +ADE  DK+++ KL+ 
Sbjct: 1  MSAVKHVTDATFKEEVLSSDKPVLVDFWADWCGPCKQMAPVLDKLADEYGDKIEVVKLNT 60

Query: 60 EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96
          +++ E    Y + S+PT+ L+KDG+V+ +++ GA  +
Sbjct: 61 DQNPETPRSYNVLSLPTMNLYKDGEVVKQII-GAKPK 96


>gi|255659620|ref|ZP_05405029.1| thioredoxin [Mitsuokella multacida DSM 20544]
 gi|260848181|gb|EEX68188.1| thioredoxin [Mitsuokella multacida DSM 20544]
          Length = 102

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 65/88 (73%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+A+ +  ++FDSEVL+    V++DFWA+WC PC  LSPI+D++A E  D VK+ K++++
Sbjct: 1  MAAIVITKENFDSEVLKAEGTVLIDFWATWCGPCRMLSPIVDEVASEHPD-VKVGKINVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ ++ I SIPTL++FK+G+ +  
Sbjct: 60 EQPELAQQFGIMSIPTLLVFKNGEKVQE 87


>gi|312113145|ref|YP_004010741.1| thioredoxin [Rhodomicrobium vannielii ATCC 17100]
 gi|311218274|gb|ADP69642.1| thioredoxin [Rhodomicrobium vannielii ATCC 17100]
          Length = 109

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF+ +V     PV+VDFWA WC PC  + PI++++++E A ++K+ KLD+E
Sbjct: 1   MATTAVSDASFEQDVKNAELPVLVDFWAEWCGPCRTVGPILEELSEEFAGQLKVVKLDVE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  I+  Y I  IP L+LFK+G+V  + + GA  +  +  WI
Sbjct: 61  SNPGIAQAYNIRGIPALLLFKNGEVAGQQI-GALPKQQLRAWI 102


>gi|160931597|ref|ZP_02078992.1| hypothetical protein CLOLEP_00429 [Clostridium leptum DSM 753]
 gi|156869468|gb|EDO62840.1| hypothetical protein CLOLEP_00429 [Clostridium leptum DSM 753]
          Length = 105

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++  ++F SEV E    V++DFWASWC PC  +SPI+D+IA+E    VK+ K++++
Sbjct: 1   MAVIELTKQNFQSEVAESKEKVLIDFWASWCGPCRMVSPIVDEIAEESPAGVKVCKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++Q+ SIPTL++ KDGK +   + GA  +  I++ I
Sbjct: 61  EQPELAQQFQVMSIPTLLVMKDGKPVASSV-GARPKQFIVKMI 102


>gi|85544673|pdb|2FCH|A Chain A, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544674|pdb|2FCH|B Chain B, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544675|pdb|2FCH|C Chain C, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544676|pdb|2FCH|D Chain D, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544677|pdb|2FCH|E Chain E, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544678|pdb|2FCH|F Chain F, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544679|pdb|2FCH|G Chain G, Crystal Structure Of Thioredoxin Mutant G74s
          Length = 108

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I SIPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRSIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|296117286|ref|ZP_06835877.1| thioredoxin [Gluconacetobacter hansenii ATCC 23769]
 gi|295976179|gb|EFG82966.1| thioredoxin [Gluconacetobacter hansenii ATCC 23769]
          Length = 109

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 68/103 (66%), Gaps = 3/103 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V    F  +VLE S PV+VDFWA WC PC  ++P +++I  E   ++K+ K++I+E
Sbjct: 4   NTVAVKDAEFQKQVLESSEPVLVDFWAEWCGPCKMVAPALEEIGAEFKGQLKVVKVNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVI-DRMMPGASSQSDIIEWI 103
           + +    Y +  IPT+++FKDGKV+ D++  GA+ ++ + EW+
Sbjct: 64  NPDTPNTYGVRGIPTMLIFKDGKVVADKV--GAAPKTQLKEWV 104


>gi|158522655|ref|YP_001530525.1| thioredoxin [Desulfococcus oleovorans Hxd3]
 gi|158511481|gb|ABW68448.1| thioredoxin [Desulfococcus oleovorans Hxd3]
          Length = 150

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F  EVL  + PV+VDFWA WC PC  + P+++ +A + A +VKI KL+++E+   ++R
Sbjct: 52  RTFQDEVLSSAVPVLVDFWAPWCGPCKMVGPMLERLAAKYAGRVKIAKLNVDENPATASR 111

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y +SSIPTL+ FK G+V   ++ GA  +S I + I
Sbjct: 112 YAVSSIPTLLFFKQGRVAQTLV-GAVPESRIEDQI 145


>gi|261368310|ref|ZP_05981193.1| thioredoxin [Subdoligranulum variabile DSM 15176]
 gi|282569683|gb|EFB75218.1| thioredoxin [Subdoligranulum variabile DSM 15176]
          Length = 104

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS L +  ++F +EV+    PV+VDFWASWC PC  +SP++D+IA E  + +K+ K++++
Sbjct: 1   MSVLHITKENFVNEVVNSDRPVLVDFWASWCGPCRMVSPLVDEIAAEHPE-IKVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++Q+ SIPTL++ K+G+V  R + GA  ++ I+  +
Sbjct: 60  EQPELAGQFQVMSIPTLMVVKNGQVTQRTV-GARPKNQILALV 101


>gi|86158918|ref|YP_465703.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775429|gb|ABC82266.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 109

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 58/81 (71%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F+ EVL+   PV+VDFWA WC PC  ++P++DD+A     K+K+ K+D+++   +  +Y
Sbjct: 13 TFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQY 72

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           I SIPTL++FK G+V+D ++
Sbjct: 73 GIRSIPTLLVFKGGRVVDTVI 93


>gi|237745454|ref|ZP_04575934.1| thioredoxin [Oxalobacter formigenes HOxBLS]
 gi|229376805|gb|EEO26896.1| thioredoxin [Oxalobacter formigenes HOxBLS]
          Length = 132

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PIID++A E A K+   K+D++ +     ++
Sbjct: 36  SFETDVLKSDKPVLVDFWAEWCGPCKMVAPIIDEVAKEYAGKLNFAKMDVDSNQVTPAKF 95

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTLILFK+G ++ + + GA S++ ++ +I S +
Sbjct: 96  GIRGIPTLILFKNGAIVSQKV-GALSKNQLMAFIDSNI 132


>gi|113461487|ref|YP_719556.1| thioredoxin [Haemophilus somnus 129PT]
 gi|170718407|ref|YP_001783629.1| thioredoxin [Haemophilus somnus 2336]
 gi|112823530|gb|ABI25619.1| thioredoxin [Haemophilus somnus 129PT]
 gi|168826536|gb|ACA31907.1| thioredoxin [Haemophilus somnus 2336]
          Length = 107

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L     +FD++VL+   PV++DFWA WC PC  + PI+++++ EL DKVKI K++I+E+ 
Sbjct: 5   LHTTDATFDTDVLKSDIPVLLDFWAPWCGPCRMIGPILEELSAELGDKVKIVKINIDENQ 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ + SIPTLI FK+GK +   + GA  ++ ++ +I
Sbjct: 65  ATPAQFGVRSIPTLIFFKEGKAVATQV-GALPKNQLVNFI 103


>gi|238020525|ref|ZP_04600951.1| hypothetical protein GCWU000324_00409 [Kingella oralis ATCC
          51147]
 gi|237867505|gb|EEP68511.1| hypothetical protein GCWU000324_00409 [Kingella oralis ATCC
          51147]
          Length = 109

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 59/81 (72%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V   +F++EVL+ S PV++DFWA WC PC  ++PI+D +A+E   KVKI K++++E+ 
Sbjct: 6  IHVTDATFEAEVLQSSVPVLLDFWAPWCGPCKMIAPILDQLAEEYDGKVKIAKMNVDENQ 65

Query: 64 EISTRYQISSIPTLILFKDGK 84
           +  ++ I  IPT+I+FKDGK
Sbjct: 66 GVPAQFGIRGIPTMIVFKDGK 86


>gi|320107753|ref|YP_004183343.1| thioredoxin [Terriglobus saanensis SP1PR4]
 gi|319926274|gb|ADV83349.1| thioredoxin [Terriglobus saanensis SP1PR4]
          Length = 110

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 61/86 (70%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
          +V+  +F+ +VL+   PV+VDFWASWC PC  L+PI+D +A+    K+K+ K+D++ ++ 
Sbjct: 8  EVNDATFEQDVLKSDQPVLVDFWASWCGPCRALAPIVDQVAETYNGKLKVMKMDVDRNNA 67

Query: 65 ISTRYQISSIPTLILFKDGKVIDRMM 90
             +Y I  IP L++FKDGKV ++++
Sbjct: 68 TPGKYGIRGIPALLIFKDGKVAEQIV 93


>gi|295105816|emb|CBL03359.1| thioredoxin [Gordonibacter pamelaeae 7-10-1-b]
          Length = 102

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          V +  F S+VL+   PV+VDF+A+WC PC  L+P ID+IA E A K  + KLDI++S +I
Sbjct: 5  VSSSDFQSKVLDAQGPVLVDFFATWCGPCKMLAPTIDEIAGEQAGKATVYKLDIDQSPDI 64

Query: 66 STRYQISSIPTLILFKDGKV 85
          + +Y + S+PTLI+F++G+V
Sbjct: 65 AQKYGVMSVPTLIVFENGQV 84


>gi|33863398|ref|NP_894958.1| thioredoxin [Prochlorococcus marinus str. MIT 9313]
 gi|124022621|ref|YP_001016928.1| thioredoxin [Prochlorococcus marinus str. MIT 9303]
 gi|33640847|emb|CAE21302.1| Thioredoxin [Prochlorococcus marinus str. MIT 9313]
 gi|123962907|gb|ABM77663.1| Thioredoxin [Prochlorococcus marinus str. MIT 9303]
          Length = 107

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+IA E   K+K+ KL+ +E
Sbjct: 3  NAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFESKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMVFKGGQKVDTVV 91


>gi|159464168|ref|XP_001690314.1| thioredoxin m [Chlamydomonas reinhardtii]
 gi|1729935|sp|P23400|TRXM_CHLRE RecName: Full=Thioredoxin M-type, chloroplastic; Short=Trx-M;
           AltName: Full=Thioredoxin-CH2; Flags: Precursor
 gi|840747|emb|CAA56851.1| thioredoxin m [Chlamydomonas reinhardtii]
 gi|158284302|gb|EDP10052.1| thioredoxin m [Chlamydomonas reinhardtii]
          Length = 140

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V+  +F + VLE S PV+VDFWA WC PC  ++P++D+IA E  DK+K  KL+ +ES
Sbjct: 36  AGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDES 95

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             +++ Y I SIPT+++FK GK  + ++ GA  ++ I++ +
Sbjct: 96  PNVASEYGIRSIPTIMVFKGGKKCETII-GAVPKATIVQTV 135


>gi|741034|prf||2006292A thioredoxin
          Length = 106

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   +F S+VLE   PV+V F   WC PC  ++P++D+IA+E   KVK+ K++ +E
Sbjct: 2   ATVKVTNATFKSDVLESDKPVLVHFEGPWCGPCKMVAPVLDEIANEYEGKVKVAKVNTDE 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +++++Y + SIPTL++FK G+V   M+ GA+ ++ +  ++
Sbjct: 62  NPQLASQYGVRSIPTLLMFKGGEVAANMV-GAAPKTRLAAFL 102


>gi|86131299|ref|ZP_01049898.1| thioredoxin [Dokdonia donghaensis MED134]
 gi|85818710|gb|EAQ39870.1| thioredoxin [Dokdonia donghaensis MED134]
          Length = 105

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+ +VL+   PV+VDFWA+WC PC  + P+I++IA E   K  + K+D++ +
Sbjct: 2   ALEITDATFEEQVLKSDKPVLVDFWAAWCGPCRMVGPVIEEIAGEYEGKAIVGKVDVDAN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            E + +Y + +IPT+++FK+G+V+ R + G + ++   E I
Sbjct: 62  QEFAAKYGVRNIPTVLMFKNGEVVGRQV-GVAPKATYTEAI 101


>gi|113953145|ref|YP_730183.1| thioredoxin [Synechococcus sp. CC9311]
 gi|113880496|gb|ABI45454.1| thioredoxin [Synechococcus sp. CC9311]
          Length = 107

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E
Sbjct: 3  SATAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMVFKGGQKVDTVV 91


>gi|325261811|ref|ZP_08128549.1| thioredoxin [Clostridium sp. D5]
 gi|324033265|gb|EGB94542.1| thioredoxin [Clostridium sp. D5]
          Length = 102

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 72/100 (72%), Gaps = 2/100 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+  ++F+ EV++   PV+VDF+A WC PC  ++P++++I++E  D  K+ KL+I+
Sbjct: 1   MAVIKLTAQNFEQEVVQSEKPVLVDFYADWCGPCKMMAPVVEEISEEKED-AKVCKLNID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E  EI+ +Y + SIPT ++FKDG+V+ + + GA  +S ++
Sbjct: 60  EEMEIAQKYGVMSIPTFMVFKDGQVVKKDL-GAKPKSAVL 98


>gi|77359090|ref|YP_338665.1| thioredoxin [Pseudoalteromonas haloplanktis TAC125]
 gi|76555868|emb|CAH57475.1| thioredoxin [Pseudoalteromonas haloplanktis TAC125]
 gi|76874001|emb|CAI85222.1| thioredoxin 1, redox factor [Pseudoalteromonas haloplanktis TAC125]
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   SF+++VL+   PV+VDFWA WC PC  ++PI+ ++A+E   +V I KL+I++++
Sbjct: 6   IQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILSEVAEEFDGRVTIAKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG+V    + GA S++ +IE++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLIEFL 104


>gi|301021428|ref|ZP_07185452.1| thioredoxin [Escherichia coli MS 69-1]
 gi|300398064|gb|EFJ81602.1| thioredoxin [Escherichia coli MS 69-1]
          Length = 127

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 30  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 89

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 90  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 122


>gi|312881438|ref|ZP_07741233.1| thioredoxin [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370920|gb|EFP98377.1| thioredoxin [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F++ V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+I+ ++
Sbjct: 6   LQLTDDGFENSVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDHNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGNVAATKV-GALSKTQLKEFL 104


>gi|317131130|ref|YP_004090444.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
 gi|315469109|gb|ADU25713.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F+  VL    PV++DFWASWC PC   SP+I+++A++L     + KL+++
Sbjct: 1   MSAISLNRSNFEDVVLNTDKPVLIDFWASWCGPCRMQSPVIEELAEKLEGAAVVAKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E+ E++ ++ + SIPTL+  KDG+++ R   G +S ++++
Sbjct: 61  ENPELAAQFSVMSIPTLVFVKDGRIVGRRT-GVTSGAELL 99


>gi|332282711|ref|ZP_08395124.1| thioredoxin 1 [Shigella sp. D9]
 gi|332105063|gb|EGJ08409.1| thioredoxin 1 [Shigella sp. D9]
          Length = 127

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 30  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPATAPKY 89

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 90  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 122


>gi|300940004|ref|ZP_07154629.1| thioredoxin [Escherichia coli MS 21-1]
 gi|300455137|gb|EFK18630.1| thioredoxin [Escherichia coli MS 21-1]
          Length = 127

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 30  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 89

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 90  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 122


>gi|227325833|ref|ZP_03829857.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF ++VL+    ++VDFWA WC PC  ++PI+D+IA+E   K+ +TKL+I+E+   + +Y
Sbjct: 12  SFGTKVLQADGAILVDFWAEWCGPCKMIAPILDEIAEEFDGKLTVTKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLTANL 108


>gi|194336617|ref|YP_002018411.1| thioredoxin [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309094|gb|ACF43794.1| thioredoxin [Pelodictyon phaeoclathratiforme BU-1]
          Length = 110

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 61/81 (75%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F SEVL+    V+VDFWA WC PC+ L P+I+++A + AD+  I KL+++E+S  + +Y
Sbjct: 12 NFKSEVLDSDKVVLVDFWAVWCGPCMMLGPVIEELAADYADRAVIAKLNVDENSATAAKY 71

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           I SIP+L+++K+G V+D+M+
Sbjct: 72 GIRSIPSLLIYKNGVVVDQML 92


>gi|116073100|ref|ZP_01470362.1| Thioredoxin [Synechococcus sp. RS9916]
 gi|116068405|gb|EAU74157.1| Thioredoxin [Synechococcus sp. RS9916]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E
Sbjct: 3  SAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMVFKGGQKVDTVV 91


>gi|17227548|ref|NP_484096.1| thioredoxin [Nostoc sp. PCC 7120]
 gi|75908866|ref|YP_323162.1| thioredoxin [Anabaena variabilis ATCC 29413]
 gi|61248483|sp|P0A4L1|THIO1_ANASP RecName: Full=Thioredoxin-1; Short=Trx-1; AltName:
          Full=Thioredoxin-M
 gi|61248485|sp|P0A4L2|THIO1_ANASO RecName: Full=Thioredoxin-1; Short=Trx-1; AltName:
          Full=Thioredoxin-M
 gi|7427614|pir||TXAI thioredoxin 1 - Anabaena sp
 gi|142118|gb|AAA22049.1| thioredoxin [Anabaena sp.]
 gi|17135030|dbj|BAB77576.1| thioredoxin [Nostoc sp. PCC 7120]
 gi|75702591|gb|ABA22267.1| thioredoxin [Anabaena variabilis ATCC 29413]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A +V   +F  EVL+   PV+VDFWA WC PC  ++P++D+IA +   K+K+ K++ +E
Sbjct: 3  AAAQVTDSTFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEIAQQYEGKIKVVKVNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          + +++++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPQVASQYGIRSIPTLMIFKGGQKVD-MVVGAVPKTTL 99


>gi|15804371|ref|NP_290411.1| thioredoxin [Escherichia coli O157:H7 EDL933]
 gi|15833968|ref|NP_312741.1| thioredoxin [Escherichia coli O157:H7 str. Sakai]
 gi|30064924|ref|NP_839095.1| thioredoxin [Shigella flexneri 2a str. 2457T]
 gi|56480434|ref|NP_709584.2| thioredoxin [Shigella flexneri 2a str. 301]
 gi|74314295|ref|YP_312714.1| thioredoxin [Shigella sonnei Ss046]
 gi|82546135|ref|YP_410082.1| thioredoxin [Shigella boydii Sb227]
 gi|82779038|ref|YP_405387.1| thioredoxin [Shigella dysenteriae Sd197]
 gi|227888636|ref|ZP_04006441.1| thioredoxin [Escherichia coli 83972]
 gi|237702791|ref|ZP_04533272.1| thioredoxin 1 [Escherichia sp. 3_2_53FAA]
 gi|254038993|ref|ZP_04873044.1| thioredoxin 1 [Escherichia sp. 1_1_43]
 gi|291285196|ref|YP_003502014.1| thioredoxin TrxA [Escherichia coli O55:H7 str. CB9615]
 gi|293417247|ref|ZP_06659872.1| thioredoxin-1 [Escherichia coli B185]
 gi|293468099|ref|ZP_06664511.1| thioredoxin 1 [Escherichia coli B088]
 gi|300818750|ref|ZP_07098957.1| thioredoxin [Escherichia coli MS 107-1]
 gi|300823312|ref|ZP_07103443.1| thioredoxin [Escherichia coli MS 119-7]
 gi|300904032|ref|ZP_07121914.1| thioredoxin [Escherichia coli MS 84-1]
 gi|300921513|ref|ZP_07137857.1| thioredoxin [Escherichia coli MS 115-1]
 gi|300923280|ref|ZP_07139329.1| thioredoxin [Escherichia coli MS 182-1]
 gi|300930056|ref|ZP_07145486.1| thioredoxin [Escherichia coli MS 187-1]
 gi|300947362|ref|ZP_07161558.1| thioredoxin [Escherichia coli MS 116-1]
 gi|300955217|ref|ZP_07167612.1| thioredoxin [Escherichia coli MS 175-1]
 gi|300979309|ref|ZP_07174493.1| thioredoxin [Escherichia coli MS 200-1]
 gi|300985807|ref|ZP_07177599.1| thioredoxin [Escherichia coli MS 45-1]
 gi|301047339|ref|ZP_07194424.1| thioredoxin [Escherichia coli MS 185-1]
 gi|301303675|ref|ZP_07209796.1| thioredoxin [Escherichia coli MS 124-1]
 gi|301325470|ref|ZP_07218953.1| thioredoxin [Escherichia coli MS 78-1]
 gi|301646154|ref|ZP_07246053.1| thioredoxin [Escherichia coli MS 146-1]
 gi|309796279|ref|ZP_07690689.1| thioredoxin [Escherichia coli MS 145-7]
 gi|331644515|ref|ZP_08345635.1| thioredoxin [Escherichia coli H736]
 gi|331649606|ref|ZP_08350688.1| thioredoxin [Escherichia coli M605]
 gi|331655465|ref|ZP_08356458.1| thioredoxin [Escherichia coli M718]
 gi|331675251|ref|ZP_08376002.1| thioredoxin [Escherichia coli TA280]
 gi|331679890|ref|ZP_08380553.1| thioredoxin [Escherichia coli H591]
 gi|25282744|pir||B91218 thioredoxin 1 [imported] - Escherichia coli (strain O157:H7,
           substrain RIMD 0509952)
 gi|25282746|pir||C86064 thioredoxin 1 [imported] - Escherichia coli (strain O157:H7,
           substrain EDL933)
 gi|12518641|gb|AAG58975.1|AE005609_7 thioredoxin 1 [Escherichia coli O157:H7 str. EDL933]
 gi|147611|gb|AAA24534.1| thioredoxin [Escherichia coli]
 gi|148185|gb|AAA67582.1| thioredoxin [Escherichia coli str. K-12 substr. MG1655]
 gi|13364189|dbj|BAB38137.1| thioredoxin 1 [Escherichia coli O157:H7 str. Sakai]
 gi|30043185|gb|AAP18906.1| thioredoxin 1 [Shigella flexneri 2a str. 2457T]
 gi|56383985|gb|AAN45291.2| thioredoxin 1 [Shigella flexneri 2a str. 301]
 gi|73857772|gb|AAZ90479.1| thioredoxin 1 [Shigella sonnei Ss046]
 gi|81243186|gb|ABB63896.1| thioredoxin 1 [Shigella dysenteriae Sd197]
 gi|81247546|gb|ABB68254.1| thioredoxin 1 [Shigella boydii Sb227]
 gi|209753508|gb|ACI75061.1| rho operon leader peptide [Escherichia coli]
 gi|209753510|gb|ACI75062.1| rho operon leader peptide [Escherichia coli]
 gi|209753512|gb|ACI75063.1| rho operon leader peptide [Escherichia coli]
 gi|209753514|gb|ACI75064.1| rho operon leader peptide [Escherichia coli]
 gi|209753516|gb|ACI75065.1| rho operon leader peptide [Escherichia coli]
 gi|226838684|gb|EEH70712.1| thioredoxin 1 [Escherichia sp. 1_1_43]
 gi|226902962|gb|EEH89221.1| thioredoxin 1 [Escherichia sp. 3_2_53FAA]
 gi|227834475|gb|EEJ44941.1| thioredoxin [Escherichia coli 83972]
 gi|290765069|gb|ADD59030.1| thioredoxin TrxA [Escherichia coli O55:H7 str. CB9615]
 gi|291321477|gb|EFE60915.1| thioredoxin 1 [Escherichia coli B088]
 gi|291431015|gb|EFF04010.1| thioredoxin-1 [Escherichia coli B185]
 gi|300300756|gb|EFJ57141.1| thioredoxin [Escherichia coli MS 185-1]
 gi|300308062|gb|EFJ62582.1| thioredoxin [Escherichia coli MS 200-1]
 gi|300317871|gb|EFJ67655.1| thioredoxin [Escherichia coli MS 175-1]
 gi|300403984|gb|EFJ87522.1| thioredoxin [Escherichia coli MS 84-1]
 gi|300407958|gb|EFJ91496.1| thioredoxin [Escherichia coli MS 45-1]
 gi|300411581|gb|EFJ94891.1| thioredoxin [Escherichia coli MS 115-1]
 gi|300420425|gb|EFK03736.1| thioredoxin [Escherichia coli MS 182-1]
 gi|300453024|gb|EFK16644.1| thioredoxin [Escherichia coli MS 116-1]
 gi|300462044|gb|EFK25537.1| thioredoxin [Escherichia coli MS 187-1]
 gi|300524098|gb|EFK45167.1| thioredoxin [Escherichia coli MS 119-7]
 gi|300528716|gb|EFK49778.1| thioredoxin [Escherichia coli MS 107-1]
 gi|300840975|gb|EFK68735.1| thioredoxin [Escherichia coli MS 124-1]
 gi|300847697|gb|EFK75457.1| thioredoxin [Escherichia coli MS 78-1]
 gi|301075623|gb|EFK90429.1| thioredoxin [Escherichia coli MS 146-1]
 gi|308120161|gb|EFO57423.1| thioredoxin [Escherichia coli MS 145-7]
 gi|315254145|gb|EFU34113.1| thioredoxin [Escherichia coli MS 85-1]
 gi|315284669|gb|EFU44114.1| thioredoxin [Escherichia coli MS 110-3]
 gi|315293135|gb|EFU52487.1| thioredoxin [Escherichia coli MS 153-1]
 gi|315296844|gb|EFU56133.1| thioredoxin [Escherichia coli MS 16-3]
 gi|324007444|gb|EGB76663.1| thioredoxin [Escherichia coli MS 57-2]
 gi|324014726|gb|EGB83945.1| thioredoxin [Escherichia coli MS 60-1]
 gi|324016170|gb|EGB85389.1| thioredoxin [Escherichia coli MS 117-3]
 gi|331036187|gb|EGI08422.1| thioredoxin [Escherichia coli H736]
 gi|331041476|gb|EGI13624.1| thioredoxin [Escherichia coli M605]
 gi|331046786|gb|EGI18870.1| thioredoxin [Escherichia coli M718]
 gi|331067537|gb|EGI38941.1| thioredoxin [Escherichia coli TA280]
 gi|331072437|gb|EGI43769.1| thioredoxin [Escherichia coli H591]
          Length = 127

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 30  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 89

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 90  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 122


>gi|161505567|ref|YP_001572679.1| thioredoxin [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866914|gb|ABX23537.1| hypothetical protein SARI_03737 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 123

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 26  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 85

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 86  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 118


>gi|300900675|ref|ZP_07118828.1| thioredoxin [Escherichia coli MS 198-1]
 gi|300355824|gb|EFJ71694.1| thioredoxin [Escherichia coli MS 198-1]
          Length = 127

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 30  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 89

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 90  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 122


>gi|56698685|ref|YP_169062.1| thioredoxin [Ruegeria pomeroyi DSS-3]
 gi|56680422|gb|AAV97088.1| thioredoxin [Ruegeria pomeroyi DSS-3]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A E A KVKI K+D++
Sbjct: 1   MSTVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELATEYAGKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI S +
Sbjct: 61  SNPNAAAAMGVRGIPALFIFKDGQVVSNRA-GAAPKAALQNWIDSSI 106


>gi|294675593|ref|YP_003576208.1| thioredoxin [Rhodobacter capsulatus SB 1003]
 gi|294474413|gb|ADE83801.1| thioredoxin-1 [Rhodobacter capsulatus SB 1003]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV +   PVVVDFWA WC PC  + P ++D++ ELA KVKI K++++
Sbjct: 1   MATVAVTDATFDAEVRQSDLPVVVDFWAEWCGPCKMIGPSLEDLSTELAGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ +      +  IP L LFKDG+V+   + GA+ ++ +  WI
Sbjct: 61  ENPDSPAALGVRGIPALFLFKDGQVVSNKV-GAAPKAALQAWI 102


>gi|217969085|ref|YP_002354319.1| thioredoxin [Thauera sp. MZ1T]
 gi|217506412|gb|ACK53423.1| thioredoxin [Thauera sp. MZ1T]
          Length = 145

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++D  +FD  V     PV+VDFWA WC PC  ++P     A  L  ++++ KLD E   
Sbjct: 42  VELDAANFDRHVGRSDVPVLVDFWAPWCGPCRTMAPAFAQAAGMLEPQLRLAKLDTEAHQ 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++ R+ I SIPTL LF+ G+ I R   GA S +DI+ W+  ++
Sbjct: 102 ALAARFGIRSIPTLALFRGGREIARQA-GAMSAADIVRWVRGQL 144


>gi|300780169|ref|ZP_07090025.1| thioredoxin [Corynebacterium genitalium ATCC 33030]
 gi|300534279|gb|EFK55338.1| thioredoxin [Corynebacterium genitalium ATCC 33030]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 5/107 (4%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+ V   +F SEV+E   PV+VDFWA WC PC KLSP++D+IA+E+  ++K+ K++++
Sbjct: 1   MTAINVTQSTFKSEVVESDIPVLVDFWAEWCGPCKKLSPLLDEIAEEMDGQIKVAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +   +Q+ SIP +++F  G+ +D  +     Q      I+SRV
Sbjct: 61  QERLLGAMFQVMSIPNVMIFSGGEKVDEFVGLVPKQE-----IVSRV 102


>gi|255326490|ref|ZP_05367572.1| thioredoxin [Rothia mucilaginosa ATCC 25296]
 gi|283458986|ref|YP_003363635.1| thiol-disulfide isomerase [Rothia mucilaginosa DY-18]
 gi|255296530|gb|EET75865.1| thioredoxin [Rothia mucilaginosa ATCC 25296]
 gi|283135050|dbj|BAI65815.1| thiol-disulfide isomerase [Rothia mucilaginosa DY-18]
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA +    +FD  VL+   PV+VDFWA WC PC  + P+ID+IA E A +V + K+D+E 
Sbjct: 3   SAQQATDATFDELVLKNDKPVIVDFWAEWCGPCRMVGPVIDEIAGEYAGQVDVVKVDVEA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + + + +Y I+SIP + LFK G+V+ + + GA ++  ++
Sbjct: 63  NGDTAMKYGITSIPAIYLFKGGEVVKKTV-GAKTKPALL 100


>gi|254510578|ref|ZP_05122645.1| thioredoxin [Rhodobacteraceae bacterium KLH11]
 gi|221534289|gb|EEE37277.1| thioredoxin [Rhodobacteraceae bacterium KLH11]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A+E  DKVKI K+D++
Sbjct: 1   MSTVAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELANEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGQVVSNRA-GAAPKAALQSWI 102


>gi|163787276|ref|ZP_02181723.1| thioredoxin [Flavobacteriales bacterium ALC-1]
 gi|159877164|gb|EDP71221.1| thioredoxin [Flavobacteriales bacterium ALC-1]
          Length = 105

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+  VL+   PV+VDFWA+WC PC  + PIID+I+ E   K  + K+D++ +
Sbjct: 2   ALEITDANFEETVLKSDKPVMVDFWAAWCGPCRMVGPIIDEISTEYDGKAVVGKVDVDAN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGA--SSQSDIIEWIL 104
            E + +Y + +IPT+++FKDG+V+ R +  A  ++ SD I+ +L
Sbjct: 62  QEFAAKYGVRNIPTVLVFKDGEVVGRQVGVAPKNAYSDAIDALL 105


>gi|94496380|ref|ZP_01302957.1| thioredoxin [Sphingomonas sp. SKA58]
 gi|94424126|gb|EAT09150.1| thioredoxin [Sphingomonas sp. SKA58]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF  +V+    PV+VDFWA WC PC  + P +++I++EL DKV I K++I+
Sbjct: 1   MATKAVTDVSFQQDVIAADKPVLVDFWAEWCGPCKMIGPALEEISEELGDKVTIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ +   +Y +  IPT+ILFK+G+V    + GA+ +S +  WI S
Sbjct: 61  ENPDAPGKYGVRGIPTMILFKNGEVSATKV-GAAPKSALKGWIES 104


>gi|86148270|ref|ZP_01066566.1| thioredoxin [Vibrio sp. MED222]
 gi|85833966|gb|EAQ52128.1| thioredoxin [Vibrio sp. MED222]
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   ++ I KL+I++++
Sbjct: 6   LQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGQLTIGKLNIDQNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 104


>gi|257064125|ref|YP_003143797.1| thioredoxin [Slackia heliotrinireducens DSM 20476]
 gi|256791778|gb|ACV22448.1| thioredoxin [Slackia heliotrinireducens DSM 20476]
          Length = 102

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 69/95 (72%), Gaps = 1/95 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           + +  F+ +VL+ + PV+VD +A+WC PC  ++P +D +A E AD+V I K+D++ES EI
Sbjct: 5   ISSAEFEEKVLKATEPVIVDLFATWCGPCKAMAPTLDKVAAEHADEVSIYKVDVDESPEI 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + ++++ S+PTL+ FK+G++++R + GA  +  I+
Sbjct: 65  AQKFRVMSVPTLLAFKNGELVNRAV-GAQPEDAIV 98


>gi|298352660|sp|Q5JMR9|TRXY_ORYSJ RecName: Full=Thioredoxin Y, chloroplastic; Short=OsTrxy; Flags:
           Precursor
          Length = 168

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           + A K    SFD  + +   PV+VDF+A+WC PC  + PI+ +++++L DK+++ K+D E
Sbjct: 59  VQAKKQTFSSFDELLEKSEKPVLVDFYATWCGPCQYMVPILQEVSEKLGDKIQVVKIDTE 118

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + + I+ RYQI ++PT I+FK+GK   R   GA   + +I+ I S
Sbjct: 119 KYTSIANRYQIEALPTFIIFKNGKPCHRFE-GALPANQLIQQIES 162


>gi|255320837|ref|ZP_05362011.1| thioredoxin [Acinetobacter radioresistens SK82]
 gi|262380270|ref|ZP_06073425.1| thioredoxin [Acinetobacter radioresistens SH164]
 gi|255302006|gb|EET81249.1| thioredoxin [Acinetobacter radioresistens SK82]
 gi|262298464|gb|EEY86378.1| thioredoxin [Acinetobacter radioresistens SH164]
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  V+T  ++F ++VL+   PV+VDFWA WC PC  ++P+++D++ E   KVKI K+D
Sbjct: 1   MSANIVNTTDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSREYEGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    + + +Y I +IP L++FK+G+V+ + + GA+ +S +  +I
Sbjct: 61  VTSCEDTAVKYNIRNIPALLMFKNGEVVGQQV-GAAPRSKLAAFI 104


>gi|152991292|ref|YP_001357014.1| thioredoxin [Nitratiruptor sp. SB155-2]
 gi|151423153|dbj|BAF70657.1| thioredoxin [Nitratiruptor sp. SB155-2]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 64/91 (70%), Gaps = 2/91 (2%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          ++++  +FD  + E    V+VDFWA WC PC  ++PIID++A+E   K KI K++ +E  
Sbjct: 5  IELNASNFDDTIKE--GVVMVDFWAPWCGPCRMIAPIIDELAEEYEGKAKIAKVNTDEEQ 62

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMMPGAS 94
          +I+ RY I SIPT++ FKDG+++D+M+  AS
Sbjct: 63 DIAIRYGIRSIPTILFFKDGQLVDQMVGAAS 93


>gi|88854487|ref|ZP_01129154.1| thioredoxin [marine actinobacterium PHSC20C1]
 gi|88816295|gb|EAR26150.1| thioredoxin [marine actinobacterium PHSC20C1]
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 73/105 (69%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA +V   +F+  V+   + ++VDFWA WC PC  +SPI+D IA E ADK+KI KL++++
Sbjct: 3   SATEVTDANFEEVVINSQDTIMVDFWAEWCGPCRAVSPILDQIASEHADKIKIVKLNVDD 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDIIEWI 103
           + +++ +YQI+SIP + +F+ G+V+  ++   P  + ++D+ E++
Sbjct: 63  NPQMAMKYQITSIPAMKVFRGGEVVKTVIGAKPKPAIEADLAEFL 107


>gi|258622629|ref|ZP_05717650.1| thioredoxin [Vibrio mimicus VM573]
 gi|258623961|ref|ZP_05718914.1| thioredoxin [Vibrio mimicus VM603]
 gi|262173962|ref|ZP_06041639.1| thioredoxin 2 [Vibrio mimicus MB-451]
 gi|258583755|gb|EEW08551.1| thioredoxin [Vibrio mimicus VM603]
 gi|258585085|gb|EEW09813.1| thioredoxin [Vibrio mimicus VM573]
 gi|261891320|gb|EEY37307.1| thioredoxin 2 [Vibrio mimicus MB-451]
          Length = 144

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T++  S +L+   PVVVDFWA WC PCV  +P+  D+A E   +V+  K+D E    ++ 
Sbjct: 44  TEANFSALLQSDKPVVVDFWAPWCNPCVGFAPVFSDVAAERKGRVRFIKIDTEAQQNLAA 103

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +QI SIPT+++FK+G+ ID M+ GA  +S   +W+
Sbjct: 104 HFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWL 138


>gi|257452612|ref|ZP_05617911.1| thioredoxin [Fusobacterium sp. 3_1_5R]
 gi|257466469|ref|ZP_05630780.1| thioredoxin [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917626|ref|ZP_07913866.1| thioredoxin [Fusobacterium gonidiaformans ATCC 25563]
 gi|317059152|ref|ZP_07923637.1| thioredoxin [Fusobacterium sp. 3_1_5R]
 gi|313684828|gb|EFS21663.1| thioredoxin [Fusobacterium sp. 3_1_5R]
 gi|313691501|gb|EFS28336.1| thioredoxin [Fusobacterium gonidiaformans ATCC 25563]
          Length = 103

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 65/88 (73%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  ++F  EVLE + PVVVDF+A+WC PC  LSP+++D+  E + K KI K+DI+
Sbjct: 1  MAIVHVTKENFKQEVLEANQPVVVDFFATWCGPCKSLSPVLEDVVAEDSFK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
             E+++ Y+I S+PTL+LFK G+V+++
Sbjct: 60 AEPELASEYKIMSVPTLLLFKHGEVVEK 87


>gi|282897039|ref|ZP_06305041.1| Thioredoxin [Raphidiopsis brookii D9]
 gi|281197691|gb|EFA72585.1| Thioredoxin [Raphidiopsis brookii D9]
          Length = 111

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +AL+V   SF  EV++   PV+VDFWA WC PC  ++P++D+IA +   ++K+ K++ +E
Sbjct: 3  AALQVTDASFKQEVIDSDIPVLVDFWAPWCGPCRMVAPVVDEIATQYEGQLKVVKMNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          + +++++Y I SIPTL++FK G+ +D M+ GA  +S +
Sbjct: 63 NPDVASKYGIRSIPTLMIFKGGQKVD-MVVGAVPKSTL 99


>gi|125972881|ref|YP_001036791.1| thioredoxin [Clostridium thermocellum ATCC 27405]
 gi|256006001|ref|ZP_05430940.1| thioredoxin [Clostridium thermocellum DSM 2360]
 gi|281417080|ref|ZP_06248100.1| thioredoxin [Clostridium thermocellum JW20]
 gi|125713106|gb|ABN51598.1| thioredoxin [Clostridium thermocellum ATCC 27405]
 gi|255990024|gb|EEU00167.1| thioredoxin [Clostridium thermocellum DSM 2360]
 gi|281408482|gb|EFB38740.1| thioredoxin [Clostridium thermocellum JW20]
 gi|316940881|gb|ADU74915.1| thioredoxin [Clostridium thermocellum DSM 1313]
          Length = 109

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 69/91 (75%), Gaps = 1/91 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F+ EVL     V+VDFWA WC PC  +SPIID++A+E   + K+ KL+++   E++ +
Sbjct: 12  ENFEQEVLNSDKVVMVDFWAPWCGPCRAVSPIIDELAEEYDGRAKVAKLNVDSEGEVTEK 71

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           ++I +IPT+++FK+G+V+++++ GA S++++
Sbjct: 72  FRIMNIPTIMVFKNGEVVEKLI-GARSKTEL 101


>gi|307132325|ref|YP_003884341.1| thioredoxin 2 [Dickeya dadantii 3937]
 gi|306529854|gb|ADM99784.1| thioredoxin 2 [Dickeya dadantii 3937]
          Length = 141

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PCV  +P+ + +ADE   K++  K++ E    +S R++I SIPT++LF
Sbjct: 56  PVVVDFWAPWCGPCVNFAPVFESVADENGGKIRFIKVNTEAEPGLSARFRIRSIPTIMLF 115

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K GKV+D M+ GA  ++    W+
Sbjct: 116 KHGKVVD-MLNGAMPKAPFESWL 137


>gi|157144414|ref|YP_001451733.1| hypothetical protein CKO_00123 [Citrobacter koseri ATCC BAA-895]
 gi|157081619|gb|ABV11297.1| hypothetical protein CKO_00123 [Citrobacter koseri ATCC BAA-895]
          Length = 124

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 27  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 86

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 87  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 119


>gi|149241898|pdb|2H76|A Chain A, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal
           (P61) Space Group
 gi|149241899|pdb|2H76|B Chain B, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 66/95 (69%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           +SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +
Sbjct: 10  ESFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPK 69

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 70  YGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|99082687|ref|YP_614841.1| thioredoxin [Ruegeria sp. TM1040]
 gi|259417496|ref|ZP_05741415.1| thioredoxin [Silicibacter sp. TrichCH4B]
 gi|99038967|gb|ABF65579.1| thioredoxin [Ruegeria sp. TM1040]
 gi|259346402|gb|EEW58216.1| thioredoxin [Silicibacter sp. TrichCH4B]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A E  DKVKI K+D++
Sbjct: 1   MSTVAVTDATFDAEVKNSDVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI
Sbjct: 61  SNPNAAAAMGVRGIPALFVFKDGQVVSNRA-GAAPKAALKSWI 102


>gi|226940610|ref|YP_002795684.1| TrxA [Laribacter hongkongensis HLHK9]
 gi|226715537|gb|ACO74675.1| TrxA [Laribacter hongkongensis HLHK9]
          Length = 109

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ EVL+   PV+VD+WA WC PC  ++PI+D++A E   K+K+ KL+I+++ 
Sbjct: 7   VHVTDASFEEEVLKAQGPVLVDYWAEWCGPCKMIAPILDEVAREYDGKLKVAKLNIDQNE 66

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               ++ I  IPTL++FKDG V+   + GA ++S +  +I S +
Sbjct: 67  ATPPKFGIRGIPTLMIFKDGNVVATKV-GALAKSQLAAFIDSNI 109


>gi|26250519|ref|NP_756559.1| thioredoxin [Escherichia coli CFT073]
 gi|91213301|ref|YP_543287.1| thioredoxin [Escherichia coli UTI89]
 gi|110644108|ref|YP_671838.1| thioredoxin [Escherichia coli 536]
 gi|110807529|ref|YP_691049.1| thioredoxin [Shigella flexneri 5 str. 8401]
 gi|26110949|gb|AAN83133.1|AE016769_248 Thioredoxin 1 [Escherichia coli CFT073]
 gi|68304124|gb|AAY89720.1| TrxA [Escherichia coli LW1655F+]
 gi|91074875|gb|ABE09756.1| thioredoxin 1 [Escherichia coli UTI89]
 gi|110345700|gb|ABG71937.1| thioredoxin 1 [Escherichia coli 536]
 gi|110617077|gb|ABF05744.1| thioredoxin 1 [Shigella flexneri 5 str. 8401]
 gi|222035483|emb|CAP78228.1| Thioredoxin 1 [Escherichia coli LF82]
 gi|281603171|gb|ADA76155.1| Thioredoxin 1 [Shigella flexneri 2002017]
          Length = 144

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 47  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 106

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 107 GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 139


>gi|220924864|ref|YP_002500166.1| thioredoxin [Methylobacterium nodulans ORS 2060]
 gi|219949471|gb|ACL59863.1| thioredoxin [Methylobacterium nodulans ORS 2060]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   SF  +VLE S PVVV FWA  C  C  + P +++I+ E+  +VKI KL+++
Sbjct: 1   MPTVMVTDASFKQDVLEASEPVVVVFWAEGCVSCQAIGPALEEISSEMQGRVKIAKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I + Y I+ +PTL++FKDGK++ +   GA S+  ++ WI S
Sbjct: 61  ENPGIVSEYGIAGVPTLMIFKDGKLVSQKF-GALSKGALLRWIQS 104


>gi|115442413|ref|NP_001045486.1| Os01g0963400 [Oryza sativa Japonica Group]
 gi|113535017|dbj|BAF07400.1| Os01g0963400 [Oryza sativa Japonica Group]
          Length = 122

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           + A K    SFD  + +   PV+VDF+A+WC PC  + PI+ +++++L DK+++ K+D E
Sbjct: 13  VQAKKQTFSSFDELLEKSEKPVLVDFYATWCGPCQYMVPILQEVSEKLGDKIQVVKIDTE 72

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + + I+ RYQI ++PT I+FK+GK   R   GA   + +I+ I S
Sbjct: 73  KYTSIANRYQIEALPTFIIFKNGKPCHRFE-GALPANQLIQQIES 116


>gi|332994629|gb|AEF04684.1| thioredoxin [Alteromonas sp. SN2]
          Length = 108

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 65/93 (69%), Gaps = 1/93 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F+++V+    PV+VDFWA WC PC  ++PI++++A+E   K+ + KL+++E++E   +Y 
Sbjct: 13  FEADVINAEGPVLVDFWAEWCGPCKMIAPILEEVANEFEGKLTVGKLNVDENNETPPKYG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 73  IRGIPTLLLFKNGNVAATKV-GALSKTQLAEFL 104


>gi|332830560|gb|EGK03181.1| thioredoxin [Dysgonomonas gadei ATCC BAA-286]
          Length = 105

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 73/101 (72%), Gaps = 2/101 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++    F+ +VL+   P+V+DFWA WC PC  + PI++++A E ADKV I K+D++ +
Sbjct: 2   ALEITDAGFE-DVLKSDKPLVIDFWAEWCGPCRMVGPIVEELAAEYADKVTIGKVDVDNN 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +I+++Y I +IPT++  K+G+V+D+ + GA+ ++ ++E I
Sbjct: 61  DDITSKYGIRNIPTILFIKNGEVVDKQV-GAAQKAVLVEKI 100


>gi|301064401|ref|ZP_07204826.1| thioredoxin [delta proteobacterium NaphS2]
 gi|300441483|gb|EFK05823.1| thioredoxin [delta proteobacterium NaphS2]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L+V    F+ E+++   PV+VDFWA WC PC  + P ++++A E   KVKI K+D++ + 
Sbjct: 5   LQVTDADFEEEIIKSELPVMVDFWAEWCGPCKIVGPTVEELAKEYEGKVKIAKMDVDSNR 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E  T++ I +IPTLILFKDG+V   ++ GA  +S + E
Sbjct: 65  ETPTKFGIRNIPTLILFKDGEVFQTIV-GAHPKSHLEE 101


>gi|296271528|ref|YP_003654160.1| thioredoxin [Thermobispora bispora DSM 43833]
 gi|296094315|gb|ADG90267.1| thioredoxin [Thermobispora bispora DSM 43833]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 68/98 (69%), Gaps = 2/98 (2%)

Query: 1  MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
          M A+K V   +F  EVL+   PV+VDFWA WC PC +++PI+++IA+E ADK+ + K++I
Sbjct: 1  MGAIKEVTDATFQDEVLKSDKPVLVDFWAPWCGPCRQIAPILEEIANEYADKLTVVKMNI 60

Query: 60 EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          +E+ E    Y +  IPTL ++++G+V+ R + GA  +S
Sbjct: 61 DENMETPRNYGVLQIPTLNVYRNGEVV-RQIIGAKPKS 97


>gi|282901325|ref|ZP_06309251.1| Thioredoxin [Cylindrospermopsis raciborskii CS-505]
 gi|281193820|gb|EFA68791.1| Thioredoxin [Cylindrospermopsis raciborskii CS-505]
          Length = 112

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 74/107 (69%), Gaps = 4/107 (3%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +AL+V   SF+ EV++   PV+VDFWA WC PC  ++P++++IA + A K+K+ K++ +E
Sbjct: 3   AALEVTDASFEQEVIDSPIPVLVDFWAPWCGPCRMVAPVVEEIATQYAGKLKVVKINTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGA---SSQSDIIEWILS 105
           +  ++++Y I SIPTLI+FK+G  +   + GA   S+ S  +E IL+
Sbjct: 63  NPGVASKYGIRSIPTLIVFKEGVKVGLHV-GAVPKSTLSKTVEEILT 108


>gi|212710199|ref|ZP_03318327.1| hypothetical protein PROVALCAL_01258 [Providencia alcalifaciens DSM
           30120]
 gi|212687198|gb|EEB46726.1| hypothetical protein PROVALCAL_01258 [Providencia alcalifaciens DSM
           30120]
          Length = 122

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+S+VL  ++P++VDFWA WC PC  ++PI+D++A+E   KV I KL+I+ +   + ++
Sbjct: 26  SFESDVLNANSPILVDFWAEWCGPCKMIAPILDEVAEEYTGKVTIAKLNIDNNPATAPKF 85

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 86  GIRGIPTLLLFKNGSVAATKV-GALSKTQLKEFL 118


>gi|840745|emb|CAA55398.1| thioredoxin m [Chlamydomonas reinhardtii]
          Length = 128

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V+  +F + VLE S PV+VDFWA WC PC  ++P++D+IA E  DK+K  KL+ +ES
Sbjct: 24  AGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDES 83

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             +++ Y I SIPT+++FK GK  + ++ GA  ++ I++ +
Sbjct: 84  PNVASEYGIRSIPTIMVFKGGKKCETII-GAVPKATIVQTV 123


>gi|270158327|ref|ZP_06186984.1| thioredoxin [Legionella longbeachae D-4968]
 gi|289163427|ref|YP_003453565.1| thioredoxin [Legionella longbeachae NSW150]
 gi|269990352|gb|EEZ96606.1| thioredoxin [Legionella longbeachae D-4968]
 gi|288856600|emb|CBJ10407.1| putative thioredoxin [Legionella longbeachae NSW150]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ EV++ + PV+VDFWA WC PC  L+PI++++A   +++V   K++I+E+ +   +Y
Sbjct: 12  SFEQEVMQSNKPVLVDFWAEWCGPCRALTPILEEVAGTHSEQVTFAKINIDENPQTPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + SIPTLILFK+G+V    M G  S+S +  ++ S V
Sbjct: 72  GVMSIPTLILFKNGQVEAVKM-GLLSKSQLSAFVESHV 108


>gi|57899183|dbj|BAD87235.1| thioredoxin M-like [Oryza sativa Japonica Group]
          Length = 123

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           + A K    SFD  + +   PV+VDF+A+WC PC  + PI+ +++++L DK+++ K+D E
Sbjct: 14  VQAKKQTFSSFDELLEKSEKPVLVDFYATWCGPCQYMVPILQEVSEKLGDKIQVVKIDTE 73

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + + I+ RYQI ++PT I+FK+GK   R   GA   + +I+ I S
Sbjct: 74  KYTSIANRYQIEALPTFIIFKNGKPCHR-FEGALPANQLIQQIES 117


>gi|86148823|ref|ZP_01067089.1| thioredoxin 2 [Vibrio sp. MED222]
 gi|85833387|gb|EAQ51579.1| thioredoxin 2 [Vibrio sp. MED222]
          Length = 144

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 58/89 (65%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           +L  S PVVVDFWA+WC PCV  +P+  D+A E +  ++  K+D E   +++  YQI SI
Sbjct: 51  ILNSSQPVVVDFWATWCNPCVGFAPVFSDVAKERSGDIRFVKIDTEAQQQLAAMYQIRSI 110

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           PT+++FKDGK +D +  GA  +    +W+
Sbjct: 111 PTVMVFKDGKRVDTIN-GALPKGQFDQWL 138


>gi|313672335|ref|YP_004050446.1| thioredoxin [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939091|gb|ADR18283.1| thioredoxin [Calditerrivibrio nitroreducens DSM 19672]
          Length = 105

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL     +F SEVL    PV+VDFWA WC PC  L+P ID +  E   K KI K++++E+
Sbjct: 2   ALVFTESNFQSEVLSSDVPVLVDFWAVWCGPCKMLAPTIDALTAEFEGKAKIGKVNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
             ++ +Y I SIPT+++FK+GKV+++ + G   +   IE
Sbjct: 62  QHLAAQYGIMSIPTVMIFKNGKVVEQFI-GVQPKGVYIE 99


>gi|229918330|ref|YP_002886976.1| thioredoxin [Exiguobacterium sp. AT1b]
 gi|229469759|gb|ACQ71531.1| thioredoxin [Exiguobacterium sp. AT1b]
          Length = 104

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+     T+SF+ +V E    V+VDFWA+WC PC  ++P+++++  E+ D+V+I KLD++
Sbjct: 1   MAIKHATTQSFEQDVKE--GVVLVDFWATWCGPCRMIAPVLEELDQEMGDQVQIVKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++  +QI SIPTL++FKDG+ + + M G   +  + E+I +
Sbjct: 59  ENPEVAGAFQIQSIPTLMMFKDGEPVSKTM-GFQPKEALKEFIAT 102


>gi|24372002|ref|NP_716044.1| thioredoxin 1 [Shewanella oneidensis MR-1]
 gi|113968754|ref|YP_732547.1| thioredoxin [Shewanella sp. MR-4]
 gi|114049102|ref|YP_739652.1| thioredoxin [Shewanella sp. MR-7]
 gi|117918866|ref|YP_868058.1| thioredoxin [Shewanella sp. ANA-3]
 gi|24345863|gb|AAN53489.1|AE015489_2 thioredoxin 1 [Shewanella oneidensis MR-1]
 gi|113883438|gb|ABI37490.1| thioredoxin [Shewanella sp. MR-4]
 gi|113890544|gb|ABI44595.1| thioredoxin [Shewanella sp. MR-7]
 gi|117611198|gb|ABK46652.1| thioredoxin [Shewanella sp. ANA-3]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI+DD+A+E A +V I KL++++++    +Y
Sbjct: 12  SFENDVLKADLPVLVDFWAEWCGPCKMIAPILDDVAEEYAGRVTIAKLNVDQNNVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTL+LFK+G++    + GA S++ + E+I +++
Sbjct: 72  GVRGIPTLLLFKNGELAATKV-GALSKTQLKEFIDAQI 108


>gi|312142760|ref|YP_003994206.1| thioredoxin [Halanaerobium sp. 'sapolanicus']
 gi|311903411|gb|ADQ13852.1| thioredoxin [Halanaerobium sp. 'sapolanicus']
          Length = 106

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 65/89 (73%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           A++V   +F  EV+    PVVVDFWA WC PC  ++P++++IA E  D +K+ KL+++E
Sbjct: 3  KAIEVTDVTFKDEVIGADKPVVVDFWAEWCGPCKMVAPVVEEIAQEYDDTIKVAKLNVDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPT+++F++G+V D+++
Sbjct: 63 NQAVASQYGIMSIPTMLVFENGEVKDKLV 91


>gi|260574438|ref|ZP_05842442.1| thioredoxin [Rhodobacter sp. SW2]
 gi|259023334|gb|EEW26626.1| thioredoxin [Rhodobacter sp. SW2]
          Length = 106

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV + + PVVVDFWA WC PC ++ P ++++A + A +VKI K++++
Sbjct: 1   MTTVAVTDATFDAEVRKSALPVVVDFWAEWCGPCRQIGPALEELAAQYAGRVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E      +  IP L LFKDG+V+   + GA+ ++ +  WI
Sbjct: 61  ENPESPALLGVRGIPALFLFKDGQVVSNKI-GAAPKAALETWI 102


>gi|328680675|gb|AEB32456.1| tagged TSC2-39 [Synthetic construct]
          Length = 204

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|238759746|ref|ZP_04620905.1| Thioredoxin 2 [Yersinia aldovae ATCC 35236]
 gi|238702072|gb|EEP94630.1| Thioredoxin 2 [Yersinia aldovae ATCC 35236]
          Length = 138

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA+WC PC   +PI +D A E A KV+  K+D 
Sbjct: 25  FDGEVINATAETLDKLLQDDLPVVIDFWATWCGPCRSFAPIFEDAATERAGKVRFVKIDT 84

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R++I SIPT++L+++GK++D M+ GA  ++    W+
Sbjct: 85  EAEPELSARFRIRSIPTIMLYRNGKMVD-MLSGALPKAPFDHWL 127


>gi|219855443|ref|YP_002472565.1| hypothetical protein CKR_2100 [Clostridium kluyveri NBRC 12016]
 gi|219569167|dbj|BAH07151.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 111

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 65/85 (76%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          +++  F+  VL  S  V+VDF+A+WC PC  ++P+++++++E+  KV++ K+D++ S+E+
Sbjct: 12 INSSEFEGNVLNSSETVLVDFFATWCGPCKMIAPVLEELSEEMKGKVEMFKVDVDRSAEL 71

Query: 66 STRYQISSIPTLILFKDGKVIDRMM 90
          + +Y I  +PTL++FKDGK +DR++
Sbjct: 72 AQKYGIQGVPTLMIFKDGKSVDRIV 96


>gi|18241|emb|CAA44209.1| thioredoxin Ch2 [Chlamydomonas reinhardtii]
          Length = 106

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V+  +F + VLE S PV+VDFWA WC PC  ++P++D+IA E  DK+K  KL+ +ES
Sbjct: 2   AGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDES 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
             +++ Y I SIPT+++FK GK  + ++ GA  ++ I++
Sbjct: 62  PNVASEYGIRSIPTIMVFKGGKKCETII-GAVPKATIVQ 99


>gi|332654175|ref|ZP_08419919.1| thioredoxin [Ruminococcaceae bacterium D16]
 gi|332517261|gb|EGJ46866.1| thioredoxin [Ruminococcaceae bacterium D16]
          Length = 105

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 5/100 (5%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+    + +SFD  + E    ++VDFWA+WC PC  L P+I+ +A +   K +I K+D++
Sbjct: 1  MALQHYNKESFDKSLNE-GKLMMVDFWANWCGPCRMLGPVIEQLAGQYEGKAEIGKVDVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR---MMP-GASSQ 96
          E  E++ RY + SIPT+I FKDGK IDR   +MP GA +Q
Sbjct: 60 EQGELAMRYGVMSIPTVIFFKDGKEIDRKVGVMPAGAFTQ 99


>gi|253997392|ref|YP_003049456.1| thioredoxin [Methylotenera mobilis JLW8]
 gi|253984071|gb|ACT48929.1| thioredoxin [Methylotenera mobilis JLW8]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +VL+   PV+VD+WA WC PC  ++PI+D+I+ E A ++K+ KL+I+++ +   +Y
Sbjct: 12  SFEQDVLQSQIPVLVDYWAEWCGPCKMIAPILDEISKEYAGRIKVAKLNIDDNQQTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G V +    GA S+S +  +I S +
Sbjct: 72  GIRGIPTLMLFKNGNV-EATKVGALSKSQLTAFIDSNI 108


>gi|87302139|ref|ZP_01084964.1| Thioredoxin [Synechococcus sp. WH 5701]
 gi|87283064|gb|EAQ75020.1| Thioredoxin [Synechococcus sp. WH 5701]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+IA E   K+K+ KL+ +E
Sbjct: 3  SATAVTDASFELDVLKSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFEGKLKVYKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMIFKGGQKVDTVV 91


>gi|150024368|ref|YP_001295194.1| thioredoxin family protein [Flavobacterium psychrophilum
          JIP02/86]
 gi|149770909|emb|CAL42374.1| Thioredoxin family protein [Flavobacterium psychrophilum
          JIP02/86]
          Length = 105

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 64/95 (67%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL +   +F+  VL+ S PV+VDFWA+WC PC  + P+I++IA E   K  + K+D++ +
Sbjct: 2  ALTITDATFEEVVLKSSQPVLVDFWAAWCGPCRMVGPVIEEIATEFEGKAIVGKVDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
           E + +Y + +IPT+++F++G+V+ R +  A  Q+
Sbjct: 62 QEFAAKYGVRNIPTVLVFQNGEVVGRQVGVAPKQT 96


>gi|149241880|pdb|2H70|A Chain A, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal
           (P61) Space Group
 gi|149241881|pdb|2H70|B Chain B, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|149241892|pdb|2H74|A Chain A, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal
           (P61) Space Group
 gi|149241893|pdb|2H74|B Chain B, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|113476827|ref|YP_722888.1| thioredoxin [Trichodesmium erythraeum IMS101]
 gi|110167875|gb|ABG52415.1| thioredoxin [Trichodesmium erythraeum IMS101]
          Length = 125

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 60/84 (71%), Gaps = 1/84 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD +VL    PV+VDFWA WC PC  ++P++ +IA +  DKVK+ KL+ +E+   +++Y
Sbjct: 20  SFDKDVLHSDIPVLVDFWAPWCGPCKMVAPVVSEIAQQFKDKVKVVKLNTDENPNTASKY 79

Query: 70  QISSIPTLILFKDGKVIDRMMPGA 93
            I SIPTL++FK G+ +D M+ GA
Sbjct: 80  GIRSIPTLMIFKGGQRVD-MVVGA 102


>gi|237727905|ref|ZP_04558386.1| thioredoxin 1 [Citrobacter sp. 30_2]
 gi|226910354|gb|EEH96272.1| thioredoxin 1 [Citrobacter sp. 30_2]
          Length = 119

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 22  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 81

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 82  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 114


>gi|157144485|ref|YP_001451804.1| thioredoxin 2 [Citrobacter koseri ATCC BAA-895]
 gi|157081690|gb|ABV11368.1| hypothetical protein CKO_00202 [Citrobacter koseri ATCC BAA-895]
          Length = 139

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVVVDFWA WC PC   +PI +DIA+E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVVDFWAPWCGPCRNFAPIFEDIAEERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIPT+++FK+G+VID M+ GA  ++    W+
Sbjct: 93  EAERELSARFGIRSIPTIMIFKNGEVID-MLNGAVPKAPFDSWL 135


>gi|114776545|ref|ZP_01451590.1| thioredoxin [Mariprofundus ferrooxydans PV-1]
 gi|114553375|gb|EAU55773.1| thioredoxin [Mariprofundus ferrooxydans PV-1]
          Length = 110

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V  +SFD++VL+ S PV+VDFWA WC PC +++PI+D++A E   +V I K++I+++ 
Sbjct: 7   IHVSDESFDADVLKASGPVLVDFWAPWCGPCKQIAPILDEVAGEKQGQVTIAKINIDDNP 66

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               +Y +  IPTL+LF  G V    + GA +++ + E+I
Sbjct: 67  NTPGKYGVRGIPTLMLFSGGNVQGTKV-GAVNKAKLGEFI 105


>gi|19703445|ref|NP_603007.1| thioredoxin [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|19713521|gb|AAL94306.1| Thioredoxin [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
          Length = 103

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 66/88 (75%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K   ++FD+EVL+ S  VVVDF A+WC PC  L PI+D+I +E   K KI K+DI+
Sbjct: 1  MAIVKGTKENFDAEVLKASGVVVVDFGANWCGPCKSLVPILDEIVEEDPSK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ +Y+I S+PTL++F++G++ID+
Sbjct: 60 EQEELAAQYKIMSVPTLLVFRNGEIIDK 87


>gi|220904469|ref|YP_002479781.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans
          str. ATCC 27774]
 gi|219868768|gb|ACL49103.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans
          str. ATCC 27774]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 68/95 (71%), Gaps = 1/95 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A +V   +F+S VL+   PV++DFWA WC PC  + PIID++A E A KV+I K++++E+
Sbjct: 2  AEQVTDATFESVVLKSDLPVLLDFWAPWCGPCRAVGPIIDELATEYAGKVRIVKMNVDEN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
              T++ I +IPTL+LFK+G+ ++++  GA +++
Sbjct: 62 PATPTKFGIRAIPTLVLFKNGETVEQIT-GAVTKA 95


>gi|94971986|ref|YP_594026.1| thioredoxin [Deinococcus geothermalis DSM 11300]
 gi|94554037|gb|ABF43952.1| thioredoxin [Deinococcus geothermalis DSM 11300]
          Length = 141

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 64/84 (76%), Gaps = 1/84 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   +FD+EV + + PV+VDFWA+WC PC  ++P+++D+A E A K+K+ KLD++++ 
Sbjct: 38  LNVSDATFDTEV-KAAVPVLVDFWATWCGPCRVVAPVLEDLAREHAGKLKVVKLDVDQNP 96

Query: 64  EISTRYQISSIPTLILFKDGKVID 87
            ++ RY + SIPTL+LF++G+ ++
Sbjct: 97  AVAGRYSVRSIPTLMLFQEGRPLE 120


>gi|300864796|ref|ZP_07109646.1| thioredoxin [Oscillatoria sp. PCC 6506]
 gi|300337200|emb|CBN54794.1| thioredoxin [Oscillatoria sp. PCC 6506]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A +V   +F  EVLE   PV+VDFWA WC PC  ++P++D+IA +   +VK+ K++ +E
Sbjct: 3  AAAQVTDSTFKQEVLESEVPVLVDFWAPWCGPCRMVAPVVDEIAQQYDGQVKVVKVNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +  ++++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPNVASQYGIRSIPTLMIFKAGQRVD-MVVGAVPKTTL 99


>gi|254430799|ref|ZP_05044502.1| thioredoxin [Cyanobium sp. PCC 7001]
 gi|197625252|gb|EDY37811.1| thioredoxin [Cyanobium sp. PCC 7001]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+IA E   ++K+ KL+ +E
Sbjct: 3  SAAAVTDASFEQDVLKSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFEGQIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMVFKGGQKVDTVV 91


>gi|187928125|ref|YP_001898612.1| thioredoxin [Ralstonia pickettii 12J]
 gi|241662728|ref|YP_002981088.1| thioredoxin [Ralstonia pickettii 12D]
 gi|309782349|ref|ZP_07677075.1| thioredoxin [Ralstonia sp. 5_7_47FAA]
 gi|187725015|gb|ACD26180.1| thioredoxin [Ralstonia pickettii 12J]
 gi|240864755|gb|ACS62416.1| thioredoxin [Ralstonia pickettii 12D]
 gi|308918885|gb|EFP64556.1| thioredoxin [Ralstonia sp. 5_7_47FAA]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+++VL+   PV+VDFWA WC PC  ++PI+D+++ +  +KV+I K++++E+  +
Sbjct: 8   VSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGEKVQIAKINVDENQGV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ I  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 68  PAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|291084661|ref|ZP_06540721.2| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           AG3]
          Length = 113

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 16  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 75

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 76  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 108


>gi|229528375|ref|ZP_04417766.1| thioredoxin 2 [Vibrio cholerae 12129(1)]
 gi|229334737|gb|EEO00223.1| thioredoxin 2 [Vibrio cholerae 12129(1)]
          Length = 144

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T++  S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E    ++ 
Sbjct: 44  TEANFSALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEAQQNLAA 103

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +QI SIPT+++FK+G+ ID M+ GA  +S   +W+
Sbjct: 104 HFQIRSIPTIMVFKNGQRID-MINGALPKSQFNQWL 138


>gi|33861617|ref|NP_893178.1| thioredoxin [Prochlorococcus marinus subsp. pastoris str.
          CCMP1986]
 gi|33634194|emb|CAE19520.1| Thioredoxin [Prochlorococcus marinus subsp. pastoris str.
          CCMP1986]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 64/89 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SFD EVL+ + PV+VDFWA WC PC  ++P++++I+ +   K+K+ KL+ +E
Sbjct: 3  SAPAVTDSSFDKEVLQSNLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMIFKGGQKVDTVV 91


>gi|126666617|ref|ZP_01737595.1| thioredoxin [Marinobacter sp. ELB17]
 gi|126629005|gb|EAZ99624.1| thioredoxin [Marinobacter sp. ELB17]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +VL+   PV+VD+WA WC PC  ++P++++IA+E A K+K+ KL+I+E+ +   ++
Sbjct: 12  SFEQDVLQSDVPVLVDYWAEWCGPCKMIAPVLEEIAEEYAGKLKVCKLNIDENEQTPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G V D    GA S+S +  ++ S +
Sbjct: 72  NIRGIPTLMLFKNGNV-DATKVGALSKSQLAAFLDSNL 108


>gi|73536038|pdb|1ZZY|A Chain A, Crystal Structure Of Thioredoxin Mutant L7v
 gi|73536039|pdb|1ZZY|B Chain B, Crystal Structure Of Thioredoxin Mutant L7v
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++ 
Sbjct: 5   IHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             + +Y I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 65  GTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|256021477|ref|ZP_05435342.1| thioredoxin [Shigella sp. D9]
 gi|307313642|ref|ZP_07593262.1| thioredoxin [Escherichia coli W]
 gi|306906623|gb|EFN37135.1| thioredoxin [Escherichia coli W]
 gi|315063077|gb|ADT77404.1| thioredoxin 1 [Escherichia coli W]
 gi|323380860|gb|ADX53128.1| thioredoxin [Escherichia coli KO11]
          Length = 109

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|153955001|ref|YP_001395766.1| hypothetical protein CKL_2383 [Clostridium kluyveri DSM 555]
 gi|146347859|gb|EDK34395.1| Hypothetical protein CKL_2383 [Clostridium kluyveri DSM 555]
          Length = 104

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 65/85 (76%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          +++  F+  VL  S  V+VDF+A+WC PC  ++P+++++++E+  KV++ K+D++ S+E+
Sbjct: 5  INSSEFEGNVLNSSETVLVDFFATWCGPCKMIAPVLEELSEEMKGKVEMFKVDVDRSAEL 64

Query: 66 STRYQISSIPTLILFKDGKVIDRMM 90
          + +Y I  +PTL++FKDGK +DR++
Sbjct: 65 AQKYGIQGVPTLMIFKDGKSVDRIV 89


>gi|86743212|ref|YP_483612.1| thioredoxin [Frankia sp. CcI3]
 gi|86570074|gb|ABD13883.1| thioredoxin [Frankia sp. CcI3]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S   V   +F +EVLE   PV+VDFWA WC PC  ++P++++IA E  +K+++ KL+I+E
Sbjct: 4   STTPVTDSTFVTEVLESDKPVLVDFWAEWCGPCKMVAPVLEEIAKEHGEKLRVVKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + E +  YQI SIPT+ +F  G VID+ + GA  ++ ++
Sbjct: 64  NPETARNYQIMSIPTMAVFVKG-VIDKSIVGAKPKAALL 101


>gi|194333752|ref|YP_002015612.1| thioredoxin [Prosthecochloris aestuarii DSM 271]
 gi|194311570|gb|ACF45965.1| thioredoxin [Prosthecochloris aestuarii DSM 271]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L    ++F +EVL+     +VDFWA+WC PC  L P+I+D+A +   K  I K++++E+ 
Sbjct: 5   LTATDQNFKAEVLDSGKVALVDFWAAWCGPCQMLGPVIEDLAGDYEGKAVIAKVNVDENP 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I+  Y I SIPT+++FK+G+++D+M+ GA  ++ I E I
Sbjct: 65  NIAAEYGIRSIPTMLIFKNGEIVDQMV-GAMPKNMIAEKI 103


>gi|16762214|ref|NP_457831.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|16767191|ref|NP_462806.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29143703|ref|NP_807045.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56415775|ref|YP_152850.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|67005950|ref|NP_418228.2| thioredoxin 1 [Escherichia coli str. K-12 substr. MG1655]
 gi|89110236|ref|AP_004016.1| thioredoxin 1 [Escherichia coli str. K-12 substr. W3110]
 gi|157158635|ref|YP_001465262.1| thioredoxin [Escherichia coli E24377A]
 gi|157163254|ref|YP_001460572.1| thioredoxin [Escherichia coli HS]
 gi|161617033|ref|YP_001590998.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           B str. SPB7]
 gi|167553315|ref|ZP_02347065.1| thioredoxin [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167994611|ref|ZP_02575702.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168234236|ref|ZP_02659294.1| thioredoxin [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168238372|ref|ZP_02663430.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168244967|ref|ZP_02669899.1| thioredoxin [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168263193|ref|ZP_02685166.1| thioredoxin [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168467668|ref|ZP_02701505.1| thioredoxin [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168822970|ref|ZP_02834970.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|170022192|ref|YP_001727146.1| thioredoxin [Escherichia coli ATCC 8739]
 gi|170083268|ref|YP_001732588.1| thioredoxin 1 [Escherichia coli str. K-12 substr. DH10B]
 gi|170680473|ref|YP_001746100.1| thioredoxin [Escherichia coli SMS-3-5]
 gi|170769809|ref|ZP_02904262.1| thioredoxin [Escherichia albertii TW07627]
 gi|187732135|ref|YP_001882394.1| thioredoxin [Shigella boydii CDC 3083-94]
 gi|187776114|ref|ZP_02800679.2| thioredoxin [Escherichia coli O157:H7 str. EC4196]
 gi|188025205|ref|ZP_02776760.2| thioredoxin [Escherichia coli O157:H7 str. EC4113]
 gi|188493841|ref|ZP_03001111.1| thioredoxin [Escherichia coli 53638]
 gi|189010248|ref|ZP_02805683.2| thioredoxin [Escherichia coli O157:H7 str. EC4076]
 gi|189401853|ref|ZP_02778681.2| thioredoxin [Escherichia coli O157:H7 str. EC4401]
 gi|189403076|ref|ZP_02793065.2| thioredoxin [Escherichia coli O157:H7 str. EC4486]
 gi|189404400|ref|ZP_02789149.2| thioredoxin [Escherichia coli O157:H7 str. EC4501]
 gi|189404879|ref|ZP_02811622.2| thioredoxin [Escherichia coli O157:H7 str. EC869]
 gi|189406048|ref|ZP_02826004.2| thioredoxin [Escherichia coli O157:H7 str. EC508]
 gi|191166127|ref|ZP_03027962.1| thioredoxin [Escherichia coli B7A]
 gi|191174370|ref|ZP_03035875.1| thioredoxin [Escherichia coli F11]
 gi|191174436|ref|ZP_03035938.1| thioredoxin [Escherichia coli F11]
 gi|193066143|ref|ZP_03047198.1| thioredoxin [Escherichia coli E22]
 gi|193071060|ref|ZP_03051987.1| thioredoxin [Escherichia coli E110019]
 gi|194429787|ref|ZP_03062302.1| thioredoxin [Escherichia coli B171]
 gi|194434620|ref|ZP_03066876.1| thioredoxin [Shigella dysenteriae 1012]
 gi|194438595|ref|ZP_03070683.1| thioredoxin [Escherichia coli 101-1]
 gi|194444873|ref|YP_002043153.1| thioredoxin [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194450695|ref|YP_002047936.1| thioredoxin [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194468829|ref|ZP_03074813.1| thioredoxin [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194735451|ref|YP_002116851.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195938069|ref|ZP_03083451.1| thioredoxin [Escherichia coli O157:H7 str. EC4024]
 gi|197249250|ref|YP_002148845.1| thioredoxin [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197264711|ref|ZP_03164785.1| thioredoxin [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197364705|ref|YP_002144342.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|198242687|ref|YP_002217853.1| thioredoxin [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|200387433|ref|ZP_03214045.1| thioredoxin [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204930358|ref|ZP_03221335.1| thioredoxin [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205354514|ref|YP_002228315.1| thioredoxin [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|207859127|ref|YP_002245778.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|208809464|ref|ZP_03251801.1| thioredoxin [Escherichia coli O157:H7 str. EC4206]
 gi|208814416|ref|ZP_03255745.1| thioredoxin [Escherichia coli O157:H7 str. EC4045]
 gi|208819175|ref|ZP_03259495.1| thioredoxin [Escherichia coli O157:H7 str. EC4042]
 gi|209396946|ref|YP_002273299.1| thioredoxin [Escherichia coli O157:H7 str. EC4115]
 gi|209921254|ref|YP_002295338.1| thioredoxin [Escherichia coli SE11]
 gi|213021586|ref|ZP_03336033.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           404ty]
 gi|213051686|ref|ZP_03344564.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E00-7866]
 gi|213423864|ref|ZP_03356844.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E01-6750]
 gi|213583146|ref|ZP_03364972.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|213612593|ref|ZP_03370419.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-2068]
 gi|213648368|ref|ZP_03378421.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           J185]
 gi|213856933|ref|ZP_03384173.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           M223]
 gi|215489109|ref|YP_002331540.1| thioredoxin [Escherichia coli O127:H6 str. E2348/69]
 gi|217324914|ref|ZP_03440998.1| thioredoxin [Escherichia coli O157:H7 str. TW14588]
 gi|218550994|ref|YP_002384785.1| thioredoxin [Escherichia fergusonii ATCC 35469]
 gi|218556343|ref|YP_002389257.1| thioredoxin [Escherichia coli IAI1]
 gi|218560847|ref|YP_002393760.1| thioredoxin [Escherichia coli S88]
 gi|218692060|ref|YP_002400272.1| thioredoxin [Escherichia coli ED1a]
 gi|218697498|ref|YP_002405165.1| thioredoxin [Escherichia coli 55989]
 gi|218701306|ref|YP_002408935.1| thioredoxin [Escherichia coli IAI39]
 gi|218707417|ref|YP_002414936.1| thioredoxin [Escherichia coli UMN026]
 gi|224585738|ref|YP_002639537.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|238902862|ref|YP_002928658.1| thioredoxin 1 [Escherichia coli BW2952]
 gi|238912925|ref|ZP_04656762.1| thioredoxin [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|253775594|ref|YP_003038425.1| thioredoxin [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163725|ref|YP_003046833.1| thioredoxin [Escherichia coli B str. REL606]
 gi|254795779|ref|YP_003080616.1| thioredoxin [Escherichia coli O157:H7 str. TW14359]
 gi|256026129|ref|ZP_05439994.1| thioredoxin [Escherichia sp. 4_1_40B]
 gi|260846443|ref|YP_003224221.1| thioredoxin 1 [Escherichia coli O103:H2 str. 12009]
 gi|260857813|ref|YP_003231704.1| thioredoxin 1 [Escherichia coli O26:H11 str. 11368]
 gi|260870506|ref|YP_003236908.1| thioredoxin 1 [Escherichia coli O111:H- str. 11128]
 gi|261225555|ref|ZP_05939836.1| thioredoxin [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255601|ref|ZP_05948134.1| thioredoxin [Escherichia coli O157:H7 str. FRIK966]
 gi|283834552|ref|ZP_06354293.1| thioredoxin [Citrobacter youngae ATCC 29220]
 gi|289825739|ref|ZP_06544907.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-3139]
 gi|293407411|ref|ZP_06651331.1| thioredoxin-1 [Escherichia coli FVEC1412]
 gi|297519964|ref|ZP_06938350.1| thioredoxin [Escherichia coli OP50]
 gi|298383151|ref|ZP_06992745.1| thioredoxin-1 [Escherichia coli FVEC1302]
 gi|301028993|ref|ZP_07192150.1| thioredoxin [Escherichia coli MS 196-1]
 gi|306815181|ref|ZP_07449334.1| thioredoxin [Escherichia coli NC101]
 gi|307140481|ref|ZP_07499837.1| thioredoxin [Escherichia coli H736]
 gi|309784493|ref|ZP_07679131.1| thioredoxin [Shigella dysenteriae 1617]
 gi|312969490|ref|ZP_07783692.1| thioredoxin [Escherichia coli 2362-75]
 gi|312971936|ref|ZP_07786110.1| thioredoxin [Escherichia coli 1827-70]
 gi|331660126|ref|ZP_08361062.1| thioredoxin [Escherichia coli TA206]
 gi|331665427|ref|ZP_08366326.1| thioredoxin [Escherichia coli TA143]
 gi|331670626|ref|ZP_08371463.1| thioredoxin [Escherichia coli TA271]
 gi|331685500|ref|ZP_08386084.1| thioredoxin [Escherichia coli H299]
 gi|76363560|sp|P0AA25|THIO_ECOLI RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|76363561|sp|P0AA28|THIO_SALTY RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|88942917|sp|P0AA27|THIO_ECO57 RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|88942918|sp|P0AA26|THIO_ECOL6 RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|88942919|sp|P0AA29|THIO_SALTI RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|88942920|sp|P0AA30|THIO_SHIFL RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|25282754|pir||AF0922 thioredoxin [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|49362|emb|CAA79851.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|147609|gb|AAA24533.1| thioredoxin (trxA) [Escherichia coli]
 gi|148066|gb|AAA24693.1| thioredoxin [Escherichia coli]
 gi|148068|gb|AAA24694.1| thioredoxin (trxA) [Escherichia coli]
 gi|217085|dbj|BAA00903.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|2852397|gb|AAC40210.1| Eschericia coli thioredoxin [Cloning vector pBIOTRX-BirA]
 gi|6960281|gb|AAF33471.1| 100% idendity with E. coli thioredoxin 1 (TRXA) (SP:P00274);
           contains similarity to Pfam family PF00085
           (Thioredoxin), score=185.9, E=9.3e-55, N=1 [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16422483|gb|AAL22765.1| thioredoxin 1 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16504518|emb|CAD09400.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29139338|gb|AAO70905.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56130032|gb|AAV79538.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|85676267|dbj|BAE77517.1| thioredoxin 1 [Escherichia coli str. K12 substr. W3110]
 gi|87082331|gb|AAC76786.2| thioredoxin 1 [Escherichia coli str. K-12 substr. MG1655]
 gi|157068934|gb|ABV08189.1| thioredoxin [Escherichia coli HS]
 gi|157080665|gb|ABV20373.1| thioredoxin [Escherichia coli E24377A]
 gi|161366397|gb|ABX70165.1| hypothetical protein SPAB_04861 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|169757120|gb|ACA79819.1| thioredoxin [Escherichia coli ATCC 8739]
 gi|169891103|gb|ACB04810.1| thioredoxin 1 [Escherichia coli str. K-12 substr. DH10B]
 gi|170121247|gb|EDS90178.1| thioredoxin [Escherichia albertii TW07627]
 gi|170518191|gb|ACB16369.1| thioredoxin [Escherichia coli SMS-3-5]
 gi|187429127|gb|ACD08401.1| thioredoxin [Shigella boydii CDC 3083-94]
 gi|187768816|gb|EDU32660.1| thioredoxin [Escherichia coli O157:H7 str. EC4196]
 gi|188014288|gb|EDU52410.1| thioredoxin [Escherichia coli O157:H7 str. EC4113]
 gi|188489040|gb|EDU64143.1| thioredoxin [Escherichia coli 53638]
 gi|189001583|gb|EDU70569.1| thioredoxin [Escherichia coli O157:H7 str. EC4076]
 gi|189359144|gb|EDU77563.1| thioredoxin [Escherichia coli O157:H7 str. EC4401]
 gi|189362599|gb|EDU81018.1| thioredoxin [Escherichia coli O157:H7 str. EC4486]
 gi|189365821|gb|EDU84237.1| thioredoxin [Escherichia coli O157:H7 str. EC4501]
 gi|189373365|gb|EDU91781.1| thioredoxin [Escherichia coli O157:H7 str. EC869]
 gi|189376807|gb|EDU95223.1| thioredoxin [Escherichia coli O157:H7 str. EC508]
 gi|190903903|gb|EDV63617.1| thioredoxin [Escherichia coli B7A]
 gi|190905291|gb|EDV64928.1| thioredoxin [Escherichia coli F11]
 gi|190905347|gb|EDV64981.1| thioredoxin [Escherichia coli F11]
 gi|192926240|gb|EDV80879.1| thioredoxin [Escherichia coli E22]
 gi|192955647|gb|EDV86123.1| thioredoxin [Escherichia coli E110019]
 gi|194403536|gb|ACF63758.1| thioredoxin [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194408999|gb|ACF69218.1| thioredoxin [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194412199|gb|EDX28506.1| thioredoxin [Escherichia coli B171]
 gi|194417139|gb|EDX33252.1| thioredoxin [Shigella dysenteriae 1012]
 gi|194422399|gb|EDX38398.1| thioredoxin [Escherichia coli 101-1]
 gi|194455193|gb|EDX44032.1| thioredoxin [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194710953|gb|ACF90174.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195629942|gb|EDX48602.1| thioredoxin [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197096182|emb|CAR61778.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|197212953|gb|ACH50350.1| thioredoxin [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197242966|gb|EDY25586.1| thioredoxin [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197288776|gb|EDY28151.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937203|gb|ACH74536.1| thioredoxin [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|199604531|gb|EDZ03076.1| thioredoxin [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204320762|gb|EDZ05964.1| thioredoxin [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205274295|emb|CAR39316.1| thioredoxin [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205322203|gb|EDZ10042.1| thioredoxin [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205327548|gb|EDZ14312.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205331812|gb|EDZ18576.1| thioredoxin [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205336242|gb|EDZ23006.1| thioredoxin [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205340698|gb|EDZ27462.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205348272|gb|EDZ34903.1| thioredoxin [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206710930|emb|CAR35296.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|208729265|gb|EDZ78866.1| thioredoxin [Escherichia coli O157:H7 str. EC4206]
 gi|208735693|gb|EDZ84380.1| thioredoxin [Escherichia coli O157:H7 str. EC4045]
 gi|208739298|gb|EDZ86980.1| thioredoxin [Escherichia coli O157:H7 str. EC4042]
 gi|209158346|gb|ACI35779.1| thioredoxin [Escherichia coli O157:H7 str. EC4115]
 gi|209914513|dbj|BAG79587.1| thioredoxin [Escherichia coli SE11]
 gi|215267181|emb|CAS11629.1| thioredoxin 1 [Escherichia coli O127:H6 str. E2348/69]
 gi|217321135|gb|EEC29559.1| thioredoxin [Escherichia coli O157:H7 str. TW14588]
 gi|218354230|emb|CAV00885.1| thioredoxin 1 [Escherichia coli 55989]
 gi|218358535|emb|CAQ91183.1| thioredoxin 1 [Escherichia fergusonii ATCC 35469]
 gi|218363112|emb|CAR00752.1| thioredoxin 1 [Escherichia coli IAI1]
 gi|218367616|emb|CAR05400.1| thioredoxin 1 [Escherichia coli S88]
 gi|218371292|emb|CAR19125.1| thioredoxin 1 [Escherichia coli IAI39]
 gi|218429624|emb|CAR10446.1| thioredoxin 1 [Escherichia coli ED1a]
 gi|218434514|emb|CAR15441.1| thioredoxin 1 [Escherichia coli UMN026]
 gi|224470266|gb|ACN48096.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|238863644|gb|ACR65642.1| thioredoxin 1 [Escherichia coli BW2952]
 gi|242379314|emb|CAQ34125.1| thioredoxin 1 [Escherichia coli BL21(DE3)]
 gi|253326638|gb|ACT31240.1| thioredoxin [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975626|gb|ACT41297.1| thioredoxin [Escherichia coli B str. REL606]
 gi|253979782|gb|ACT45452.1| thioredoxin [Escherichia coli BL21(DE3)]
 gi|254595179|gb|ACT74540.1| thioredoxin 1 [Escherichia coli O157:H7 str. TW14359]
 gi|257756462|dbj|BAI27964.1| thioredoxin 1 [Escherichia coli O26:H11 str. 11368]
 gi|257761590|dbj|BAI33087.1| thioredoxin 1 [Escherichia coli O103:H2 str. 12009]
 gi|257766862|dbj|BAI38357.1| thioredoxin 1 [Escherichia coli O111:H- str. 11128]
 gi|260451374|gb|ACX41796.1| thioredoxin [Escherichia coli DH1]
 gi|261249044|emb|CBG26904.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996197|gb|ACY91082.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|281180830|dbj|BAI57160.1| thioredoxin [Escherichia coli SE15]
 gi|284923886|emb|CBG36985.1| thioredoxin 1 [Escherichia coli 042]
 gi|291069682|gb|EFE07791.1| thioredoxin [Citrobacter youngae ATCC 29220]
 gi|291425522|gb|EFE98560.1| thioredoxin-1 [Escherichia coli FVEC1412]
 gi|294490421|gb|ADE89177.1| thioredoxin [Escherichia coli IHE3034]
 gi|298276387|gb|EFI17906.1| thioredoxin-1 [Escherichia coli FVEC1302]
 gi|299878036|gb|EFI86247.1| thioredoxin [Escherichia coli MS 196-1]
 gi|301160436|emb|CBW19965.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|305851550|gb|EFM52004.1| thioredoxin [Escherichia coli NC101]
 gi|307555909|gb|ADN48684.1| thioredoxin 1 [Escherichia coli ABU 83972]
 gi|307628844|gb|ADN73148.1| thioredoxin [Escherichia coli UM146]
 gi|308927599|gb|EFP73068.1| thioredoxin [Shigella dysenteriae 1617]
 gi|309704220|emb|CBJ03567.1| thioredoxin 1 [Escherichia coli ETEC H10407]
 gi|310334313|gb|EFQ00518.1| thioredoxin [Escherichia coli 1827-70]
 gi|312286037|gb|EFR13955.1| thioredoxin [Escherichia coli 2362-75]
 gi|312915039|dbj|BAJ39013.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|312948336|gb|ADR29163.1| thioredoxin [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647774|gb|EFS12221.1| thioredoxin [Shigella flexneri 2a str. 2457T]
 gi|315138359|dbj|BAJ45518.1| thioredoxin [Escherichia coli DH1]
 gi|315618520|gb|EFU99106.1| thioredoxin [Escherichia coli 3431]
 gi|320088332|emb|CBY98092.1| Thioredoxin Trx [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|320176024|gb|EFW51093.1| Thioredoxin [Shigella dysenteriae CDC 74-1112]
 gi|320178072|gb|EFW53052.1| Thioredoxin [Shigella boydii ATCC 9905]
 gi|320185442|gb|EFW60211.1| Thioredoxin [Shigella flexneri CDC 796-83]
 gi|320191125|gb|EFW65775.1| Thioredoxin [Escherichia coli O157:H7 str. EC1212]
 gi|320197593|gb|EFW72205.1| Thioredoxin [Escherichia coli WV_060327]
 gi|320198511|gb|EFW73112.1| Thioredoxin [Escherichia coli EC4100B]
 gi|320639265|gb|EFX08887.1| thioredoxin [Escherichia coli O157:H7 str. G5101]
 gi|320644650|gb|EFX13700.1| thioredoxin [Escherichia coli O157:H- str. 493-89]
 gi|320649975|gb|EFX18478.1| thioredoxin [Escherichia coli O157:H- str. H 2687]
 gi|320655321|gb|EFX23263.1| thioredoxin [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320660946|gb|EFX28389.1| thioredoxin [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666070|gb|EFX33084.1| thioredoxin [Escherichia coli O157:H7 str. LSU-61]
 gi|321225441|gb|EFX50498.1| Thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322612999|gb|EFY09950.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322617413|gb|EFY14313.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322625595|gb|EFY22417.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322627018|gb|EFY23811.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322631266|gb|EFY28029.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322638299|gb|EFY34998.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322642851|gb|EFY39437.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322646993|gb|EFY43495.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322650381|gb|EFY46794.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322656329|gb|EFY52623.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322657554|gb|EFY53824.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322665965|gb|EFY62146.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322666704|gb|EFY62881.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322671053|gb|EFY67183.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322679240|gb|EFY75292.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322681644|gb|EFY77671.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322686029|gb|EFY82017.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|323132268|gb|ADX19698.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323155183|gb|EFZ41367.1| thioredoxin [Escherichia coli EPECa14]
 gi|323161155|gb|EFZ47073.1| thioredoxin [Escherichia coli E128010]
 gi|323167635|gb|EFZ53340.1| thioredoxin [Shigella sonnei 53G]
 gi|323173398|gb|EFZ59027.1| thioredoxin [Escherichia coli LT-68]
 gi|323177791|gb|EFZ63375.1| thioredoxin [Escherichia coli 1180]
 gi|323182554|gb|EFZ67958.1| thioredoxin [Escherichia coli 1357]
 gi|323189496|gb|EFZ74776.1| thioredoxin [Escherichia coli RN587/1]
 gi|323192655|gb|EFZ77883.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323197838|gb|EFZ82969.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323203727|gb|EFZ88748.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323205398|gb|EFZ90372.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323210769|gb|EFZ95645.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323215935|gb|EGA00668.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323221428|gb|EGA05846.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB102109-0047]
 gi|323227328|gb|EGA11495.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323231739|gb|EGA15850.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323236154|gb|EGA20231.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323239609|gb|EGA23657.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323244295|gb|EGA28303.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323249608|gb|EGA33520.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2009159199]
 gi|323250300|gb|EGA34186.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008282]
 gi|323256507|gb|EGA40238.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008283]
 gi|323259795|gb|EGA43428.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
 gi|323265203|gb|EGA48701.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008285]
 gi|323268368|gb|EGA51840.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008287]
 gi|323934172|gb|EGB30603.1| thioredoxin [Escherichia coli E1520]
 gi|323938920|gb|EGB35139.1| thioredoxin [Escherichia coli E482]
 gi|323943816|gb|EGB39911.1| thioredoxin [Escherichia coli H120]
 gi|323949334|gb|EGB45224.1| thioredoxin [Escherichia coli H252]
 gi|323954096|gb|EGB49893.1| thioredoxin [Escherichia coli H263]
 gi|323959038|gb|EGB54707.1| thioredoxin [Escherichia coli H489]
 gi|323964029|gb|EGB59519.1| thioredoxin [Escherichia coli M863]
 gi|323969377|gb|EGB64676.1| thioredoxin [Escherichia coli TA007]
 gi|323974365|gb|EGB69493.1| thioredoxin [Escherichia coli TW10509]
 gi|324111008|gb|EGC04995.1| thioredoxin [Escherichia fergusonii B253]
 gi|324115755|gb|EGC09690.1| thioredoxin [Escherichia coli E1167]
 gi|325499247|gb|EGC97106.1| thioredoxin/transketolase fusion protein [Escherichia fergusonii
           ECD227]
 gi|326344239|gb|EGD67999.1| Thioredoxin [Escherichia coli O157:H7 str. 1125]
 gi|326347934|gb|EGD71648.1| Thioredoxin [Escherichia coli O157:H7 str. 1044]
 gi|326629649|gb|EGE35992.1| thioredoxin [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
 gi|327250633|gb|EGE62339.1| thioredoxin [Escherichia coli STEC_7v]
 gi|330908083|gb|EGH36602.1| thioredoxin [Escherichia coli AA86]
 gi|331052694|gb|EGI24729.1| thioredoxin [Escherichia coli TA206]
 gi|331057325|gb|EGI29314.1| thioredoxin [Escherichia coli TA143]
 gi|331062099|gb|EGI34021.1| thioredoxin [Escherichia coli TA271]
 gi|331077201|gb|EGI48415.1| thioredoxin [Escherichia coli H299]
 gi|332084704|gb|EGI89892.1| thioredoxin [Shigella boydii 5216-82]
 gi|332084949|gb|EGI90131.1| thioredoxin [Shigella dysenteriae 155-74]
 gi|332089064|gb|EGI94175.1| thioredoxin [Shigella boydii 3594-74]
 gi|332345761|gb|AEE59095.1| thioredoxin [Escherichia coli UMNK88]
 gi|332750994|gb|EGJ81399.1| thioredoxin [Shigella flexneri 4343-70]
 gi|332751083|gb|EGJ81487.1| thioredoxin [Shigella flexneri K-671]
 gi|332751922|gb|EGJ82317.1| thioredoxin [Shigella flexneri 2747-71]
 gi|332764377|gb|EGJ94612.1| thioredoxin [Shigella flexneri 2930-71]
 gi|332990756|gb|AEF09739.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
 gi|332996856|gb|EGK16476.1| thioredoxin [Shigella flexneri VA-6]
 gi|332997930|gb|EGK17537.1| thioredoxin [Shigella flexneri K-218]
 gi|332998277|gb|EGK17879.1| thioredoxin [Shigella flexneri K-272]
 gi|333013584|gb|EGK32951.1| thioredoxin [Shigella flexneri K-304]
 gi|333013816|gb|EGK33179.1| thioredoxin [Shigella flexneri K-227]
          Length = 109

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|296392455|ref|YP_003657339.1| thioredoxin [Segniliparus rotundus DSM 44985]
 gi|296179602|gb|ADG96508.1| thioredoxin [Segniliparus rotundus DSM 44985]
          Length = 109

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 68/97 (70%), Gaps = 1/97 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SF  +VL    PV+VDFWA+WC PC  ++P++++IA E A K+ + KLD++ + 
Sbjct: 9   LTVTDNSFAQDVLASEQPVLVDFWAAWCGPCRMVAPVLEEIAKEQAGKLVVAKLDVDANP 68

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + ST+Y ++SIP LILF++G+ + +++ GA  ++ I+
Sbjct: 69  KTSTKYDVNSIPNLILFQNGEPVKQII-GAKPKAAIL 104


>gi|119512335|ref|ZP_01631420.1| Thioredoxin [Nodularia spumigena CCY9414]
 gi|119462986|gb|EAW43938.1| Thioredoxin [Nodularia spumigena CCY9414]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A +V   SF  EVLE   PV+VDFWA WC PC  ++P++++IA +   ++K+ K++ +E
Sbjct: 3  AAEQVTDSSFKQEVLESDVPVLVDFWAPWCGPCRMVAPVVEEIAGQYEGQIKVVKVNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          + +++++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPQVASQYGIRSIPTLMIFKGGQKVD-MVVGAVPKTTL 99


>gi|90415272|ref|ZP_01223206.1| Thioredoxin [marine gamma proteobacterium HTCC2207]
 gi|90332595|gb|EAS47765.1| Thioredoxin [marine gamma proteobacterium HTCC2207]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 68/94 (72%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+S+VL+   P +VDFWA+WC PC  ++P++D+++ E A +VKI K+D++ S E + ++
Sbjct: 12  SFESDVLQSDIPALVDFWAAWCGPCKMIAPLLDELSTEYAGRVKICKVDVDASPETAAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL++FK+G V +    GA S++ ++E++
Sbjct: 72  NVRGIPTLLVFKNGTV-EATKVGALSKAQLVEFV 104


>gi|254476381|ref|ZP_05089767.1| thioredoxin [Ruegeria sp. R11]
 gi|214030624|gb|EEB71459.1| thioredoxin [Ruegeria sp. R11]
          Length = 106

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV   + PVVVDFWA WC PC ++ P ++++A E  DKVKI K+D++
Sbjct: 1   MSTVAVTDDTFDAEVKNSAVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGQVVSNRS-GAAPKAALQSWI 102


>gi|71735462|ref|YP_272592.1| thioredoxin [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289624461|ref|ZP_06457415.1| thioredoxin [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289651578|ref|ZP_06482921.1| thioredoxin [Pseudomonas syringae pv. aesculi str. 2250]
 gi|71556015|gb|AAZ35226.1| thioredoxin [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320322168|gb|EFW78264.1| thioredoxin [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331819|gb|EFW87757.1| thioredoxin [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330866611|gb|EGH01320.1| thioredoxin [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330872822|gb|EGH06971.1| thioredoxin [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330886068|gb|EGH19969.1| thioredoxin [Pseudomonas syringae pv. mori str. 301020]
          Length = 109

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+    V+VD+WA WC PC  ++P++D+IAD  A K+ I KL+I+E+ E   ++
Sbjct: 13  NFEAEVLKAEGAVLVDYWAEWCGPCKMIAPVLDEIADTYAGKLTIAKLNIDENQETPAKH 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 73  GVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFL 105


>gi|24987897|pdb|1XOB|A Chain A, Thioredoxin (Reduced Dithio Form), Nmr, 20 Structures
 gi|157834256|pdb|1XOA|A Chain A, Thioredoxin (Oxidized Disulfide Form), Nmr, 20 Structures
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|222619924|gb|EEE56056.1| hypothetical protein OsJ_04864 [Oryza sativa Japonica Group]
          Length = 193

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           + A K    SFD  + +   PV+VDF+A+WC PC  + PI+ +++++L DK+++ K+D E
Sbjct: 84  VQAKKQTFSSFDELLEKSEKPVLVDFYATWCGPCQYMVPILQEVSEKLGDKIQVVKIDTE 143

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + + I+ RYQI ++PT I+FK+GK   R   GA   + +I+ I S
Sbjct: 144 KYTSIANRYQIEALPTFIIFKNGKPCHR-FEGALPANQLIQQIES 187


>gi|239817817|ref|YP_002946727.1| thioredoxin [Variovorax paradoxus S110]
 gi|239804394|gb|ACS21461.1| thioredoxin [Variovorax paradoxus S110]
          Length = 149

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
           D K+FD  +     PV+VDFWA WC PC +++P  +  A +L  +V++ K+D E    + 
Sbjct: 48  DEKTFDRHIARNEIPVLVDFWAPWCGPCRQMAPGYEQAAAQLEPQVRLAKVDTEAVPALG 107

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            R+ I SIPTL LF+ G+ + R   GA   +DI+ W+
Sbjct: 108 ARFNIRSIPTLALFRGGREVARQA-GAMGAADIVRWV 143


>gi|83589778|ref|YP_429787.1| thioredoxin [Moorella thermoacetica ATCC 39073]
 gi|83572692|gb|ABC19244.1| thioredoxin [Moorella thermoacetica ATCC 39073]
          Length = 108

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 59/87 (67%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V+   F++EVL    PVVVDFWA WC PC  ++P+++ +A +    VK  K++++E+ 
Sbjct: 5  INVNQNDFEAEVLSAPLPVVVDFWAVWCGPCRMMAPVLEQLAADYDGNVKFAKVNVDENQ 64

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
          E++ RY I SIPTL++FKDG    R++
Sbjct: 65 ELAARYGIMSIPTLVIFKDGAEAGRIV 91


>gi|230777|pdb|2TRX|A Chain A, Crystal Structure Of Thioredoxin From Escherichia Coli At
           1.68 Angstroms Resolution
 gi|230778|pdb|2TRX|B Chain B, Crystal Structure Of Thioredoxin From Escherichia Coli At
           1.68 Angstroms Resolution
 gi|2982126|pdb|1T7P|B Chain B, T7 Dna Polymerase Complexed To Dna PrimerTEMPLATE,A
           Nucleoside Triphosphate, And Its Processivity Factor
           Thioredoxin
 gi|50513552|pdb|1SKR|B Chain B, T7 Dna Polymerase Complexed To Dna PrimerTEMPLATE AND
           DDATP
 gi|50513556|pdb|1SKS|B Chain B, Binary 3' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A CIS-Syn Thymine Dimer On The
           Template
 gi|50513560|pdb|1SKW|B Chain B, Binary 3' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A DISORDERED CIS-Syn Thymine
           Dimer On The Template
 gi|50513564|pdb|1SL0|B Chain B, Ternary 3' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A DISORDERED CIS-Syn Thymine
           Dimer On The Template And An Incoming Nucleotide
 gi|50513566|pdb|1SL0|D Chain D, Ternary 3' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A DISORDERED CIS-Syn Thymine
           Dimer On The Template And An Incoming Nucleotide
 gi|50513572|pdb|1SL1|B Chain B, Binary 5' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A CIS-Syn Thymine Dimer On The
           Template
 gi|50513576|pdb|1SL2|B Chain B, Ternary 5' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A CIS-Syn Thymine Dimer On The
           Template And An Incoming Nucleotide
 gi|52695799|pdb|1TK0|B Chain B, T7 Dna Polymerase Ternary Complex With 8 Oxo Guanosine And
           Ddctp At The Insertion Site
 gi|52695803|pdb|1TK5|B Chain B, T7 Dna Polymerase Binary Complex With 8 Oxo Guanosine In
           The Templating Strand
 gi|52695807|pdb|1TK8|B Chain B, T7 Dna Polymerase Ternary Complex With 8 Oxo Guanosine And
           Damp At The Elongation Site
 gi|52695811|pdb|1TKD|B Chain B, T7 Dna Polymerase Ternary Complex With 8 Oxo Guanosine And
           Dcmp At The Elongation Site
 gi|56553843|pdb|1T8E|B Chain B, T7 Dna Polymerase Ternary Complex With Dctp At The
           Insertion Site.
 gi|56554411|pdb|1X9M|B Chain B, T7 Dna Polymerase In Complex With An N-2-
           Acetylaminofluorene-Adducted Dna
 gi|56554415|pdb|1X9S|B Chain B, T7 Dna Polymerase In Complex With A PrimerTEMPLATE DNA
           Containing A Disordered N-2 Aminofluorene On The
           Template, Crystallized With Dideoxy-Ctp As The Incoming
           Nucleotide.
 gi|56554419|pdb|1X9W|B Chain B, T7 Dna Polymerase In Complex With A PrimerTEMPLATE DNA
           Containing A Disordered N-2 Aminofluorene On The
           Template, Crystallized With Dideoxy-Atp As The Incoming
           Nucleotide.
 gi|71042775|pdb|2BTO|T Chain T, Structure Of Btuba From Prosthecobacter Dejongeii
 gi|83753887|pdb|1ZYQ|B Chain B, T7 Dna Polymerase In Complex With 8og And Incoming Ddatp
 gi|116666723|pdb|2AJQ|B Chain B, Structure Of Replicative Dna Polymerase Provides Insigts
           Into The Mechanisms For Processivity, Frameshifting And
           Editing
 gi|116666727|pdb|2AJQ|I Chain I, Structure Of Replicative Dna Polymerase Provides Insigts
           Into The Mechanisms For Processivity, Frameshifting And
           Editing
 gi|149241870|pdb|2H6X|A Chain A, Crystal Structure Of Thioredoxin Wild Type In Hexagonal
           (P61) Space Group
 gi|149241871|pdb|2H6X|B Chain B, Crystal Structure Of Thioredoxin Wild Type In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|87121329|ref|ZP_01077219.1| thioredoxin [Marinomonas sp. MED121]
 gi|86163486|gb|EAQ64761.1| thioredoxin [Marinomonas sp. MED121]
          Length = 108

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++    F  EVL    PVVVDFWA WC PC  + P+++D+A E+  K+K+ K++++E
Sbjct: 4   NTIQITDAQFQEEVLNSEVPVVVDFWAPWCGPCKMIGPVLEDVAGEMEGKIKVVKINVDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + + + +Y +  IPTL++ K G+V+   + GA S+S ++++I
Sbjct: 64  NPDTAPKYNVRGIPTLLVVKGGEVVATKV-GAVSKSQLVDFI 104


>gi|302039153|ref|YP_003799475.1| thioredoxin [Candidatus Nitrospira defluvii]
 gi|300607217|emb|CBK43550.1| Thioredoxin [Candidatus Nitrospira defluvii]
          Length = 144

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (60%), Gaps = 1/97 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           FD        P+VVDFWASWC PC  ++P  +  A  L  +V++ K++ EE   ++ R+ 
Sbjct: 49  FDLHAQRAEIPLVVDFWASWCGPCRMMAPAYEQAAQMLEPQVRLAKVNTEEEQALAARFG 108

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ISSIPTL+L + G+ + R  PGA    DI+ W+ S++
Sbjct: 109 ISSIPTLVLLRGGRELAR-QPGALGLQDIVRWVRSKI 144


>gi|218710958|ref|YP_002418579.1| thioredoxin [Vibrio splendidus LGP32]
 gi|218323977|emb|CAV20339.1| Thioredoxin [Vibrio splendidus LGP32]
          Length = 112

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   ++ I KL+I++++
Sbjct: 10  LQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGQLTIGKLNIDQNA 69

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 70  GTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFL 108


>gi|218248832|ref|YP_002374203.1| thioredoxin [Cyanothece sp. PCC 8801]
 gi|257061894|ref|YP_003139782.1| thioredoxin [Cyanothece sp. PCC 8802]
 gi|218169310|gb|ACK68047.1| thioredoxin [Cyanothece sp. PCC 8801]
 gi|256592060|gb|ACV02947.1| thioredoxin [Cyanothece sp. PCC 8802]
          Length = 107

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
          +V    F  EVLE   PV+VDFWA WC PC  ++P++D+IA++   +VK+ KL+ +E+ +
Sbjct: 6  QVTDAKFKEEVLESDIPVLVDFWAPWCGPCRMVAPVVDEIAEQYQGQVKVLKLNTDENPQ 65

Query: 65 ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +++Y I SIPTL++FK+G+ +D M+ GA  ++ +
Sbjct: 66 TASQYGIRSIPTLMIFKEGQRVD-MVVGAVPKTTL 99


>gi|25067747|gb|AAN65341.1| thioredoxin/transketolase fusion protein [synthetic construct]
          Length = 804

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|145309338|gb|ABK41839.1| thioredoxin [Flavobacterium columnare]
          Length = 105

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 60/88 (68%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL +   +FD  VL+   PV+VDFWA+WC PC  + P+ID+IA E   K  I K+D++ +
Sbjct: 2  ALAITDATFDEVVLQSDKPVLVDFWAAWCGPCRMVGPVIDEIATEYEGKAVIGKVDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E + +Y + +IPT+++F++G+V+ R +
Sbjct: 62 QEFAAKYGVRNIPTVLIFQNGEVVGRQV 89


>gi|257791643|ref|YP_003182249.1| thioredoxin [Eggerthella lenta DSM 2243]
 gi|317487890|ref|ZP_07946482.1| thioredoxin [Eggerthella sp. 1_3_56FAA]
 gi|325830640|ref|ZP_08164061.1| thioredoxin [Eggerthella sp. HGA1]
 gi|257475540|gb|ACV55860.1| thioredoxin [Eggerthella lenta DSM 2243]
 gi|316913016|gb|EFV34533.1| thioredoxin [Eggerthella sp. 1_3_56FAA]
 gi|325487386|gb|EGC89828.1| thioredoxin [Eggerthella sp. HGA1]
          Length = 102

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V +  F S+VL+   PV+VDF+A+WC PC  L+P +D++A E A K  + KLDI++S +I
Sbjct: 5   VSSSDFQSKVLDAQGPVLVDFFATWCGPCKMLAPTLDEVAAETAGKAAVYKLDIDQSPDI 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +Y + S+PTL++F++G+V ++ + G   + +I+  I
Sbjct: 65  AQKYGVMSVPTLMVFENGQVKNQAV-GVQPKQNILSMI 101


>gi|37520449|ref|NP_923826.1| thioredoxin [Gloeobacter violaceus PCC 7421]
 gi|35211443|dbj|BAC88821.1| thioredoxin [Gloeobacter violaceus PCC 7421]
          Length = 110

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A+ V   +F +EVL+   PV+VDFWA WC PC  ++P++D+IA + + K+K+ K++ +E
Sbjct: 3  AAVPVGDSNFKTEVLDSELPVLVDFWAPWCGPCRMVAPVVDEIAQQYSGKLKVVKVNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          + +++++Y I SIPTL++FK G  +D M+ GA  ++ +
Sbjct: 63 NPQVASQYGIRSIPTLMVFKSGSKVD-MVVGAVPKTTL 99


>gi|114561647|ref|YP_749160.1| thioredoxin [Shewanella frigidimarina NCIMB 400]
 gi|114332940|gb|ABI70322.1| thioredoxin [Shewanella frigidimarina NCIMB 400]
          Length = 108

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI++D+A+E A K+ + KL++++++    +Y
Sbjct: 12  SFENDVLKSETPVLVDFWAEWCGPCKMIAPILNDVAEEYAGKLTVAKLNVDQNNVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTL++FK G+++   + GA S++ + E+I +++
Sbjct: 72  GVRGIPTLLMFKGGELVATKV-GALSKTQLKEFIDAKI 108


>gi|270264231|ref|ZP_06192498.1| thioredoxin-1 [Serratia odorifera 4Rx13]
 gi|270041880|gb|EFA14977.1| thioredoxin-1 [Serratia odorifera 4Rx13]
          Length = 108

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   P++VDFWA WC PC  ++PI+D+IA E   K+ ITKL+I+++   + +Y
Sbjct: 12  SFETDVLKAEGPILVDFWAEWCGPCKMIAPILDEIAVEFEGKLTITKLNIDQNPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + +++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKDFL 104


>gi|91216592|ref|ZP_01253558.1| putative thioredoxin [Psychroflexus torquis ATCC 700755]
 gi|91185386|gb|EAS71763.1| putative thioredoxin [Psychroflexus torquis ATCC 700755]
          Length = 105

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 63/94 (67%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L++  K F  +VLE   PV+VDFWA+WC PC  + PIID++  E   K  I K+D++++ 
Sbjct: 3  LEITDKDFQEKVLESDIPVLVDFWAAWCGPCRMVGPIIDELNTEYEGKAVIAKMDVDQNQ 62

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          E + +Y + +IPT++ FK+G++++R +  A  ++
Sbjct: 63 EFAAKYGVRNIPTVLFFKNGEMVNRQVGVAQKET 96


>gi|237755583|ref|ZP_04584199.1| thioredoxin [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237692246|gb|EEP61238.1| thioredoxin [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 105

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 61/84 (72%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V+  +F+ EVL    PV+VDFWA WC PC  ++PI++++A EL  K K+ K++ +E+ 
Sbjct: 6  ISVNESNFEQEVLNSDVPVLVDFWAPWCGPCRLIAPIVEELAVELEGKAKVVKVNTDENP 65

Query: 64 EISTRYQISSIPTLILFKDGKVID 87
           ++ RY I +IPT+++FK+G+V+D
Sbjct: 66 NLAMRYGIRAIPTIMVFKNGRVVD 89


>gi|260431947|ref|ZP_05785918.1| thioredoxin [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415775|gb|EEX09034.1| thioredoxin [Silicibacter lacuscaerulensis ITI-1157]
          Length = 106

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V  ++FD+EV     PVVVDFWA WC PC ++ P ++++A E  DK+KI K+D++
Sbjct: 1   MSTVAVTDETFDAEVRNSDVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKIKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGQVVSNRA-GAAPKAALQSWI 102


>gi|257057904|ref|YP_003135736.1| thioredoxin [Saccharomonospora viridis DSM 43017]
 gi|256587776|gb|ACU98909.1| thioredoxin [Saccharomonospora viridis DSM 43017]
          Length = 108

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   +F  EVL    PV+VDFWA+WC PC  ++P++++IA E  DK+++ KLD + 
Sbjct: 3   NTVEVTDSNFADEVLAHDKPVLVDFWATWCGPCKMIAPVLEEIAAEHGDKLRVAKLDTDA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +   +  YQ+ SIPT+ILF+DGK + +++ GA  ++ ++ 
Sbjct: 63  NPNTTRDYQVMSIPTMILFQDGKPVKQIV-GAKPKAALLN 101


>gi|291541719|emb|CBL14829.1| thioredoxin [Ruminococcus bromii L2-63]
          Length = 102

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 71/95 (74%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F+ EVL+   PV+VDFWA+WC PC  ++PI+ +IADE   K+ + K++++E  +++ +
Sbjct: 8   ETFEQEVLQSDIPVLVDFWATWCGPCKMIAPIVKEIADEYDGKILVGKVNVDEEPDLTMQ 67

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y +SSIPTL++FK+G+++++ + G   + +I++ +
Sbjct: 68  YNVSSIPTLMVFKNGQLVNKAV-GYREKDEILKML 101


>gi|210060966|pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060967|pdb|3DXB|B Chain B, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060968|pdb|3DXB|C Chain C, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060969|pdb|3DXB|D Chain D, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060970|pdb|3DXB|E Chain E, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060971|pdb|3DXB|F Chain F, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060972|pdb|3DXB|G Chain G, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060973|pdb|3DXB|H Chain H, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
          Length = 222

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 21  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 80

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 81  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 113


>gi|150010064|ref|YP_001304807.1| thioredoxin [Parabacteroides distasonis ATCC 8503]
 gi|262382634|ref|ZP_06075771.1| thioredoxin [Bacteroides sp. 2_1_33B]
 gi|298374424|ref|ZP_06984382.1| thioredoxin [Bacteroides sp. 3_1_19]
 gi|301308096|ref|ZP_07214050.1| thioredoxin [Bacteroides sp. 20_3]
 gi|149938488|gb|ABR45185.1| thioredoxin [Parabacteroides distasonis ATCC 8503]
 gi|262295512|gb|EEY83443.1| thioredoxin [Bacteroides sp. 2_1_33B]
 gi|298268792|gb|EFI10447.1| thioredoxin [Bacteroides sp. 3_1_19]
 gi|300833566|gb|EFK64182.1| thioredoxin [Bacteroides sp. 20_3]
          Length = 105

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 72/101 (71%), Gaps = 2/101 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+ E++    P+V+DFWA WC PC  +SPIID++A E   +V I K++++E+
Sbjct: 2   ALQITDANFE-ELVNSGKPMVLDFWAEWCGPCRMVSPIIDELATEYEGRVTIGKMNVDEN 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++  ++ I +IPT++ FKDGK++D+++ GA+++   +E I
Sbjct: 61  DDVVGQFGIRNIPTVLFFKDGKMVDKVV-GATAKDKFVEKI 100


>gi|319944210|ref|ZP_08018486.1| thioredoxin [Lautropia mirabilis ATCC 51599]
 gi|319742505|gb|EFV94916.1| thioredoxin [Lautropia mirabilis ATCC 51599]
          Length = 106

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    V   SFD++VL+   PV+VDFWA WC PC  ++PI+D+++ + +D++ + K++++
Sbjct: 1   MGIKNVSADSFDTDVLKSDVPVLVDFWAEWCGPCKLIAPILDEVSHDYSDRMAVAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +S  I+ +Y I  IPTL+LFK+G ++   + GA S+  +  ++ S +
Sbjct: 61  DSQAIAAKYGIRGIPTLMLFKNGTLVGTKV-GAVSKGQLTAFLDSNL 106


>gi|298491749|ref|YP_003721926.1| thioredoxin ['Nostoc azollae' 0708]
 gi|298233667|gb|ADI64803.1| thioredoxin ['Nostoc azollae' 0708]
          Length = 108

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 60/90 (66%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+   V   +F  EVLE   PV+VDFWA WC PC  L+ ++D++A E   +VK+ KL+ +
Sbjct: 1  MTVTNVTEATFKQEVLESETPVLVDFWAPWCGPCRMLATVVDEVAAEYEGQVKVVKLNTD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          ++  +++ Y I SIPTL++FK G+ ID ++
Sbjct: 61 QNPIVASHYGIRSIPTLMIFKGGRQIDTVV 90


>gi|575449|gb|AAA67270.1| Derived from E. coli thioredoxin gene; normal translation
           termination codon following nucleotide 3050 has been
           removed [Cloning vector pTRXFUS]
          Length = 134

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|294789511|ref|ZP_06754747.1| thioredoxin [Simonsiella muelleri ATCC 29453]
 gi|294482591|gb|EFG30282.1| thioredoxin [Simonsiella muelleri ATCC 29453]
          Length = 109

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F++EVL+   PV++DFWA WC PC  ++P++D++A ELA +VKI K++++++ 
Sbjct: 6   VHVTDATFETEVLQSEIPVLLDFWAPWCGPCKMIAPVLDELATELAGQVKIAKINVDDNQ 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  ++ +  IPTLI+FKDG+ +   + GA +++ +  ++
Sbjct: 66  AVPAQFGVRGIPTLIIFKDGQALATKV-GALAKNQLAAFV 104


>gi|157836387|pdb|2TIR|A Chain A, Crystal Structure Analysis Of A Mutant Escherichia Coli
           Thioredoxin In Which Lysine 36 Is Replaced By Glutamic
           Acid
          Length = 108

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCEMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|311772203|pdb|3NOF|A Chain A, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant
 gi|311772204|pdb|3NOF|B Chain B, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant
 gi|311772217|pdb|3O6T|A Chain A, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant In
           Complex With Quinol Inhibitor Pmx464
 gi|311772218|pdb|3O6T|B Chain B, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant In
           Complex With Quinol Inhibitor Pmx464
 gi|311772219|pdb|3O6T|C Chain C, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant In
           Complex With Quinol Inhibitor Pmx464
 gi|311772220|pdb|3O6T|D Chain D, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant In
           Complex With Quinol Inhibitor Pmx464
          Length = 118

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC P   ++P++++IA E A  + + KLD++ 
Sbjct: 10  ATIKVTDASFATDVLSSNKPVLVDFWATWCGPSKMVAPVLEEIATERATDLTVAKLDVDT 69

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++ 
Sbjct: 70  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLR 108


>gi|254784464|ref|YP_003071892.1| thioredoxin [Teredinibacter turnerae T7901]
 gi|237684810|gb|ACR12074.1| thioredoxin [Teredinibacter turnerae T7901]
          Length = 108

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +VL    PV+VDFWA+WC PC  ++P++D++A E   K+KI K+D++ + E   ++
Sbjct: 12  SFEQDVLTADGPVLVDFWAAWCGPCKMIAPVLDELAQEYEGKIKICKMDVDANKETPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTLI+FK+G   +    GA S++ + E+I + V
Sbjct: 72  NIRGIPTLIIFKNGSA-EGTKVGALSKAQLKEFIDANV 108


>gi|28899775|ref|NP_799380.1| thioredoxin [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839100|ref|ZP_01991767.1| thioredoxin [Vibrio parahaemolyticus AQ3810]
 gi|260362508|ref|ZP_05775434.1| thioredoxin [Vibrio parahaemolyticus K5030]
 gi|260877188|ref|ZP_05889543.1| thioredoxin [Vibrio parahaemolyticus AN-5034]
 gi|260897232|ref|ZP_05905728.1| thioredoxin [Vibrio parahaemolyticus Peru-466]
 gi|260901364|ref|ZP_05909759.1| thioredoxin [Vibrio parahaemolyticus AQ4037]
 gi|28808027|dbj|BAC61264.1| thioredoxin [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747396|gb|EDM58360.1| thioredoxin [Vibrio parahaemolyticus AQ3810]
 gi|308088940|gb|EFO38635.1| thioredoxin [Vibrio parahaemolyticus Peru-466]
 gi|308094140|gb|EFO43835.1| thioredoxin [Vibrio parahaemolyticus AN-5034]
 gi|308107210|gb|EFO44750.1| thioredoxin [Vibrio parahaemolyticus AQ4037]
 gi|308112668|gb|EFO50208.1| thioredoxin [Vibrio parahaemolyticus K5030]
 gi|328471327|gb|EGF42226.1| thioredoxin [Vibrio parahaemolyticus 10329]
          Length = 108

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+I+ ++
Sbjct: 6   LQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDHNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFKDG V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKDGNVAATKV-GALSKTQLKEFL 104


>gi|330957135|gb|EGH57395.1| thioredoxin [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 109

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+ + PV+VD+WA WC PC  ++P++D+IA+    K+ I KL+I+E+ E   ++
Sbjct: 13  TFEAEVLKATGPVLVDYWAEWCGPCKMIAPVLDEIANTYDGKLTIAKLNIDENQETPAKH 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 73  GVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFL 105


>gi|302207201|gb|ADL11543.1| Thioredoxin [Corynebacterium pseudotuberculosis C231]
 gi|308277454|gb|ADO27353.1| Thioredoxin [Corynebacterium pseudotuberculosis I19]
          Length = 107

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 64/97 (65%), Gaps = 1/97 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F + V++   PV+VDFWA WC PC KL PIID+IA E+ D+V + K+D++    +   +
Sbjct: 11  TFKTTVIDSDKPVLVDFWAEWCGPCKKLGPIIDEIAAEMGDEVVVGKVDVDAERNLGAMF 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           QI SIPT+++FKDG+ +   + G   +S+I+  + S 
Sbjct: 71  QIMSIPTVLIFKDGQKVAEFV-GVRPKSEIVAKLRSH 106


>gi|296141897|ref|YP_003649140.1| thioredoxin [Tsukamurella paurometabola DSM 20162]
 gi|296030031|gb|ADG80801.1| thioredoxin [Tsukamurella paurometabola DSM 20162]
          Length = 111

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 65/91 (71%), Gaps = 1/91 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F + VLE S PV+VDFWA+WC PC  ++P+++ IA + AD + + K+D++ +      YQ
Sbjct: 16  FKATVLESSKPVLVDFWATWCGPCKMVAPVLEQIAADHADSLVVAKVDVDANPAAPRDYQ 75

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           + SIPTLILFKDG+ + +++ GA S+S I++
Sbjct: 76  VLSIPTLILFKDGEPVAKLV-GAKSKSAILK 105


>gi|288921195|ref|ZP_06415481.1| thioredoxin [Frankia sp. EUN1f]
 gi|288347402|gb|EFC81693.1| thioredoxin [Frankia sp. EUN1f]
          Length = 108

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 67/91 (73%), Gaps = 1/91 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F +EVL+   PV+VDFWA WC PC  ++P++++IA E  +K++I KL+I+++ +++  Y
Sbjct: 12  TFATEVLKSDKPVLVDFWAEWCGPCKMVAPVLEEIAKEHGEKLRIVKLNIDDNPQVAREY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           QI SIPT+ +F +G+V DR + GA  ++ ++
Sbjct: 72  QIMSIPTMAVFVNGEV-DRTIVGAKPKAALL 101


>gi|145221432|ref|YP_001132110.1| thioredoxin [Mycobacterium gilvum PYR-GCK]
 gi|315446816|ref|YP_004079695.1| thioredoxin [Mycobacterium sp. Spyr1]
 gi|145213918|gb|ABP43322.1| thioredoxin [Mycobacterium gilvum PYR-GCK]
 gi|315265119|gb|ADU01861.1| thioredoxin [Mycobacterium sp. Spyr1]
          Length = 109

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + V   SF  +VL    PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++E
Sbjct: 5   STVTVTDDSFSDDVLSSGTPVLVDFWATWCGPCKMVAPVLEEIASEKAGSLTVAKLDVDE 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +   +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++  I
Sbjct: 65  NPATARDFQVVSIPTMILFKDGQPVKRIV-GAKGKAALLREI 105


>gi|225847955|ref|YP_002728118.1| thioredoxin [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643086|gb|ACN98136.1| thioredoxin [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 105

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 62/84 (73%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V+  +F+ EVL    PV+VDFWA WC PC  ++PI+++IA+E+  + K+ K++ +E+ 
Sbjct: 6  ISVNESNFEQEVLNSDVPVLVDFWAPWCGPCRLIAPIVEEIAEEMEGRAKVVKVNTDENP 65

Query: 64 EISTRYQISSIPTLILFKDGKVID 87
           ++ +Y I +IPT+++FK+G+V+D
Sbjct: 66 NLAMKYGIRAIPTIMVFKNGRVVD 89


>gi|56477801|ref|YP_159390.1| putative thioredoxin [Aromatoleum aromaticum EbN1]
 gi|56313844|emb|CAI08489.1| putative thioredoxin [Aromatoleum aromaticum EbN1]
          Length = 145

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++D  SFD        P++VDFWASWC PC  ++P  ++ A +L   V++ K++ EE+ 
Sbjct: 42  VELDAASFDVHAGHGDLPLLVDFWASWCGPCRTMAPAFEEAAAKLEPHVRLGKVNTEEAQ 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEW 102
           +++ RY I SIPT++LF+ G+ + R   GA +   I++W
Sbjct: 102 DLAARYAIRSIPTMVLFRAGREVARQS-GAMNTGQILQW 139


>gi|317132285|ref|YP_004091599.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
 gi|315470264|gb|ADU26868.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
          Length = 104

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+A+ V   +F++ VL+   PV++DFWA+WC PC  +SPI+D++++EL+  +++ K++++
Sbjct: 1  MAAITVTKDNFNTIVLQADKPVLIDFWATWCGPCRMVSPIVDELSEELSGTIEVAKVNVD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          E  E+++++ + SIPTL+L K G V    + GA  + DI
Sbjct: 61 EEPELASKFGVMSIPTLVLVKGGTVAATSV-GARPKEDI 98


>gi|192360857|ref|YP_001980884.1| thioredoxin [Cellvibrio japonicus Ueda107]
 gi|190687022|gb|ACE84700.1| thioredoxin [Cellvibrio japonicus Ueda107]
          Length = 138

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +   SF+ EV+    PV+VDFWA WC PC  ++PI+DD+A++   K+KITKL+++++ 
Sbjct: 36  VHISDASFEQEVIAADIPVLVDFWAPWCGPCKMIAPILDDLAEQFEGKLKITKLNVDDNK 95

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E + ++ +  IPTLI+FK+G      + GA S+  ++++I
Sbjct: 96  ESAAKFNVRGIPTLIIFKNGAAHATKV-GALSKPQLVDFI 134


>gi|148262446|ref|YP_001229152.1| thioredoxin [Geobacter uraniireducens Rf4]
 gi|146395946|gb|ABQ24579.1| thioredoxin [Geobacter uraniireducens Rf4]
          Length = 109

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 65/90 (72%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++ VL+   PV+VDFWA+WC PC  ++P+ID IADE   K+K+ K++++++     +Y
Sbjct: 13  NFEAAVLQSDVPVLVDFWATWCAPCKAIAPLIDTIADEYDGKIKVGKVNVDDNPGTPGKY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            +  IPT+IL KDGKV+D+++ GA  ++ +
Sbjct: 73  GVRGIPTVILIKDGKVVDQVV-GAVPKAQL 101


>gi|58698543|ref|ZP_00373444.1| thioredoxin [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630597|ref|YP_002727388.1| thioredoxin [Wolbachia sp. wRi]
 gi|58534925|gb|EAL59023.1| thioredoxin [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225592578|gb|ACN95597.1| thioredoxin [Wolbachia sp. wRi]
          Length = 107

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 68/102 (66%), Gaps = 3/102 (2%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+ ++F SEV +    V+VDFWA WC PC  L P I+ +A +   K+KI K DI+E +E+
Sbjct: 8   VNDQNFKSEVTDYKGFVLVDFWAEWCGPCKSLMPRIEQLAKDRKGKIKICKFDIDEGTEV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++Y + SIPTLI+F+DGK I R + GA+  +D+  W+ S +
Sbjct: 68  PSKYGVQSIPTLIIFQDGKEIARKI-GAT--NDLSSWVDSEI 106


>gi|301630305|ref|XP_002944262.1| PREDICTED: thioredoxin-like [Xenopus (Silurana) tropicalis]
          Length = 127

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF ++VL+ S PV+VD+WA WC PC  ++PI+DD+A     K+ I K++++++ E
Sbjct: 25  HVSDTSFQADVLQSSTPVLVDYWAEWCGPCKMIAPILDDVAGAYQGKLTIAKMNMDDNQE 84

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I  ++ I  IPTL+LFK+G++    + GA  ++ +  +I
Sbjct: 85  IPAKFGIRGIPTLMLFKNGQLAATHV-GALGRAQLTAFI 122


>gi|298485181|ref|ZP_07003275.1| Thioredoxin [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298160293|gb|EFI01320.1| Thioredoxin [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 109

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 62/90 (68%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+    V+VD+WA WC PC  ++P++D+IAD  A K+ I KL+I+E+ E   ++
Sbjct: 13  NFEAEVLKAEGAVLVDYWAEWCGPCKMIAPVLDEIADTYAGKLTIAKLNIDENQETPAKH 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            +  IPTL+LFK+G V +    GA S+S +
Sbjct: 73  GVRGIPTLMLFKNGNV-EATKVGALSKSQL 101


>gi|297580212|ref|ZP_06942139.1| thioredoxin 2 [Vibrio cholerae RC385]
 gi|297535858|gb|EFH74692.1| thioredoxin 2 [Vibrio cholerae RC385]
          Length = 144

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T++  S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E    ++ 
Sbjct: 44  TEANFSALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEAQQNLAA 103

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +QI SIPT+++FK+G+ ID M+ GA  +S   +W+
Sbjct: 104 HFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWL 138


>gi|296283900|ref|ZP_06861898.1| thiol-disulfide isomerase [Citromicrobium bathyomarinum JL354]
          Length = 106

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF S+VL+   PV+VDFWA WC PC  ++P +++I+DELAD+V I K+DI 
Sbjct: 1   MATKTVTDASFQSDVLQSDKPVLVDFWAEWCGPCKMIAPALEEISDELADQVTIAKMDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+++   +  +  IP L+L+K+G+    +  GA  +S +  W+
Sbjct: 61  ENTDTPGKLGVQGIPYLVLYKNGERAAELT-GARPKSQLKAWL 102


>gi|89901669|ref|YP_524140.1| thioredoxin [Rhodoferax ferrireducens T118]
 gi|89346406|gb|ABD70609.1| thioredoxin [Rhodoferax ferrireducens T118]
          Length = 133

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+++VL+ + PV+VD+WA WC PC  ++PI+++IA     K++I K++++E+ +
Sbjct: 31  HVSDASFEADVLQSTQPVLVDYWAEWCGPCKMIAPILEEIATSYEGKLQIAKMNVDENRD 90

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I  ++ I  IPTL+LFKDG++    + GA S+S +  +I
Sbjct: 91  IPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKSQMTAFI 128


>gi|308233505|ref|ZP_07664242.1| thioredoxin [Atopobium vaginae DSM 15829]
 gi|328943423|ref|ZP_08240888.1| thioredoxin [Atopobium vaginae DSM 15829]
 gi|327491392|gb|EGF23166.1| thioredoxin [Atopobium vaginae DSM 15829]
          Length = 105

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 62/88 (70%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A  + +  FDS +   + PV++DFWA+WC PC  L P I++I++E+ADK+ + K +++E 
Sbjct: 2  AQAITSADFDSIISSSTKPVLIDFWATWCGPCRALGPKIEEISEEMADKLAVYKCNVDEE 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E++ ++QI SIPT+ILFKDG  +  ++
Sbjct: 62 PELAQQFQIVSIPTVILFKDGNAVHSLV 89


>gi|160892603|ref|ZP_02073393.1| hypothetical protein CLOL250_00133 [Clostridium sp. L2-50]
 gi|156865644|gb|EDO59075.1| hypothetical protein CLOL250_00133 [Clostridium sp. L2-50]
          Length = 105

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + ++ K ++ +VL+     +VDFWA+WC PC  ++PI++++ADE  + VK+ K+D++
Sbjct: 1   MAVIHLNEKEYEDQVLKAKGLTLVDFWATWCGPCRMVAPIVEELADEFPE-VKVCKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++   ++ SIPT +L+KDG+VI +++ GA  +S++I+ I
Sbjct: 60  ENQELALANKVVSIPTFLLYKDGEVIKKIV-GAVPKSELIQAI 101


>gi|145346917|ref|XP_001417928.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578156|gb|ABO96221.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 123

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 66/97 (68%), Gaps = 1/97 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A  V   +F++EVL+   PV+VDFWA WC PC  ++P+ID +A+E   K+K  KL+ +ES
Sbjct: 20  ATVVTDATFEAEVLKSDVPVLVDFWAPWCGPCRMIAPLIDQLAEEYQGKLKAVKLNTDES 79

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
             ++T Y I SIPT+++FK G+ +D ++ GA  +S +
Sbjct: 80  PSVATEYGIRSIPTVMIFKGGQKMDTVI-GAVPKSTL 115


>gi|323357967|ref|YP_004224363.1| thiol-disulfide isomerase and thioredoxins [Microbacterium
          testaceum StLB037]
 gi|323274338|dbj|BAJ74483.1| thiol-disulfide isomerase and thioredoxins [Microbacterium
          testaceum StLB037]
          Length = 107

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 62/85 (72%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+A    + +F+ +VL+   PV+VDFWA WC PC  ++P++D+I  E ADK+ + KL+++
Sbjct: 1  MTAKATTSATFEQDVLQADGPVLVDFWAEWCGPCRMVAPVLDEIQSENADKITVLKLNVD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKV 85
          E+ +++ +YQI+SIP + +F+ G+V
Sbjct: 61 ENPDLAMKYQITSIPAMKVFQGGEV 85


>gi|258648348|ref|ZP_05735817.1| thioredoxin [Prevotella tannerae ATCC 51259]
 gi|260851513|gb|EEX71382.1| thioredoxin [Prevotella tannerae ATCC 51259]
          Length = 104

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 68/88 (77%), Gaps = 2/88 (2%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F+SE L    P+VVDF A+WC PC K++PIID++A+E   +V + K D++E+S+++TR+
Sbjct: 9  NFESE-LNAGLPLVVDFSATWCGPCKKIAPIIDELAEEYDGRVNVGKCDVDENSDLTTRF 67

Query: 70 QISSIPTLILFKDGKVIDRMMPGASSQS 97
           I S+PT++ FK+G+++D+ + GA S++
Sbjct: 68 GIRSVPTVLFFKNGELVDKTV-GAGSKA 94


>gi|153800780|ref|ZP_01955366.1| thioredoxin [Vibrio cholerae MZO-3]
 gi|124123755|gb|EAY42498.1| thioredoxin [Vibrio cholerae MZO-3]
          Length = 144

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 61/96 (63%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T++  S +L    PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E    ++ 
Sbjct: 44  TEANFSALLRSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRFVKIDTEAQQNLAA 103

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +QI SIPT+++FK+G+ ID M+ GA  +S   +W+
Sbjct: 104 HFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWL 138


>gi|115373100|ref|ZP_01460402.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|310824344|ref|YP_003956702.1| thioredoxin 1 [Stigmatella aurantiaca DW4/3-1]
 gi|115369856|gb|EAU68789.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|309397416|gb|ADO74875.1| Thioredoxin 1 [Stigmatella aurantiaca DW4/3-1]
          Length = 108

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MSA--LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MSA  + V   +FD  VL+   PV+VDFWA WC PC +++P++D+IADE A K+ I KL+
Sbjct: 1   MSAKPIHVSEVNFDEVVLKDQGPVLVDFWAEWCGPCERIAPLLDEIADEYAGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+  ++ +  +  IPTL+LFK G+V   +  G  S++ + E++ + +
Sbjct: 61  IDENRALARKQGVRRIPTLMLFKQGEVA-AVKEGVPSKTQLNEFLTANM 108


>gi|78184297|ref|YP_376732.1| thioredoxin [Synechococcus sp. CC9902]
 gi|116071056|ref|ZP_01468325.1| Thioredoxin [Synechococcus sp. BL107]
 gi|78168591|gb|ABB25688.1| thioredoxin [Synechococcus sp. CC9902]
 gi|116066461|gb|EAU72218.1| Thioredoxin [Synechococcus sp. BL107]
          Length = 107

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+++IA E   ++K+ KL+ +E
Sbjct: 3  SAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVEEIAKEFEGQIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMVFKGGQKVDTVV 91


>gi|261212503|ref|ZP_05926788.1| thioredoxin 2 [Vibrio sp. RC341]
 gi|262189645|ref|ZP_06048028.1| thioredoxin 2 [Vibrio cholerae CT 5369-93]
 gi|260838434|gb|EEX65090.1| thioredoxin 2 [Vibrio sp. RC341]
 gi|262034473|gb|EEY52830.1| thioredoxin 2 [Vibrio cholerae CT 5369-93]
          Length = 144

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T++  S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E    ++ 
Sbjct: 44  TEANFSALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEAQQNLAA 103

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +QI SIPT+++FK+G+ ID M+ GA  +S   +W+
Sbjct: 104 HFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWL 138


>gi|153952947|ref|YP_001393712.1| Trx [Clostridium kluyveri DSM 555]
 gi|219853604|ref|YP_002470726.1| hypothetical protein CKR_0261 [Clostridium kluyveri NBRC 12016]
 gi|146345828|gb|EDK32364.1| Trx [Clostridium kluyveri DSM 555]
 gi|219567328|dbj|BAH05312.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 105

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 59/81 (72%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F   V E S PVVVDFWASWC PC  LSP+I+++A EL  K K  K++++E+   + ++
Sbjct: 9  NFSESVKESSTPVVVDFWASWCGPCKMLSPVIEEVASELEGKAKFFKINVDENPVTAAQF 68

Query: 70 QISSIPTLILFKDGKVIDRMM 90
          +I SIPT+++FKDG V+++ +
Sbjct: 69 KIGSIPTVMVFKDGSVVEQFI 89


>gi|251777916|ref|ZP_04820836.1| thioredoxin [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243082231|gb|EES48121.1| thioredoxin [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 105

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 60/84 (71%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          ++++ F  +V      V+VDF+A WC PC  L+PI +D+++E  DK K+ KL+++ES EI
Sbjct: 5  INSREFMEKVENTKGVVMVDFFADWCGPCKMLAPIFEDLSNEFNDKAKLFKLNVDESGEI 64

Query: 66 STRYQISSIPTLILFKDGKVIDRM 89
          + +Y + SIPT+I+FKDGK ++ +
Sbjct: 65 AQKYGVFSIPTMIIFKDGKAVENL 88


>gi|33152818|ref|NP_874171.1| thioredoxin [Haemophilus ducreyi 35000HP]
 gi|33149043|gb|AAP96560.1| thioredoxin [Haemophilus ducreyi 35000HP]
          Length = 105

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 69/99 (69%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   +F+ EVL+   PV++DFWA WC PC  ++P +D++A E A + K+ K++++E+ +
Sbjct: 4   QVTDATFEQEVLKSDLPVLLDFWAPWCGPCRTIAPWLDELAQEFAGRAKVAKVNVDENQQ 63

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I+ ++ I SIPTL+LFK+G+V+  +  G   +S ++ +I
Sbjct: 64  IAAQFGIRSIPTLLLFKNGEVV-AIQVGVLPKSQLVTFI 101


>gi|322834950|ref|YP_004214977.1| thioredoxin [Rahnella sp. Y9602]
 gi|321170151|gb|ADW75850.1| thioredoxin [Rahnella sp. Y9602]
          Length = 108

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    V+VDFWA WC PC  ++PI+D+IA E   K+ I KL+I+E+   + +Y
Sbjct: 12  SFDNDVLKAEGLVLVDFWAEWCGPCKMIAPILDEIATEFEGKLTIAKLNIDENPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK G+V    + GA S+  + E++ + +
Sbjct: 72  GIRGIPTLLLFKGGEVAATKV-GALSKGQLKEFLTANL 108


>gi|293413225|ref|ZP_06655887.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291468173|gb|EFF10670.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 127

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 30  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLIVAKLNIDQNPGTAPKY 89

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 90  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 122


>gi|313156964|gb|EFR56396.1| thioredoxin [Alistipes sp. HGB5]
          Length = 104

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 69/101 (68%), Gaps = 2/101 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL +  ++F  EV+    PVV+DFWA WC PC  ++PI+D++A E   +V I K D+EE+
Sbjct: 2   ALAITKENF-QEVISSELPVVIDFWAEWCGPCRTIAPIVDELAAEYEGRVLIGKCDVEEN 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            EI+ +Y + +IPT++  K G+++D+ + GA+S++ + E I
Sbjct: 61  DEITMKYGVRNIPTIVFLKGGELVDKQV-GAASKAALAEKI 100


>gi|311693120|gb|ADP95993.1| thioredoxin [marine bacterium HP15]
          Length = 114

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL+   PV+VD+WA WC PC  ++P++++IADE   K+K+ KL+I+E+ 
Sbjct: 12  VNVTDASFEQDVLQSDVPVLVDYWAEWCGPCKMIAPVLEEIADEYDGKLKVCKLNIDENE 71

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   ++ I  IPTL+LFK+G V D    GA S+S +  ++ S +
Sbjct: 72  QTPPKFNIRGIPTLMLFKNGNV-DATKVGALSKSQLAAFLDSNL 114


>gi|166710444|ref|ZP_02241651.1| thioredoxin [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 113

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++++++  
Sbjct: 7  HVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRA 66

Query: 65 ISTRYQISSIPTLILFKDGKV 85
          ++ +Y + SIP L+LFK+G+V
Sbjct: 67 LAIKYHVRSIPMLLLFKNGEV 87


>gi|15601507|ref|NP_233138.1| thioredoxin 2 [Vibrio cholerae O1 biovar eltor str. N16961]
 gi|121585544|ref|ZP_01675340.1| thioredoxin [Vibrio cholerae 2740-80]
 gi|147671803|ref|YP_001215529.1| thioredoxin 2 [Vibrio cholerae O395]
 gi|153215604|ref|ZP_01950049.1| thioredoxin 2 [Vibrio cholerae 1587]
 gi|153818647|ref|ZP_01971314.1| thioredoxin [Vibrio cholerae NCTC 8457]
 gi|153820684|ref|ZP_01973351.1| thioredoxin 2 [Vibrio cholerae B33]
 gi|153824349|ref|ZP_01977016.1| thioredoxin 2 [Vibrio cholerae MZO-2]
 gi|153829865|ref|ZP_01982532.1| thioredoxin 2 [Vibrio cholerae 623-39]
 gi|227812319|ref|YP_002812329.1| thioredoxin 2 [Vibrio cholerae M66-2]
 gi|229506091|ref|ZP_04395600.1| thioredoxin 2 [Vibrio cholerae BX 330286]
 gi|229510052|ref|ZP_04399532.1| thioredoxin 2 [Vibrio cholerae B33]
 gi|229514200|ref|ZP_04403661.1| thioredoxin 2 [Vibrio cholerae TMA 21]
 gi|229516387|ref|ZP_04405834.1| thioredoxin 2 [Vibrio cholerae RC9]
 gi|229522314|ref|ZP_04411730.1| thioredoxin 2 [Vibrio cholerae TM 11079-80]
 gi|229526725|ref|ZP_04416129.1| thioredoxin 2 [Vibrio cholerae bv. albensis VL426]
 gi|229605622|ref|YP_002876326.1| thioredoxin 2 [Vibrio cholerae MJ-1236]
 gi|254285774|ref|ZP_04960737.1| thioredoxin 2 [Vibrio cholerae AM-19226]
 gi|254849913|ref|ZP_05239263.1| thioredoxin 2 [Vibrio cholerae MO10]
 gi|255746487|ref|ZP_05420434.1| thioredoxin 2 [Vibrio cholera CIRS 101]
 gi|262152382|ref|ZP_06028515.1| thioredoxin 2 [Vibrio cholerae INDRE 91/1]
 gi|262168594|ref|ZP_06036290.1| thioredoxin 2 [Vibrio cholerae RC27]
 gi|298499548|ref|ZP_07009354.1| thioredoxin 2 [Vibrio cholerae MAK 757]
 gi|9658173|gb|AAF96650.1| thioredoxin 2 [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121550161|gb|EAX60175.1| thioredoxin [Vibrio cholerae 2740-80]
 gi|124114692|gb|EAY33512.1| thioredoxin 2 [Vibrio cholerae 1587]
 gi|126510800|gb|EAZ73394.1| thioredoxin [Vibrio cholerae NCTC 8457]
 gi|126521727|gb|EAZ78950.1| thioredoxin 2 [Vibrio cholerae B33]
 gi|146314186|gb|ABQ18726.1| thioredoxin 2 [Vibrio cholerae O395]
 gi|148874666|gb|EDL72801.1| thioredoxin 2 [Vibrio cholerae 623-39]
 gi|149741903|gb|EDM55932.1| thioredoxin 2 [Vibrio cholerae MZO-2]
 gi|150424271|gb|EDN16209.1| thioredoxin 2 [Vibrio cholerae AM-19226]
 gi|227011461|gb|ACP07672.1| thioredoxin 2 [Vibrio cholerae M66-2]
 gi|227015187|gb|ACP11396.1| thioredoxin 2 [Vibrio cholerae O395]
 gi|229336883|gb|EEO01901.1| thioredoxin 2 [Vibrio cholerae bv. albensis VL426]
 gi|229340299|gb|EEO05305.1| thioredoxin 2 [Vibrio cholerae TM 11079-80]
 gi|229346268|gb|EEO11239.1| thioredoxin 2 [Vibrio cholerae RC9]
 gi|229348180|gb|EEO13138.1| thioredoxin 2 [Vibrio cholerae TMA 21]
 gi|229352497|gb|EEO17437.1| thioredoxin 2 [Vibrio cholerae B33]
 gi|229356442|gb|EEO21360.1| thioredoxin 2 [Vibrio cholerae BX 330286]
 gi|229372108|gb|ACQ62530.1| thioredoxin 2 [Vibrio cholerae MJ-1236]
 gi|254845618|gb|EET24032.1| thioredoxin 2 [Vibrio cholerae MO10]
 gi|255736241|gb|EET91639.1| thioredoxin 2 [Vibrio cholera CIRS 101]
 gi|262023123|gb|EEY41828.1| thioredoxin 2 [Vibrio cholerae RC27]
 gi|262030833|gb|EEY49464.1| thioredoxin 2 [Vibrio cholerae INDRE 91/1]
 gi|297541529|gb|EFH77580.1| thioredoxin 2 [Vibrio cholerae MAK 757]
 gi|327485758|gb|AEA80164.1| Thioredoxin 2 [Vibrio cholerae LMA3894-4]
          Length = 144

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T++  S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E    ++ 
Sbjct: 44  TEANFSALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEAQQNLAA 103

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +QI SIPT+++FK+G+ ID M+ GA  +S   +W+
Sbjct: 104 HFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWL 138


>gi|160882037|ref|YP_001561005.1| thioredoxin [Clostridium phytofermentans ISDg]
 gi|160430703|gb|ABX44266.1| thioredoxin [Clostridium phytofermentans ISDg]
          Length = 103

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL    ++F+ EV++   PV+VDF+A WC PC  ++PII+++ D+   K+KI KL+++ S
Sbjct: 2  ALIFTDENFEKEVIQSDLPVLVDFYADWCGPCKMMAPIIEELHDQYEGKIKIGKLNVDNS 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96
           E +  +++ SIPTLI FK+GK I+ M+   + Q
Sbjct: 62 PETAAAFRVMSIPTLIFFKNGKAIETMVGVVAKQ 95


>gi|325290211|ref|YP_004266392.1| thioredoxin [Syntrophobotulus glycolicus DSM 8271]
 gi|324965612|gb|ADY56391.1| thioredoxin [Syntrophobotulus glycolicus DSM 8271]
          Length = 107

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 68/94 (72%), Gaps = 1/94 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           ++++ +EVL+   PV+VDFWASWC PC  + P+++++A +   KV + KL+++E  EI+ 
Sbjct: 9   SQNWQNEVLDADKPVLVDFWASWCGPCRMIGPVVEELAGDYDGKVIVGKLNVDEQGEIAQ 68

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +Y I SIP+L+LFK+G++ ++ + G   + D+++
Sbjct: 69  KYGIMSIPSLLLFKNGQIKEKTV-GFRGKGDLVK 101


>gi|58583925|ref|YP_202941.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625713|ref|YP_453085.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188574751|ref|YP_001911680.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58428519|gb|AAW77556.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369653|dbj|BAE70811.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519203|gb|ACD57148.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 113

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++++++  
Sbjct: 7  HVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRA 66

Query: 65 ISTRYQISSIPTLILFKDGKV 85
          ++ +Y + SIP L+LFK+G+V
Sbjct: 67 LAIKYHVRSIPMLLLFKNGEV 87


>gi|197302900|ref|ZP_03167951.1| hypothetical protein RUMLAC_01628 [Ruminococcus lactaris ATCC
           29176]
 gi|197297981|gb|EDY32530.1| hypothetical protein RUMLAC_01628 [Ruminococcus lactaris ATCC
           29176]
          Length = 102

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 73/103 (70%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS +K+  ++F+ EVL+    V+VDF+A WC PC  +SPI+D+IA+E ++ +K+  ++I+
Sbjct: 1   MSVVKLTVENFEQEVLQAEKLVLVDFYADWCGPCKMMSPIVDEIAEEESE-IKVCNINID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ++ EI+ +Y++ SIPT I FK+G+   R + GA S+ +++  I
Sbjct: 60  QAMEIAQKYRVMSIPTFIAFKNGEEAGRQI-GAVSKGELLSLI 101


>gi|218780249|ref|YP_002431567.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
 gi|218761633|gb|ACL04099.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
          Length = 108

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 64/86 (74%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L+V+  SFDS+V++   PV+VDFWA WC PC  ++P+++++A ++ DKV   K +++++ 
Sbjct: 6  LEVNDSSFDSDVMQSDKPVLVDFWAPWCGPCRAIAPVVEELAAQMGDKVAFAKCNVDDNP 65

Query: 64 EISTRYQISSIPTLILFKDGKVIDRM 89
             +++ I +IPTLI+FK G+V++++
Sbjct: 66 ATPSKFGIRAIPTLIVFKGGEVVEQI 91


>gi|88808976|ref|ZP_01124485.1| Thioredoxin [Synechococcus sp. WH 7805]
 gi|148239928|ref|YP_001225315.1| thioredoxin [Synechococcus sp. WH 7803]
 gi|88786918|gb|EAR18076.1| Thioredoxin [Synechococcus sp. WH 7805]
 gi|147848467|emb|CAK24018.1| Thioredoxin [Synechococcus sp. WH 7803]
          Length = 107

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E
Sbjct: 3   SAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRM---MPGASSQSDIIEWI 103
           +  +++++ I SIPTL++FK G+ +D +   +P A+    I +++
Sbjct: 63  NPNVASQFGIRSIPTLMVFKGGQKVDTVVGAVPKATLSGTIAKYL 107


>gi|291613479|ref|YP_003523636.1| thioredoxin [Sideroxydans lithotrophicus ES-1]
 gi|291583591|gb|ADE11249.1| thioredoxin [Sideroxydans lithotrophicus ES-1]
          Length = 108

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F +EVL+   PV+VD+WA WC PC  ++PI+D+++ E A ++ + KL+++E+ + 
Sbjct: 8   VTDGTFTAEVLQSPLPVLVDYWAEWCGPCRMIAPILDEVSKEYAGRLNVAKLNVDENQQT 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y +  IPTL+LFK+G  I+    GA S+S +  +I S +
Sbjct: 68  PQKYGVRGIPTLMLFKNGN-IEATKVGALSKSQLTAFIDSHI 108


>gi|330938793|gb|EGH42318.1| thioredoxin [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 109

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +FD+EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL+I+++ E
Sbjct: 8   HVTDANFDAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDEIAGTYEGKLTVAKLNIDQNPE 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFKDG V +    GA S+S +  ++
Sbjct: 68  TPAKHGVRGIPTLMLFKDGNV-EATKVGALSKSQLAAFL 105


>gi|162454024|ref|YP_001616391.1| thioredoxin [Sorangium cellulosum 'So ce 56']
 gi|161164606|emb|CAN95911.1| thioredoxin [Sorangium cellulosum 'So ce 56']
          Length = 107

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 61/87 (70%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          ++V+  +F  EVL+   PV+VDF ASWC PC +L+PI+D+IA E A +VK+ KLD++ S 
Sbjct: 7  IEVNDLNFAQEVLQTDTPVLVDFSASWCAPCKRLAPIVDEIAAETAGEVKVVKLDVDASP 66

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
          E + R+ I  +PT++ F+ G+ + R +
Sbjct: 67 EAAQRFGIRGLPTVVAFQKGEPVGRHV 93


>gi|300857192|ref|YP_003782176.1| putative thioredoxin [Clostridium ljungdahlii DSM 13528]
 gi|300437307|gb|ADK17074.1| predicted thioredoxin [Clostridium ljungdahlii DSM 13528]
          Length = 105

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 62/86 (72%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
          ++  + F   +     PVVVDFWASWC PC  LSPII++++DEL +K K  KL+++E+  
Sbjct: 4  EIKDQDFSQSIENAPTPVVVDFWASWCGPCKMLSPIIEEVSDELGEKAKFFKLNVDENPV 63

Query: 65 ISTRYQISSIPTLILFKDGKVIDRMM 90
           + +++I+SIPT+++FK+G ++D+ +
Sbjct: 64 TAAQFKIASIPTVMVFKNGNMVDKFV 89


>gi|269467939|gb|EEZ79674.1| thioredoxin [uncultured SUP05 cluster bacterium]
          Length = 108

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L V   SF+++V+  S  V+VDFWA WC PC  L+P++D+IADE   K+ I K++++E+ 
Sbjct: 6   LAVTDTSFEADVINSSQAVLVDFWAEWCGPCKALAPVLDEIADEYDGKLIIAKINVDEND 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +Y I  IPT++LFKDG V    M GA S++++  +I + +
Sbjct: 66  QTPPKYGIRGIPTVLLFKDGAVEATKM-GALSKAELSAFIDANI 108


>gi|188588569|ref|YP_001921917.1| thioredoxin [Clostridium botulinum E3 str. Alaska E43]
 gi|188498850|gb|ACD51986.1| thioredoxin [Clostridium botulinum E3 str. Alaska E43]
          Length = 105

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 60/84 (71%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          ++++ F  +V      V+VDF+A WC PC  L+PI +D+++E  DK K+ KL+++ES EI
Sbjct: 5  INSREFMEKVENTKGVVMVDFFADWCGPCKMLAPIFEDLSNEFNDKAKLFKLNVDESGEI 64

Query: 66 STRYQISSIPTLILFKDGKVIDRM 89
          + +Y + SIPT+I+FKDGK ++ +
Sbjct: 65 AQKYGVFSIPTMIIFKDGKAVENL 88


>gi|221066136|ref|ZP_03542241.1| thioredoxin [Comamonas testosteroni KF-1]
 gi|264679316|ref|YP_003279223.1| thioredoxin [Comamonas testosteroni CNB-2]
 gi|299532276|ref|ZP_07045669.1| thioredoxin [Comamonas testosteroni S44]
 gi|220711159|gb|EED66527.1| thioredoxin [Comamonas testosteroni KF-1]
 gi|262209829|gb|ACY33927.1| thioredoxin [Comamonas testosteroni CNB-2]
 gi|298719684|gb|EFI60648.1| thioredoxin [Comamonas testosteroni S44]
          Length = 109

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 57/76 (75%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SF+S+VL+    V+VD+WA WC PC  ++PI+DD+A+    KV+I K++++E+ EI  ++
Sbjct: 13 SFESDVLQPGTTVLVDYWAEWCGPCKMIAPILDDVAEGYKGKVQIAKMNVDENREIPAKF 72

Query: 70 QISSIPTLILFKDGKV 85
           I  IPTL+LFKDG++
Sbjct: 73 GIRGIPTLMLFKDGQL 88


>gi|71908610|ref|YP_286197.1| thioredoxin [Dechloromonas aromatica RCB]
 gi|71848231|gb|AAZ47727.1| Thioredoxin [Dechloromonas aromatica RCB]
          Length = 108

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+   PV+VD+WA WC PC  ++PI+D++A E A K+K+ K++I+++     ++
Sbjct: 12  TFEAEVLQSQQPVLVDYWAEWCGPCKMIAPILDEVATEYAGKLKVAKVNIDDNQATPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL++FK+G V +    GA S+S +  +I S +
Sbjct: 72  GIRGIPTLMIFKNGNV-EATKVGALSKSQLAAFIDSNL 108


>gi|327479207|gb|AEA82517.1| thioredoxin [Pseudomonas stutzeri DSM 4166]
          Length = 108

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+ +VL+   PV+VD+WA WC PC  ++P++D+IA +   ++K+ KL+I+E+ E
Sbjct: 7   NVSDSSFEQDVLQADGPVLVDYWAEWCGPCKMIAPVLDEIAKDYEGRLKVCKLNIDENQE 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +Y +  IPTL+LFK+G V +    GA S+S +  ++ S +
Sbjct: 67  TPPKYGVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFLDSNI 108


>gi|319779375|ref|YP_004130288.1| Thioredoxin [Taylorella equigenitalis MCE9]
 gi|317109399|gb|ADU92145.1| Thioredoxin [Taylorella equigenitalis MCE9]
          Length = 105

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF ++VLE + PV+VDFWA WC PC  ++PI++++  EL DK+ I K++++++ +++ ++
Sbjct: 9   SFKADVLESTKPVLVDFWAPWCGPCKMVAPILEELDSELTDKISIVKVNVDDNQDLAAQF 68

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I SIPTL+LFK+G     +  GA ++SD+  +I + +
Sbjct: 69  GIRSIPTLMLFKNGNQ-SAVKVGAVTKSDLTNFINTNI 105


>gi|157377242|ref|YP_001475842.1| thioredoxin [Shewanella sediminis HAW-EB3]
 gi|157319616|gb|ABV38714.1| thioredoxin [Shewanella sediminis HAW-EB3]
          Length = 108

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V+    PV+VDFWA WC PC  ++PI+DD+A+E A KV I KL++++++    +Y
Sbjct: 12  SFENDVINSELPVIVDFWAEWCGPCKMIAPILDDVAEEYAGKVTIAKLNVDQNNVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL++FK+G++    + GA S++ + E+I
Sbjct: 72  GVRGIPTLLIFKNGELAGTKV-GALSKTQLKEFI 104


>gi|312142017|ref|YP_004009353.1| thioredoxin [Rhodococcus equi 103S]
 gi|311891356|emb|CBH50677.1| thioredoxin [Rhodococcus equi 103S]
          Length = 107

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + ++  SF  +VL+   PV+VDFWA+WC PC  ++P++++IA E  DK+ I KLDI++
Sbjct: 3   NTITINDDSFKQDVLDAEKPVLVDFWATWCGPCKMVAPVLEEIAGEHGDKLTIAKLDIDQ 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +   +  +Q+ SIPT+ILF+ GK + + + GA  ++ +++
Sbjct: 63  NPGAARDFQVMSIPTMILFQGGKPV-KTIVGAKGKAALLK 101


>gi|325108580|ref|YP_004269648.1| thioredoxin [Planctomyces brasiliensis DSM 5305]
 gi|324968848|gb|ADY59626.1| thioredoxin [Planctomyces brasiliensis DSM 5305]
          Length = 108

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 62/86 (72%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L+    +F +EVL    PV+VDFWA WC PC  ++P I+++A + A KV+I KL+ +++ 
Sbjct: 6  LEFTDGNFQTEVLSGDQPVLVDFWAPWCGPCKMMTPTIEELATDYAGKVRIGKLNTDDNP 65

Query: 64 EISTRYQISSIPTLILFKDGKVIDRM 89
            ++ + IS+IPTL+LFK+G++++R+
Sbjct: 66 NTASEHGISAIPTLMLFKNGELVERL 91


>gi|89093776|ref|ZP_01166722.1| thioredoxin [Oceanospirillum sp. MED92]
 gi|89081906|gb|EAR61132.1| thioredoxin [Oceanospirillum sp. MED92]
          Length = 108

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL+    V+VD+WA WC PC  ++P++++IA E  D++KI KL+I+E+S
Sbjct: 6   VNVTDASFEEDVLKAEGAVLVDYWAEWCGPCKMIAPVLEEIAKEYGDQLKICKLNIDENS 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   ++ I  IPTL+LFK G V +    GA S+S +  +I
Sbjct: 66  ETPPKFGIRGIPTLMLFKGGNV-EATKVGALSKSQLAAFI 104


>gi|171463385|ref|YP_001797498.1| thioredoxin [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171192923|gb|ACB43884.1| thioredoxin [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 108

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV++DFWA WC PC  + PI++++A E  DK++I K++++E+  +
Sbjct: 8   VTDASFEQDVLKSDKPVLLDFWAEWCGPCKMIGPILEELAGEYGDKLQIAKMNVDENQGV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +  I  IPTLILFK+G V  + + GA ++S +  +I S +
Sbjct: 68  PAQLNIRGIPTLILFKNGTVAAQKV-GALAKSQLTAFIDSHL 108


>gi|146313636|ref|YP_001178710.1| thioredoxin [Enterobacter sp. 638]
 gi|261343046|ref|ZP_05970904.1| thioredoxin [Enterobacter cancerogenus ATCC 35316]
 gi|145320512|gb|ABP62659.1| thioredoxin [Enterobacter sp. 638]
 gi|288314611|gb|EFC53549.1| thioredoxin [Enterobacter cancerogenus ATCC 35316]
          Length = 109

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGLILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|225849914|ref|YP_002730148.1| thioredoxin [Persephonella marina EX-H1]
 gi|225645299|gb|ACO03485.1| thioredoxin [Persephonella marina EX-H1]
          Length = 105

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 61/82 (74%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          V+  +++ EVL    PV+VDFWA WC PC  ++P+I+++A+EL  K KI KL+ +E+  I
Sbjct: 8  VNESNWEQEVLNSELPVLVDFWAPWCGPCRLIAPVIEELAEELEGKAKICKLNTDENPNI 67

Query: 66 STRYQISSIPTLILFKDGKVID 87
          + +Y I +IPT+++FK+G+V+D
Sbjct: 68 AMKYGIRAIPTIMVFKNGQVVD 89


>gi|153832834|ref|ZP_01985501.1| thioredoxin [Vibrio harveyi HY01]
 gi|148870968|gb|EDL69858.1| thioredoxin [Vibrio harveyi HY01]
          Length = 144

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +LE + PVVVDFWA WC PCV  +P+ +D+A E     +  K+D E   +++ ++ I 
Sbjct: 49  SALLESNTPVVVDFWAPWCNPCVGFAPVFEDVAQEQTGNARFVKIDTEAQQQLAAQFGIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  ++   +W+
Sbjct: 109 SIPTIMVFKNGQRVD-MINGALPKTQFDQWL 138


>gi|78189117|ref|YP_379455.1| thioredoxin [Chlorobium chlorochromatii CaD3]
 gi|78171316|gb|ABB28412.1| thioredoxin [Chlorobium chlorochromatii CaD3]
          Length = 109

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 60/81 (74%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F +E+L+ +   +VDFWA+WC PC+ L P+I+++A E   K  I KL+++E+   + +Y
Sbjct: 12 NFKAEILDSNKVALVDFWAAWCGPCMMLGPVIEELAGEYEGKAIIAKLNVDENPNTAAQY 71

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           I SIP+L++FK+G+++D+M+
Sbjct: 72 GIRSIPSLLIFKNGQIVDQML 92


>gi|213964027|ref|ZP_03392270.1| thioredoxin [Capnocytophaga sputigena Capno]
 gi|213953309|gb|EEB64648.1| thioredoxin [Capnocytophaga sputigena Capno]
          Length = 106

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 72/105 (68%), Gaps = 2/105 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+  VL+ S PV+VDFWA WC PC  L+P++++I+ E   +V + K+D++ +
Sbjct: 2   ALEITDGNFEELVLKSSQPVLVDFWAVWCGPCRMLAPVVEEISKEYEGRVVVGKVDVDNN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGA--SSQSDIIEWILS 105
            E + +Y I +IPT+++F++G+V+ R +  A   + +D ++ +LS
Sbjct: 62  QEFAAKYGIRNIPTVLVFQNGEVVGRQVGVAPKKTYTDALDGLLS 106


>gi|153004238|ref|YP_001378563.1| thioredoxin [Anaeromyxobacter sp. Fw109-5]
 gi|152027811|gb|ABS25579.1| thioredoxin [Anaeromyxobacter sp. Fw109-5]
          Length = 110

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 65/92 (70%), Gaps = 1/92 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+   PV+VDFWA WC PC  ++P ++++A +   KVK+ K+D+++   +  +Y
Sbjct: 13  TFETEVLKSDVPVLVDFWAVWCGPCKAIAPTVEELASQYKGKVKVAKMDVDQHQNVPQQY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            I SIPTL++FK G+V+D ++ GA  ++ + E
Sbjct: 73  GIRSIPTLLVFKGGRVVDTIV-GAVPKAKLEE 103


>gi|289642454|ref|ZP_06474599.1| thioredoxin [Frankia symbiont of Datisca glomerata]
 gi|289507713|gb|EFD28667.1| thioredoxin [Frankia symbiont of Datisca glomerata]
          Length = 108

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF  EVL+   PV+VDFWA WC PC  ++P++++IA E  DK+++ KL+I+E+ + 
Sbjct: 8   VTDNSFTEEVLKSKVPVLVDFWAEWCGPCRLVAPVLEEIAAEHGDKLRVVKLNIDENPQT 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + +YQI SIPTL +F +G+V D+ + GA  ++ ++
Sbjct: 68  ARQYQILSIPTLAVFVNGEV-DKSIVGAKPKAALL 101


>gi|242055683|ref|XP_002456987.1| hypothetical protein SORBIDRAFT_03g046830 [Sorghum bicolor]
 gi|241928962|gb|EES02107.1| hypothetical protein SORBIDRAFT_03g046830 [Sorghum bicolor]
          Length = 171

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 72/107 (67%), Gaps = 6/107 (5%)

Query: 2   SALKVDTK-----SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITK 56
           + L+V+ K     SFD  + +   P++VDF+A+WC PC  + PI+++++++L DK+++ K
Sbjct: 58  ATLRVEAKKQTFSSFDELLEKSEKPLLVDFYATWCGPCQYMVPILEEVSEKLGDKIQVVK 117

Query: 57  LDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +D E+ + I++RY+I ++PT I+FKDGK   R   GA   + +IE I
Sbjct: 118 IDTEKYTSIASRYRIEALPTFIIFKDGKPCYRFE-GALPANQMIEQI 163


>gi|22124275|ref|NP_667698.1| thioredoxin 1 [Yersinia pestis KIM 10]
 gi|45442929|ref|NP_994468.1| thioredoxin 1 [Yersinia pestis biovar Microtus str. 91001]
 gi|51594522|ref|YP_068713.1| thioredoxin 1 [Yersinia pseudotuberculosis IP 32953]
 gi|108806148|ref|YP_650064.1| thioredoxin 1 [Yersinia pestis Antiqua]
 gi|108810261|ref|YP_646028.1| thioredoxin 1 [Yersinia pestis Nepal516]
 gi|153950031|ref|YP_001399176.1| thioredoxin [Yersinia pseudotuberculosis IP 31758]
 gi|153997076|ref|ZP_02022209.1| thioredoxin 1 [Yersinia pestis CA88-4125]
 gi|162421208|ref|YP_001605107.1| thioredoxin 1 [Yersinia pestis Angola]
 gi|165926289|ref|ZP_02222121.1| thioredoxin [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165939713|ref|ZP_02228256.1| thioredoxin [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009693|ref|ZP_02230591.1| thioredoxin [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213563|ref|ZP_02239598.1| thioredoxin [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167402076|ref|ZP_02307555.1| thioredoxin [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420843|ref|ZP_02312596.1| thioredoxin [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167425907|ref|ZP_02317660.1| thioredoxin [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170026245|ref|YP_001722750.1| thioredoxin [Yersinia pseudotuberculosis YPIII]
 gi|186893520|ref|YP_001870632.1| thioredoxin [Yersinia pseudotuberculosis PB1/+]
 gi|218930871|ref|YP_002348746.1| thioredoxin 1 [Yersinia pestis CO92]
 gi|229837201|ref|ZP_04457366.1| thioredoxin 1 [Yersinia pestis Pestoides A]
 gi|229839561|ref|ZP_04459720.1| thioredoxin 1 [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229900124|ref|ZP_04515261.1| thioredoxin 1 [Yersinia pestis biovar Orientalis str. India 195]
 gi|229900429|ref|ZP_04515558.1| thioredoxin 1 [Yersinia pestis Nepal516]
 gi|270488785|ref|ZP_06205859.1| thioredoxin [Yersinia pestis KIM D27]
 gi|294505531|ref|YP_003569593.1| thioredoxin 1 [Yersinia pestis Z176003]
 gi|21957044|gb|AAM83949.1|AE013636_7 thioredoxin 1 [Yersinia pestis KIM 10]
 gi|45437796|gb|AAS63345.1| thioredoxin 1 [Yersinia pestis biovar Microtus str. 91001]
 gi|51587804|emb|CAH19406.1| thioredoxin 1 [Yersinia pseudotuberculosis IP 32953]
 gi|108773909|gb|ABG16428.1| thioredoxin 1 [Yersinia pestis Nepal516]
 gi|108778061|gb|ABG12119.1| thioredoxin 1 [Yersinia pestis Antiqua]
 gi|115349482|emb|CAL22455.1| thioredoxin 1 [Yersinia pestis CO92]
 gi|149289382|gb|EDM39460.1| thioredoxin 1 [Yersinia pestis CA88-4125]
 gi|152961526|gb|ABS48987.1| thioredoxin [Yersinia pseudotuberculosis IP 31758]
 gi|162354023|gb|ABX87971.1| thioredoxin [Yersinia pestis Angola]
 gi|165912403|gb|EDR31037.1| thioredoxin [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921813|gb|EDR39010.1| thioredoxin [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991615|gb|EDR43916.1| thioredoxin [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205236|gb|EDR49716.1| thioredoxin [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960972|gb|EDR56993.1| thioredoxin [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167048550|gb|EDR59958.1| thioredoxin [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167055055|gb|EDR64854.1| thioredoxin [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169752779|gb|ACA70297.1| thioredoxin [Yersinia pseudotuberculosis YPIII]
 gi|186696546|gb|ACC87175.1| thioredoxin [Yersinia pseudotuberculosis PB1/+]
 gi|229682448|gb|EEO78535.1| thioredoxin 1 [Yersinia pestis Nepal516]
 gi|229686904|gb|EEO78983.1| thioredoxin 1 [Yersinia pestis biovar Orientalis str. India 195]
 gi|229695927|gb|EEO85974.1| thioredoxin 1 [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706144|gb|EEO92153.1| thioredoxin 1 [Yersinia pestis Pestoides A]
 gi|262363597|gb|ACY60318.1| thioredoxin 1 [Yersinia pestis D106004]
 gi|262367525|gb|ACY64082.1| thioredoxin 1 [Yersinia pestis D182038]
 gi|270337289|gb|EFA48066.1| thioredoxin [Yersinia pestis KIM D27]
 gi|294355990|gb|ADE66331.1| thioredoxin 1 [Yersinia pestis Z176003]
 gi|320013531|gb|ADV97102.1| thioredoxin 1 [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 108

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 58/77 (75%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ I KL+I+++   + +Y
Sbjct: 12 SFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLNIDDNQGTAPKY 71

Query: 70 QISSIPTLILFKDGKVI 86
           I  IPTL+LF+DG+V+
Sbjct: 72 GIRGIPTLLLFRDGEVV 88


>gi|161502248|ref|YP_001569360.1| thioredoxin 2 [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160863595|gb|ABX20218.1| hypothetical protein SARI_00276 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 139

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  ++           PVV+DFWA WC PC   +PI  D+A+E + KV+  K+D 
Sbjct: 33  FDGEVINATSETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFKDVAEERSGKVRFVKVDT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIPT+++FK G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSARFGIRSIPTIMIFKHGQVVD-MLNGAVPKAPFDNWL 135


>gi|149241886|pdb|2H72|A Chain A, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal
           (P61) Space Group
 gi|149241887|pdb|2H72|B Chain B, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGDVAATKV-GALSKGQLKEFL 103


>gi|300310194|ref|YP_003774286.1| thioredoxin 1 [Herbaspirillum seropedicae SmR1]
 gi|300072979|gb|ADJ62378.1| thioredoxin 1 (redox factor) protein [Herbaspirillum seropedicae
           SmR1]
          Length = 108

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI++++A E   K++I KLD++ +  I  ++
Sbjct: 12  SFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLDVDANQAIPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTLILFK+G    + + GA ++  ++ +I S +
Sbjct: 72  GIRGIPTLILFKNGAAAAQKV-GALAKGQLVSFIDSNI 108


>gi|238755776|ref|ZP_04617108.1| Thioredoxin-1 [Yersinia ruckeri ATCC 29473]
 gi|238706003|gb|EEP98388.1| Thioredoxin-1 [Yersinia ruckeri ATCC 29473]
          Length = 108

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 61/90 (67%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+     +VDFWA WC PC  ++PI+D+IADE   K+ I KL+I+E+   + +Y
Sbjct: 12  SFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIAKLNIDENPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            I  IPTL+LFKDG V    + GA S+S +
Sbjct: 72  GIRGIPTLLLFKDGAVAATKV-GALSKSQL 100


>gi|15615660|ref|NP_243964.1| thioredoxin [Bacillus halodurans C-125]
 gi|10175720|dbj|BAB06817.1| thioredoxin [Bacillus halodurans C-125]
          Length = 104

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 64/89 (71%), Gaps = 2/89 (2%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  ++F  E  E    V+ DFWA WC PC  ++P+++++  E+ DKVKI KLD++
Sbjct: 1  MAIVNVTDQTFAQETSE--GLVLADFWAPWCGPCKMIAPVLEELDGEMGDKVKIAKLDVD 58

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRM 89
          E+ E ++++ + SIPTLI+FKDG+V+D++
Sbjct: 59 ENQETASKFNVMSIPTLIVFKDGQVVDQV 87


>gi|255656955|ref|ZP_05402364.1| thioredoxin [Clostridium difficile QCD-23m63]
 gi|296452203|ref|ZP_06893911.1| thioredoxin [Clostridium difficile NAP08]
 gi|296877557|ref|ZP_06901588.1| thioredoxin [Clostridium difficile NAP07]
 gi|296258942|gb|EFH05829.1| thioredoxin [Clostridium difficile NAP08]
 gi|296431408|gb|EFH17224.1| thioredoxin [Clostridium difficile NAP07]
          Length = 105

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 63/85 (74%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          ++   F +EV      VVVDF+A+WC PC  LSPI + + DE+A+K K  K+DI++S E+
Sbjct: 5  INHNEFINEVENKDGLVVVDFFATWCGPCKMLSPIYEALGDEMAEKAKFLKVDIDQSIEL 64

Query: 66 STRYQISSIPTLILFKDGKVIDRMM 90
          + ++++S++PT+++FKDGK +DR++
Sbjct: 65 AQKFEVSTVPTMMIFKDGKPVDRLI 89


>gi|163738013|ref|ZP_02145429.1| thioredoxin [Phaeobacter gallaeciensis BS107]
 gi|163742591|ref|ZP_02149977.1| thioredoxin [Phaeobacter gallaeciensis 2.10]
 gi|161384176|gb|EDQ08559.1| thioredoxin [Phaeobacter gallaeciensis 2.10]
 gi|161388629|gb|EDQ12982.1| thioredoxin [Phaeobacter gallaeciensis BS107]
          Length = 106

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A E  DKVKI K+D++
Sbjct: 1   MSTVAVTDATFDAEVKNSEVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   ++   +  IP L +FK+G+V+     GA+ ++ +  WI
Sbjct: 61  SNPNAASAMGVRGIPALFIFKNGEVVSNRS-GAAPKAALQSWI 102


>gi|327400911|ref|YP_004341750.1| thioredoxin [Archaeoglobus veneficus SNP6]
 gi|327316419|gb|AEA47035.1| thioredoxin [Archaeoglobus veneficus SNP6]
          Length = 134

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 70/100 (70%), Gaps = 2/100 (2%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++V+  +FD EV+  +  VVVDFWA WC PC  L+P+I+++A E A KV   K++ +E+ 
Sbjct: 31  VEVNLFNFD-EVISNNENVVVDFWAEWCGPCRMLAPVIEELAKEYAGKVLFAKVNTDENE 89

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +++R+ IS+IPTLI FK GK +D ++ GA  +S++  WI
Sbjct: 90  VLASRFGISAIPTLIYFKRGKPVDSIV-GALPKSELKRWI 128


>gi|123966384|ref|YP_001011465.1| thioredoxin [Prochlorococcus marinus str. MIT 9515]
 gi|123200750|gb|ABM72358.1| Thioredoxin [Prochlorococcus marinus str. MIT 9515]
          Length = 107

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SFD EVL+   PV+VDFWA WC PC  ++P++++I+ +   K+K+ KL+ +E
Sbjct: 3  SAPAVTDSSFDKEVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMIFKGGQKVDTVV 91


>gi|283786197|ref|YP_003366062.1| thioredoxin 2 [Citrobacter rodentium ICC168]
 gi|282949651|emb|CBG89270.1| thioredoxin 2 [Citrobacter rodentium ICC168]
          Length = 171

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A+E + KV+  K++ 
Sbjct: 65  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNT 124

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 125 EAERELSARFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 167


>gi|228471874|ref|ZP_04056645.1| thioredoxin [Capnocytophaga gingivalis ATCC 33624]
 gi|228276804|gb|EEK15507.1| thioredoxin [Capnocytophaga gingivalis ATCC 33624]
          Length = 105

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 62/88 (70%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   SF+  VL+   PV+VDFWA+WC PC  L P+I++IA E   +V + K+D++ +
Sbjct: 2  ALQITDASFEEVVLKSDKPVLVDFWATWCGPCRMLGPVIEEIATEYEGRVVVGKVDVDSN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E + +Y + +IPT+++F++G+V+ R +
Sbjct: 62 QEYAAKYGVRNIPTVLVFQNGEVVGRQV 89


>gi|152971436|ref|YP_001336545.1| thioredoxin 2 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206576298|ref|YP_002237076.1| putative thioredoxin [Klebsiella pneumoniae 342]
 gi|238896031|ref|YP_002920767.1| thioredoxin 2 [Klebsiella pneumoniae NTUH-K2044]
 gi|262040315|ref|ZP_06013566.1| thioredoxin 2 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|288934039|ref|YP_003438098.1| thioredoxin [Klebsiella variicola At-22]
 gi|290508235|ref|ZP_06547606.1| thioredoxin 2 [Klebsiella sp. 1_1_55]
 gi|330007672|ref|ZP_08306012.1| thioredoxin [Klebsiella sp. MS 92-3]
 gi|150956285|gb|ABR78315.1| putative thioredoxin-like protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206565356|gb|ACI07132.1| putative thioredoxin [Klebsiella pneumoniae 342]
 gi|238548349|dbj|BAH64700.1| putative thioredoxin-like protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042424|gb|EEW43444.1| thioredoxin 2 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|288888768|gb|ADC57086.1| thioredoxin [Klebsiella variicola At-22]
 gi|289777629|gb|EFD85626.1| thioredoxin 2 [Klebsiella sp. 1_1_55]
 gi|328535395|gb|EGF61876.1| thioredoxin [Klebsiella sp. MS 92-3]
          Length = 141

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PC   +PI +D+A+E + K++  K++ E   E+S R++I SIPT+++F
Sbjct: 54  PVVVDFWAPWCGPCRSFAPIFEDVAEERSGKMRFVKVNTEAERELSARFRIRSIPTIMMF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+VID M+ GA  ++    W+
Sbjct: 114 KNGEVID-MLNGAVPKAPFDSWL 135


>gi|149912865|ref|ZP_01901399.1| thioredoxin [Roseobacter sp. AzwK-3b]
 gi|149813271|gb|EDM73097.1| thioredoxin [Roseobacter sp. AzwK-3b]
          Length = 106

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V  ++FD+EV     PVVVDFWA WC PC ++ P ++++++E+  KVKI K+D++
Sbjct: 1   MGTVAVTDETFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELSEEMGGKVKIAKIDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FK+G+VI     GA+ ++ +  WI S +
Sbjct: 61  SNPNTAAAMGVRGIPALFIFKNGEVISNRA-GAAPKAALQNWIESSI 106


>gi|113476828|ref|YP_722889.1| thioredoxin [Trichodesmium erythraeum IMS101]
 gi|110167876|gb|ABG52416.1| thioredoxin [Trichodesmium erythraeum IMS101]
          Length = 109

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 65/90 (72%), Gaps = 1/90 (1%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SF  EVLE + PV+VDFWA WC PC  ++P+++DI+ +   +VK+ KL+ +E+  ++++Y
Sbjct: 11 SFKEEVLESNIPVLVDFWAPWCGPCRMVAPVVEDISKQYEGQVKVVKLNTDENPNVASQY 70

Query: 70 QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 71 GIRSIPTLMIFKGGERVD-MVVGAVPKTTL 99


>gi|326317087|ref|YP_004234759.1| thioredoxin [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373923|gb|ADX46192.1| thioredoxin [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 110

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F   VL+ S PV+VDFWA WC PC +L PI+DDI++E A + +I K++ +E+ + + ++
Sbjct: 12  TFSEHVLQSSGPVLVDFWAEWCAPCKQLLPIVDDISEEYAGEARICKINADENKDTAQQF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Q+  +PT+ILF DGK   R++ G  S++ I + I
Sbjct: 72  QVRGLPTMILFVDGKEKARLV-GLVSKTRIAQII 104


>gi|296104255|ref|YP_003614401.1| thioredoxin 2 [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295058714|gb|ADF63452.1| thioredoxin 2 [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 139

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PC   +PI +D+A+E + K++  K++ E   E+S R++I SIPT+++F
Sbjct: 54  PVVVDFWAPWCGPCRNFAPIFEDVAEERSGKMRFVKVNTEAERELSARFRIRSIPTIMIF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+VID M+ GA  ++    W+
Sbjct: 114 KNGEVID-MLNGAVPKAPFESWL 135


>gi|283787537|ref|YP_003367402.1| thioredoxin 1 [Citrobacter rodentium ICC168]
 gi|282950991|emb|CBG90668.1| thioredoxin 1 [Citrobacter rodentium ICC168]
          Length = 109

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LF++G+V    + GA S+  + E++ + +
Sbjct: 72  GIRGIPTLLLFRNGEVAATKV-GALSKGQLKEFLDANI 108


>gi|171909709|ref|ZP_02925179.1| thioredoxin [Verrucomicrobium spinosum DSM 4136]
          Length = 106

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 72/106 (67%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M A+++ ++SFD  +   S PV+VDF A WC PC  +SP+I+ +A E   +  + K++++
Sbjct: 1   MKAIELSSQSFDRTLASTSQPVLVDFHAEWCGPCRMMSPVIEQVAGEQQGRAVVAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ +++ RY ISSIPTLI+FKD + +  +  GA S+S  IE +++R
Sbjct: 61  DAPDLAQRYGISSIPTLIVFKDAQPVATVR-GAQSKS-AIESLIAR 104


>gi|110597395|ref|ZP_01385682.1| thioredoxin [Chlorobium ferrooxidans DSM 13031]
 gi|110340939|gb|EAT59410.1| thioredoxin [Chlorobium ferrooxidans DSM 13031]
          Length = 109

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 68/95 (71%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F +E+L+ S   +VDFWA+WC PC+ L P+I+++A +   K  I KL+++E+   + +
Sbjct: 11  QNFQAEILDSSKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAVIAKLNVDENPATAAK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y I SIP+L++FK+G+V+D+++ GA  ++ I + I
Sbjct: 71  YGIRSIPSLLIFKNGQVVDQLL-GAVPKNQIAKKI 104


>gi|27364380|ref|NP_759908.1| thioredoxin [Vibrio vulnificus CMCP6]
 gi|320157763|ref|YP_004190142.1| thioredoxin [Vibrio vulnificus MO6-24/O]
 gi|27360499|gb|AAO09435.1| thioredoxin [Vibrio vulnificus CMCP6]
 gi|319933075|gb|ADV87939.1| thioredoxin [Vibrio vulnificus MO6-24/O]
          Length = 108

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++  + F+++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+I+ ++
Sbjct: 6   LQLSDEGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDHNA 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 66  GTPPKFGIRGIPTLLLFKNGSVAATKV-GALSKTQLKEFL 104


>gi|319763163|ref|YP_004127100.1| thioredoxin [Alicycliphilus denitrificans BC]
 gi|330825226|ref|YP_004388529.1| thioredoxin [Alicycliphilus denitrificans K601]
 gi|317117724|gb|ADV00213.1| thioredoxin [Alicycliphilus denitrificans BC]
 gi|329310598|gb|AEB85013.1| thioredoxin [Alicycliphilus denitrificans K601]
          Length = 110

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+ S PV+VD+WA WC PC  ++PI+D++A     K+++ K++++++ EI  ++
Sbjct: 13  SFEADVLKSSTPVLVDYWAEWCGPCKMIAPILDEVASAYQGKLQVAKMNVDDNREIPAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG++    + GA S++ +  +I
Sbjct: 73  GIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFI 105


>gi|292670657|ref|ZP_06604083.1| thioredoxin-1 [Selenomonas noxia ATCC 43541]
 gi|292647684|gb|EFF65656.1| thioredoxin-1 [Selenomonas noxia ATCC 43541]
          Length = 103

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 69/96 (71%), Gaps = 1/96 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+  +V  K+F++EVL+    VVVDFWA WC PC+ L+PI+ ++A+E  D +KI K++++
Sbjct: 1  MAVAEVTGKTFEAEVLQADQWVVVDFWADWCTPCLMLTPILKELAEERKD-IKICKINVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96
           + +I+ +Y++ S+P +ILFKDG+ +D ++   S +
Sbjct: 60 GAQDIAGKYEVMSLPHIILFKDGEPVDELIGMVSKE 95


>gi|226362883|ref|YP_002780663.1| thioredoxin [Rhodococcus opacus B4]
 gi|226241370|dbj|BAH51718.1| thioredoxin [Rhodococcus opacus B4]
          Length = 107

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SF  +V+    PV+VDFWA+WC PC  ++P++++IA E +DK+ I KLDI+ +   +  +
Sbjct: 11 SFQQDVISSDKPVLVDFWATWCGPCKMIAPVLEEIAGEHSDKLTIAKLDIDANPGAARDF 70

Query: 70 QISSIPTLILFKDGKVIDRMM 90
          Q+ SIPTLILFKDGK I+ ++
Sbjct: 71 QVMSIPTLILFKDGKPINTIV 91


>gi|25029490|ref|NP_739544.1| putative thioredoxin [Corynebacterium efficiens YS-314]
 gi|259508328|ref|ZP_05751228.1| thioredoxin-1 [Corynebacterium efficiens YS-314]
 gi|23494779|dbj|BAC19744.1| putative thioredoxin [Corynebacterium efficiens YS-314]
 gi|259164085|gb|EEW48639.1| thioredoxin-1 [Corynebacterium efficiens YS-314]
          Length = 107

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V  ++F S V+E   PV+VDFWA WC PC KLSPII++IA E  DK+ +  +D++ 
Sbjct: 3   NVIAVTEQTFKSTVVESDKPVLVDFWAEWCGPCKKLSPIIEEIAGEYGDKIVVASVDVDA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
              +   +QI SIP++++FK G+ +D  + G   +++I+
Sbjct: 63  ERTLGAMFQIMSIPSVLIFKGGQKVDEFV-GLRPKTEIV 100


>gi|330447974|ref|ZP_08311622.1| thioredoxin [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328492165|dbj|GAA06119.1| thioredoxin [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 144

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +LE   PVVVDFWA WC PCV  +P+  D++ E   + +  K+D E+   ++ +Y+I 
Sbjct: 49  STLLESDKPVVVDFWAPWCNPCVGFAPVFSDVSKERDGEARFVKIDTEDQQALAAQYRIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK GK++D M+ GA  +S   +W+
Sbjct: 109 SIPTIMVFKGGKMVD-MLNGALPKSHFDQWL 138


>gi|121594698|ref|YP_986594.1| thioredoxin [Acidovorax sp. JS42]
 gi|222110698|ref|YP_002552962.1| thioredoxin [Acidovorax ebreus TPSY]
 gi|120606778|gb|ABM42518.1| thioredoxin [Acidovorax sp. JS42]
 gi|221730142|gb|ACM32962.1| thioredoxin [Acidovorax ebreus TPSY]
          Length = 110

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VD+WA WC PC  ++PI+D++A     K+ I K++++E+ EI  ++
Sbjct: 13  SFEADVLKAGTPVLVDYWAEWCGPCKMIAPILDEVAGAYQGKLTIAKMNVDENREIPAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G++    + GA S++ +  +I
Sbjct: 73  GIRGIPTLMLFKNGELAATKV-GAMSKAQLTAFI 105


>gi|86607693|ref|YP_476455.1| thioredoxin [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556235|gb|ABD01192.1| thioredoxin [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 113

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 62/86 (72%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A+ +   +F++EVL    PV+VDFWA WC PC  ++P++ +IA++   KVK+ K++ +E
Sbjct: 3  AAIDIADATFEAEVLRSDIPVLVDFWAPWCGPCRMVAPVVQEIAEQYVGKVKVVKINTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVID 87
          + + +++Y I SIPTL+LFK G+ +D
Sbjct: 63 NPQTASQYGIRSIPTLMLFKGGQKVD 88


>gi|325104968|ref|YP_004274622.1| thioredoxin [Pedobacter saltans DSM 12145]
 gi|324973816|gb|ADY52800.1| thioredoxin [Pedobacter saltans DSM 12145]
          Length = 106

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F+  VL+   PV+VDFWA WC PC  + P+++++A E   K  + K++++ +
Sbjct: 2  ALEITDANFEELVLKSDKPVLVDFWAEWCGPCRMVGPVVEELAKEYEGKAVVGKVNVDHN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          SEIS ++ I +IPTL++FK+G+++D+ + GA  +S
Sbjct: 62 SEISAKFGIRNIPTLLVFKNGEIVDKQV-GAVPKS 95


>gi|167036263|ref|YP_001671494.1| thioredoxin [Pseudomonas putida GB-1]
 gi|166862751|gb|ABZ01159.1| thioredoxin [Pseudomonas putida GB-1]
          Length = 108

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+++VL+   PV+VD+WA WC PC  ++P++DDIA     K+ + KL+I+E+ E
Sbjct: 7   HVTDASFEADVLQAQGPVLVDYWAEWCGPCKMIAPVLDDIAATYEGKLTVAKLNIDENQE 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 67  TPAKHGVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFL 104


>gi|254226184|ref|ZP_04919779.1| thioredoxin 2 [Vibrio cholerae V51]
 gi|125621286|gb|EAZ49625.1| thioredoxin 2 [Vibrio cholerae V51]
          Length = 144

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T++  S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E    ++ 
Sbjct: 44  TEANFSALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQLRCVKIDTEAQQNLAA 103

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +QI SIPT+++FK+G+ ID M+ GA  +S   +W+
Sbjct: 104 HFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWL 138


>gi|331654045|ref|ZP_08355046.1| thioredoxin [Escherichia coli M718]
 gi|331048894|gb|EGI20970.1| thioredoxin [Escherichia coli M718]
          Length = 139

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+R+ I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 135


>gi|78213462|ref|YP_382241.1| thioredoxin [Synechococcus sp. CC9605]
 gi|78197921|gb|ABB35686.1| thioredoxin [Synechococcus sp. CC9605]
          Length = 124

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 63/89 (70%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+++IA E   ++K+ KL+ +E
Sbjct: 20  SAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVEEIAKEFDGQIKVFKLNTDE 79

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMM 90
           +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 80  NPNVASQYGIRSIPTLMVFKGGQKVDTVV 108


>gi|331268456|ref|YP_004394948.1| thioredoxin [Clostridium botulinum BKT015925]
 gi|329125006|gb|AEB74951.1| thioredoxin [Clostridium botulinum BKT015925]
          Length = 105

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 64/97 (65%), Gaps = 1/97 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           ++   +F  EV+     VVVDFWA WC PC  L P+++++A ++  K K  K++++E+ E
Sbjct: 4   EIGQSNFAKEVINSEEAVVVDFWAPWCGPCKMLGPVMEELAHDMGHKAKFFKINVDENPE 63

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           I+ + QISSIP +++FK+GKV++ M+ G   + D  E
Sbjct: 64  IAQKLQISSIPNVMVFKEGKVVENMV-GFRPKKDFKE 99


>gi|119475469|ref|ZP_01615822.1| thioredoxin [marine gamma proteobacterium HTCC2143]
 gi|119451672|gb|EAW32905.1| thioredoxin [marine gamma proteobacterium HTCC2143]
          Length = 108

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+S+VL    PV+VDFWA WC PC  ++P+I +IA+E   K+K+ K+D++ ++
Sbjct: 6   VHVTDASFESDVLGADVPVLVDFWAEWCGPCKMIAPVIAEIANEYEGKLKVCKVDVDANT 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E + ++ I  IPTL++FK+G   +    GA S++ + E+I S +
Sbjct: 66  ETAPKFGIRGIPTLMIFKNGNA-EATKVGALSKTQLTEFITSAL 108


>gi|108803844|ref|YP_643781.1| thioredoxin [Rubrobacter xylanophilus DSM 9941]
 gi|108765087|gb|ABG03969.1| thioredoxin [Rubrobacter xylanophilus DSM 9941]
          Length = 110

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V   SF+ EVLE   PV+VDFWA WC PC +L P+I+++A E A +VK+ K+D++  S
Sbjct: 5  VAVTVDSFEREVLESEVPVLVDFWAEWCPPCRQLEPVIEELAREYAGRVKVAKVDVDAES 64

Query: 64 EISTRYQISSIPTLILFKDGK 84
           ++ R+ ISSIPT+  F+ G+
Sbjct: 65 SLAGRFGISSIPTIAFFEPGE 85


>gi|253682239|ref|ZP_04863036.1| thioredoxin [Clostridium botulinum D str. 1873]
 gi|253561951|gb|EES91403.1| thioredoxin [Clostridium botulinum D str. 1873]
          Length = 105

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 65/97 (67%), Gaps = 1/97 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           ++   +F  EV++    VVVDFWA WC PC  L P+++++A ++  K K  K++++E+ E
Sbjct: 4   EIGQSNFAKEVIDSEEAVVVDFWAPWCGPCKMLGPVMEELAHDMGHKAKFFKINVDENPE 63

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           I+ + QISSIP +++FK+GKV++ M+ G   + D  E
Sbjct: 64  IAQKLQISSIPNVMVFKEGKVVENMV-GFRPKKDFKE 99


>gi|225629621|ref|ZP_03787628.1| thioredoxin [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225591526|gb|EEH12559.1| thioredoxin [Wolbachia endosymbiont of Muscidifurax uniraptor]
          Length = 107

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 68/102 (66%), Gaps = 3/102 (2%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+ ++F SEV +    V++DFWA WC PC  L P I+ +A +   K+KI K DI+E +E+
Sbjct: 8   VNDQNFKSEVTDYKGFVLIDFWAEWCGPCKSLMPRIEQLAKDRKGKIKICKFDIDEGTEV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++Y + SIPTLI+F+DGK I R + GA+  +D+  W+ S +
Sbjct: 68  PSKYGVQSIPTLIIFQDGKEIARKI-GAT--NDLSSWVDSEI 106


>gi|197116802|ref|YP_002137229.1| thioredoxin [Geobacter bemidjiensis Bem]
 gi|197086162|gb|ACH37433.1| thioredoxin [Geobacter bemidjiensis Bem]
          Length = 109

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 60/81 (74%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F+ EVL+ + PV+VDFWA+WC PC  ++P+ID IA E   ++K+ K++++++     +Y
Sbjct: 13 NFEKEVLQSNIPVLVDFWATWCAPCKAIAPLIDTIASEYDGRIKVGKVNVDDNPGTPAKY 72

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           +  IPT+IL KDGKV+D+++
Sbjct: 73 GVRGIPTVILLKDGKVVDQVV 93


>gi|89067402|ref|ZP_01154915.1| thioredoxin [Oceanicola granulosus HTCC2516]
 gi|89046971|gb|EAR53025.1| thioredoxin [Oceanicola granulosus HTCC2516]
          Length = 106

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FDSEV +   PVVVDFWA WC PC ++ P +++IA E+  KVKI K++++
Sbjct: 1   MATVAVTDDTFDSEVRQSDIPVVVDFWAEWCGPCKQIGPALEEIAAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +  I  IP L +FKDG+V+     GA+ ++ +  WI
Sbjct: 61  ENPNSPAQMGIRGIPALFIFKDGEVVSNRA-GAAPKAALQGWI 102


>gi|310642076|ref|YP_003946834.1| thiol-disulfide isomerase and thioredoxin [Paenibacillus polymyxa
           SC2]
 gi|309247026|gb|ADO56593.1| Thiol-disulfide isomerase and thioredoxin [Paenibacillus polymyxa
           SC2]
          Length = 105

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 68/101 (67%), Gaps = 4/101 (3%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA  +  ++F++++   S   +VDFWA WC PC    PII  +AD+L +K  I  ++++
Sbjct: 1   MSATALTNQTFNNQIQ--SGITLVDFWAPWCGPCQIQLPIIHQLADDLKEKATIATINVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E +E++TR+ I SIP L+LF+DGK++D M+    +Q D++E
Sbjct: 59  EQTELATRFGIRSIPALLLFQDGKLMDTMI--GINQRDVLE 97


>gi|94970094|ref|YP_592142.1| thioredoxin [Candidatus Koribacter versatilis Ellin345]
 gi|94552144|gb|ABF42068.1| thioredoxin [Candidatus Koribacter versatilis Ellin345]
          Length = 109

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 61/87 (70%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          ++V   +FD  VL+   PV++DFWA+WC PC  L+PI+D++A     KV + K+D+++++
Sbjct: 7  VEVTDSNFDQLVLKSDKPVLIDFWAAWCGPCKALAPIVDEVAQSYNGKVTVGKMDVDKNA 66

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
             +RY I  IPTL+LFK G+V ++++
Sbjct: 67 ATPSRYGIRGIPTLLLFKGGQVQEQIV 93


>gi|325066334|ref|ZP_08125007.1| thioredoxin [Actinomyces oris K20]
 gi|326772855|ref|ZP_08232139.1| thioredoxin [Actinomyces viscosus C505]
 gi|326637487|gb|EGE38389.1| thioredoxin [Actinomyces viscosus C505]
          Length = 108

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL V   +F+ EVL+   PVV+DFWA WC PC +++PI+D++A +  DKVK  K+D++ +
Sbjct: 4   ALAVTDATFEEEVLKSEVPVVIDFWAQWCGPCRQMAPIVDEVAADFGDKVKFVKVDVDAN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDI 99
              +  Y + SIPT  + +DG+V  +     P AS ++++
Sbjct: 64  PATARSYGVRSIPTFAVVRDGEVFHQFAGSRPKASFKAEV 103


>gi|288553652|ref|YP_003425587.1| thioredoxin [Bacillus pseudofirmus OF4]
 gi|288544812|gb|ADC48695.1| thioredoxin [Bacillus pseudofirmus OF4]
          Length = 104

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 64/90 (71%), Gaps = 2/90 (2%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  ++F SE  E    V+ DFWA WC PC  ++P+++++  E+ DKVKI KLD++
Sbjct: 1  MAIVNVTDQTFASETSE--GVVLADFWAPWCGPCKMIAPVLEELDTEMGDKVKIAKLDVD 58

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ E + +Y + SIPTL++FKDG V+D+++
Sbjct: 59 ENQETAGKYSVMSIPTLLVFKDGDVVDQVV 88


>gi|254500797|ref|ZP_05112948.1| thioredoxin, putative [Labrenzia alexandrii DFL-11]
 gi|222436868|gb|EEE43547.1| thioredoxin, putative [Labrenzia alexandrii DFL-11]
          Length = 314

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 6   VDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           V T++F ++V+E S   PV+VDFWA WC PC +L+P+I+D        VK+ K++I++  
Sbjct: 32  VTTQTFMADVMEASRQQPVLVDFWAPWCGPCKQLTPLIEDAVKAAGGAVKLAKMNIDDHP 91

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           EI+ +  I SIP +I FKDG+ +D  M GA  +S I  +I
Sbjct: 92  EIAGQMGIQSIPAVIAFKDGQPVDGFM-GAQPESQIKAFI 130


>gi|15896334|ref|NP_349683.1| thioredoxin [Clostridium acetobutylicum ATCC 824]
 gi|15026147|gb|AAK81023.1|AE007805_4 Thioredoxin [Clostridium acetobutylicum ATCC 824]
 gi|325510490|gb|ADZ22126.1| Thioredoxin [Clostridium acetobutylicum EA 2018]
          Length = 105

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 61/87 (70%)

Query: 11 FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
          FD E+     PV+VDFWA WC PC  L PIID+++++L  K K TK++++E+  I++++ 
Sbjct: 10 FDEEIKTSGEPVIVDFWAPWCGPCKMLGPIIDELSEDLDGKAKFTKVNVDENPGIASKFG 69

Query: 71 ISSIPTLILFKDGKVIDRMMPGASSQS 97
          I+SIPT+++FKDG  ++ ++     QS
Sbjct: 70 IASIPTVMIFKDGNPVETLVGFRPKQS 96


>gi|302876483|ref|YP_003845116.1| thioredoxin [Clostridium cellulovorans 743B]
 gi|307687154|ref|ZP_07629600.1| thioredoxin [Clostridium cellulovorans 743B]
 gi|302579340|gb|ADL53352.1| thioredoxin [Clostridium cellulovorans 743B]
          Length = 104

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PC  L P+I+++A E+ DKVK  K++++E+   +  ++++SIPTLI+ 
Sbjct: 19  PVVVDFWAPWCGPCKMLGPVIEELASEMGDKVKFAKINVDENPVTANTFRVASIPTLIIV 78

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           KDGKV+D+ + G   +  +  WI
Sbjct: 79  KDGKVVDQSL-GFKPKPALAAWI 100


>gi|33865258|ref|NP_896817.1| thioredoxin [Synechococcus sp. WH 8102]
 gi|260436036|ref|ZP_05790006.1| thioredoxin [Synechococcus sp. WH 8109]
 gi|33632427|emb|CAE07239.1| Thioredoxin [Synechococcus sp. WH 8102]
 gi|260413910|gb|EEX07206.1| thioredoxin [Synechococcus sp. WH 8109]
          Length = 107

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+++IA E   ++K+ KL+ +E
Sbjct: 3  SAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVEEIAKEFDGQIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMVFKGGQKVDTVV 91


>gi|300791153|ref|YP_003771444.1| thioredoxin [Amycolatopsis mediterranei U32]
 gi|299800667|gb|ADJ51042.1| thioredoxin [Amycolatopsis mediterranei U32]
          Length = 107

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 67/101 (66%), Gaps = 3/101 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   +F  EVL    PV+VDFWA+WC PC  ++P++++IA E  +K+ I K+DI+E
Sbjct: 3   NTVKVTDATFVDEVLTSEKPVLVDFWATWCGPCKMVAPVLEEIAAENGEKLTIAKIDIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDI 99
           +      YQ+ SIPTLILF+ GK + +++   P A+  SD+
Sbjct: 63  NPNTPRDYQVMSIPTLILFQGGKPVKQIVGAKPKAALLSDL 103


>gi|284042122|ref|YP_003392462.1| thioredoxin [Conexibacter woesei DSM 14684]
 gi|283946343|gb|ADB49087.1| thioredoxin [Conexibacter woesei DSM 14684]
          Length = 150

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 62/94 (65%), Gaps = 2/94 (2%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD  +   S PV+VDFWA WC PC  +SP+++ I  + A ++K+ KLD E + +I+ R+
Sbjct: 45  TFDGAI-AASVPVLVDFWADWCGPCRMVSPLVERIGHDYAGRLKVVKLDTEAAPQIAARF 103

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           QI SIP L+LF+DG  + R++ GA   + +  WI
Sbjct: 104 QIRSIPLLVLFRDGDEVARLI-GAHPDAQLRAWI 136


>gi|253699054|ref|YP_003020243.1| thioredoxin [Geobacter sp. M21]
 gi|251773904|gb|ACT16485.1| thioredoxin [Geobacter sp. M21]
          Length = 109

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 60/81 (74%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F+ EVL+ + PV+VDFWA+WC PC  ++P+ID +A E   ++K+ K++++++     +Y
Sbjct: 13 NFEKEVLQSNIPVLVDFWATWCAPCKAIAPLIDTVAAEYEGRIKVGKVNVDDNPGTPAKY 72

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           +  IPT+IL KDGKV+D+++
Sbjct: 73 GVRGIPTVILLKDGKVVDQVV 93


>gi|120597337|ref|YP_961911.1| thioredoxin [Shewanella sp. W3-18-1]
 gi|146294518|ref|YP_001184942.1| thioredoxin [Shewanella putrefaciens CN-32]
 gi|120557430|gb|ABM23357.1| thioredoxin [Shewanella sp. W3-18-1]
 gi|145566208|gb|ABP77143.1| thioredoxin [Shewanella putrefaciens CN-32]
 gi|319427883|gb|ADV55957.1| thioredoxin [Shewanella putrefaciens 200]
          Length = 108

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
            F+++VL+   PV+VDFWA WC PC  ++PI+DD+A+E A +V I KL++++++    +Y
Sbjct: 12  GFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVAEEYAGRVTIAKLNVDQNNVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTL+LFK+G++    + GA S++ + E+I +++
Sbjct: 72  GVRGIPTLLLFKNGELAATKV-GALSKTQLKEFIDAQI 108


>gi|304398700|ref|ZP_07380572.1| thioredoxin [Pantoea sp. aB]
 gi|304353911|gb|EFM18286.1| thioredoxin [Pantoea sp. aB]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  ++           PVV+DFWA WC PCV  +P+  D+A E + KV+  K++ 
Sbjct: 33  FDGEVVNATSANFDKYLQDDLPVVIDFWAPWCGPCVNFAPVFKDVASERSGKVRFIKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E    +S R+ I SIPT++LFK+G+ +D M+ GA  ++   EW+
Sbjct: 93  EAEPALSARFNIRSIPTIMLFKNGERVD-MLNGAMPKAPFNEWL 135


>gi|251787807|ref|YP_003002528.1| thioredoxin [Dickeya zeae Ech1591]
 gi|247536428|gb|ACT05049.1| thioredoxin [Dickeya zeae Ech1591]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL   +  +VDFWA WC PC  ++PI+D+IADE   K+KI KL+I+++   + +Y
Sbjct: 12  SFETDVLRSEHVTLVDFWADWCGPCKMIAPILDEIADEFEGKLKIAKLNIDDNPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|218706088|ref|YP_002413607.1| thioredoxin 2 [Escherichia coli UMN026]
 gi|293406025|ref|ZP_06650017.1| thioredoxin 2 [Escherichia coli FVEC1412]
 gi|298381825|ref|ZP_06991424.1| thioredoxin 2 [Escherichia coli FVEC1302]
 gi|300895651|ref|ZP_07114251.1| thioredoxin [Escherichia coli MS 198-1]
 gi|218433185|emb|CAR14083.1| thioredoxin 2 [Escherichia coli UMN026]
 gi|284922534|emb|CBG35621.1| thioredoxin 2 [Escherichia coli 042]
 gi|291428233|gb|EFF01260.1| thioredoxin 2 [Escherichia coli FVEC1412]
 gi|298279267|gb|EFI20781.1| thioredoxin 2 [Escherichia coli FVEC1302]
 gi|300360411|gb|EFJ76281.1| thioredoxin [Escherichia coli MS 198-1]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E + KV+  K++ 
Sbjct: 33  FDGEVINATGETFDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+R+ I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 135


>gi|160896701|ref|YP_001562283.1| thioredoxin [Delftia acidovorans SPH-1]
 gi|160362285|gb|ABX33898.1| thioredoxin [Delftia acidovorans SPH-1]
          Length = 144

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +D +SF   V     PVVVDFWA WC PC  ++P  +  A  LA  V++ KLD E   
Sbjct: 42  VALDAQSFARHVGRSQAPVVVDFWAPWCGPCRMMAPAFEQAAQALAPGVQLAKLDTEAHP 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +  + I SIPT+++FK+G+ I R+  GA    +I+ W+ S V
Sbjct: 102 QAAAPWNIRSIPTMVVFKEGREIARVS-GALPAGEIVRWVRSVV 144


>gi|297180921|gb|ADI17125.1| thiol-disulfide isomerase and thioredoxins [uncultured gamma
           proteobacterium HF0070_03O15]
          Length = 113

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 67/92 (72%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + VD ++F SEVL+    V+VDFWA WC PC +++P +D+I+++ ++ + + K+D++ +
Sbjct: 10  TISVDKETFSSEVLQNDKLVLVDFWAEWCGPCKQIAPRLDEISEKYSENLSVCKVDVDSN 69

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGAS 94
            E++ +Y + SIP+L++FK+G++ID +M   S
Sbjct: 70  RELALQYNVRSIPSLMIFKEGEMIDSLMGAVS 101


>gi|126663021|ref|ZP_01734019.1| thioredoxin [Flavobacteria bacterium BAL38]
 gi|126624679|gb|EAZ95369.1| thioredoxin [Flavobacteria bacterium BAL38]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 62/95 (65%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL +   +FD  VL+   PVVVDFWA+WC PC  + P+ID+I  E   K  + K+D++ +
Sbjct: 2  ALAITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPVIDEIHGEYEGKAVVGKVDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
           E + +Y + +IPT+++F++G+V+ R +  A  ++
Sbjct: 62 QEFAAKYGVRNIPTVLIFQNGEVVGRQVGVAPKKT 96


>gi|303232577|ref|ZP_07319263.1| thioredoxin [Atopobium vaginae PB189-T1-4]
 gi|302481364|gb|EFL44438.1| thioredoxin [Atopobium vaginae PB189-T1-4]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 63/88 (71%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A  + +  FDS +     PV+VDFWA+WC PC  L P+I++I+DE+++ + + K +++E 
Sbjct: 2  AQAITSSDFDSIITSSDLPVLVDFWATWCGPCRALGPVIEEISDEMSNSLAVYKCNVDEE 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E++ R+QI SIPT++LFK+G+V+  ++
Sbjct: 62 PELAQRFQIVSIPTVMLFKNGEVVHSLV 89


>gi|260769219|ref|ZP_05878152.1| thioredoxin 2 [Vibrio furnissii CIP 102972]
 gi|260614557|gb|EEX39743.1| thioredoxin 2 [Vibrio furnissii CIP 102972]
          Length = 144

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 64/94 (68%), Gaps = 2/94 (2%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD+ +L+ + PVVVDFWA WC PCV  +PI  D+A+    +V+  K+D E    ++ ++
Sbjct: 47  NFDA-LLQSAQPVVVDFWAPWCNPCVGFAPIFSDVAEARKGQVRFVKIDTESQQNLAAKF 105

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           QI SIPT+++FK+G+ +D ++ GA  +S   +W+
Sbjct: 106 QIRSIPTIMVFKNGQRVD-VINGALPKSQFDQWL 138


>gi|326791633|ref|YP_004309454.1| thioredoxin [Clostridium lentocellum DSM 5427]
 gi|326542397|gb|ADZ84256.1| thioredoxin [Clostridium lentocellum DSM 5427]
          Length = 103

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 62/87 (71%), Gaps = 1/87 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MS + +   +FD EV +   PV++DFWA WC PC  LSPI+D+IA+E    +K+ K++I+
Sbjct: 1  MSVINITKGNFDLEVKKADTPVLIDFWAPWCGPCRMLSPIVDEIANETTG-IKVCKVNID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVID 87
          E  E++  ++++SIPTL L KDG+++D
Sbjct: 60 EQPELAADFKVASIPTLALIKDGQLVD 86


>gi|256017268|ref|ZP_05431133.1| thioredoxin 2 [Shigella sp. D9]
 gi|332278260|ref|ZP_08390673.1| thioredoxin-2 [Shigella sp. D9]
 gi|332100612|gb|EGJ03958.1| thioredoxin-2 [Shigella sp. D9]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+R+ I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 135


>gi|163782120|ref|ZP_02177119.1| thioredoxin [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882652|gb|EDP76157.1| thioredoxin [Hydrogenivirga sp. 128-5-R1-1]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + +   +++ EV+    PV+VDFWA WC PC  ++PII+++A+E   ++K+ KL+ +E
Sbjct: 4   SVVTLTESNWNEEVVNSDKPVLVDFWAPWCGPCRIIAPIIEELAEEFEGQIKVGKLNTDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  I+ +Y I +IPT+ILFK+G+V+D  + G   +  + + +++ V
Sbjct: 64  NPNIAMQYGIRAIPTVILFKNGEVVDTRI-GVQPKEALKQMVMAHV 108


>gi|15803110|ref|NP_289141.1| thioredoxin 2 [Escherichia coli O157:H7 EDL933]
 gi|15832702|ref|NP_311475.1| thioredoxin 2 [Escherichia coli O157:H7 str. Sakai]
 gi|16130507|ref|NP_417077.1| thioredoxin 2 [Escherichia coli str. K-12 substr. MG1655]
 gi|24113923|ref|NP_708433.1| thioredoxin 2 [Shigella flexneri 2a str. 301]
 gi|26248948|ref|NP_754988.1| thioredoxin 2 [Escherichia coli CFT073]
 gi|30063983|ref|NP_838154.1| thioredoxin 2 [Shigella flexneri 2a str. 2457T]
 gi|74313145|ref|YP_311564.1| thioredoxin 2 [Shigella sonnei Ss046]
 gi|82778010|ref|YP_404359.1| thioredoxin 2 [Shigella dysenteriae Sd197]
 gi|89109388|ref|AP_003168.1| thioredoxin 2 [Escherichia coli str. K-12 substr. W3110]
 gi|91211910|ref|YP_541896.1| thioredoxin 2 [Escherichia coli UTI89]
 gi|110642744|ref|YP_670474.1| thioredoxin 2 [Escherichia coli 536]
 gi|110806526|ref|YP_690046.1| thioredoxin 2 [Shigella flexneri 5 str. 8401]
 gi|117624804|ref|YP_853717.1| thioredoxin 2 [Escherichia coli APEC O1]
 gi|157156661|ref|YP_001463906.1| thioredoxin 2 [Escherichia coli E24377A]
 gi|157162062|ref|YP_001459380.1| thioredoxin 2 [Escherichia coli HS]
 gi|168752075|ref|ZP_02777097.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4113]
 gi|168757752|ref|ZP_02782759.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4401]
 gi|168765023|ref|ZP_02790030.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4501]
 gi|168768688|ref|ZP_02793695.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4486]
 gi|168773488|ref|ZP_02798495.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4196]
 gi|168778562|ref|ZP_02803569.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4076]
 gi|168790384|ref|ZP_02815391.1| putative thioredoxin [Escherichia coli O157:H7 str. EC869]
 gi|168801702|ref|ZP_02826709.1| putative thioredoxin [Escherichia coli O157:H7 str. EC508]
 gi|170019135|ref|YP_001724089.1| thioredoxin 2 [Escherichia coli ATCC 8739]
 gi|170082191|ref|YP_001731511.1| thioredoxin 2 [Escherichia coli str. K-12 substr. DH10B]
 gi|170680235|ref|YP_001744771.1| thioredoxin 2 [Escherichia coli SMS-3-5]
 gi|187730887|ref|YP_001881367.1| thioredoxin 2 [Shigella boydii CDC 3083-94]
 gi|188494141|ref|ZP_03001411.1| thioredoxin [Escherichia coli 53638]
 gi|191167976|ref|ZP_03029778.1| putative thioredoxin [Escherichia coli B7A]
 gi|191174032|ref|ZP_03035549.1| putative thioredoxin [Escherichia coli F11]
 gi|193064037|ref|ZP_03045122.1| putative thioredoxin [Escherichia coli E22]
 gi|193068293|ref|ZP_03049256.1| putative thioredoxin [Escherichia coli E110019]
 gi|194429275|ref|ZP_03061802.1| putative thioredoxin [Escherichia coli B171]
 gi|194432141|ref|ZP_03064430.1| putative thioredoxin [Shigella dysenteriae 1012]
 gi|194437590|ref|ZP_03069686.1| putative thioredoxin [Escherichia coli 101-1]
 gi|195936730|ref|ZP_03082112.1| thioredoxin 2 [Escherichia coli O157:H7 str. EC4024]
 gi|208809450|ref|ZP_03251787.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4206]
 gi|208814511|ref|ZP_03255840.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4045]
 gi|208821538|ref|ZP_03261858.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4042]
 gi|209396514|ref|YP_002272057.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4115]
 gi|209920062|ref|YP_002294146.1| thioredoxin 2 [Escherichia coli SE11]
 gi|215487925|ref|YP_002330356.1| thioredoxin 2 [Escherichia coli O127:H6 str. E2348/69]
 gi|217327645|ref|ZP_03443728.1| putative thioredoxin [Escherichia coli O157:H7 str. TW14588]
 gi|218547891|ref|YP_002381682.1| thioredoxin 2 [Escherichia fergusonii ATCC 35469]
 gi|218555166|ref|YP_002388079.1| thioredoxin 2 [Escherichia coli IAI1]
 gi|218559504|ref|YP_002392417.1| thioredoxin 2 [Escherichia coli S88]
 gi|218696211|ref|YP_002403878.1| thioredoxin 2 [Escherichia coli 55989]
 gi|218701097|ref|YP_002408726.1| thioredoxin 2 [Escherichia coli IAI39]
 gi|227887618|ref|ZP_04005423.1| protein-disulfide reductase [Escherichia coli 83972]
 gi|237705092|ref|ZP_04535573.1| thioredoxin 2 [Escherichia sp. 3_2_53FAA]
 gi|238901747|ref|YP_002927543.1| thioredoxin 2 [Escherichia coli BW2952]
 gi|253772518|ref|YP_003035349.1| thioredoxin 2 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162557|ref|YP_003045665.1| thioredoxin 2 [Escherichia coli B str. REL606]
 gi|254794534|ref|YP_003079371.1| thioredoxin 2 [Escherichia coli O157:H7 str. TW14359]
 gi|256021731|ref|ZP_05435596.1| thioredoxin 2 [Escherichia sp. 4_1_40B]
 gi|260845268|ref|YP_003223046.1| thioredoxin 2 [Escherichia coli O103:H2 str. 12009]
 gi|260856676|ref|YP_003230567.1| thioredoxin 2 [Escherichia coli O26:H11 str. 11368]
 gi|260869268|ref|YP_003235670.1| thioredoxin 2 [Escherichia coli O111:H- str. 11128]
 gi|261222982|ref|ZP_05937263.1| thioredoxin 2 [Escherichia coli O157:H7 str. FRIK2000]
 gi|261259468|ref|ZP_05952001.1| thioredoxin 2 [Escherichia coli O157:H7 str. FRIK966]
 gi|291283859|ref|YP_003500677.1| Thioredoxin-2 [Escherichia coli O55:H7 str. CB9615]
 gi|293410998|ref|ZP_06654574.1| thioredoxin 2 [Escherichia coli B354]
 gi|293415851|ref|ZP_06658494.1| thioredoxin 2 [Escherichia coli B185]
 gi|293446937|ref|ZP_06663359.1| thioredoxin 2 [Escherichia coli B088]
 gi|297517287|ref|ZP_06935673.1| thioredoxin 2 [Escherichia coli OP50]
 gi|300817640|ref|ZP_07097855.1| thioredoxin [Escherichia coli MS 107-1]
 gi|300820737|ref|ZP_07100887.1| thioredoxin [Escherichia coli MS 119-7]
 gi|300904234|ref|ZP_07122093.1| thioredoxin [Escherichia coli MS 84-1]
 gi|300920750|ref|ZP_07137156.1| thioredoxin [Escherichia coli MS 115-1]
 gi|300927041|ref|ZP_07142793.1| thioredoxin [Escherichia coli MS 182-1]
 gi|300927709|ref|ZP_07143277.1| thioredoxin [Escherichia coli MS 187-1]
 gi|300935716|ref|ZP_07150685.1| thioredoxin [Escherichia coli MS 21-1]
 gi|300951697|ref|ZP_07165517.1| thioredoxin [Escherichia coli MS 116-1]
 gi|300958775|ref|ZP_07170888.1| thioredoxin [Escherichia coli MS 175-1]
 gi|300974113|ref|ZP_07172463.1| thioredoxin [Escherichia coli MS 200-1]
 gi|300982306|ref|ZP_07176014.1| thioredoxin [Escherichia coli MS 45-1]
 gi|301021931|ref|ZP_07185890.1| thioredoxin [Escherichia coli MS 196-1]
 gi|301024869|ref|ZP_07188506.1| thioredoxin [Escherichia coli MS 69-1]
 gi|301047221|ref|ZP_07194313.1| thioredoxin [Escherichia coli MS 185-1]
 gi|301302949|ref|ZP_07209077.1| thioredoxin [Escherichia coli MS 124-1]
 gi|301330316|ref|ZP_07222963.1| thioredoxin [Escherichia coli MS 78-1]
 gi|301648347|ref|ZP_07248087.1| thioredoxin [Escherichia coli MS 146-1]
 gi|306814354|ref|ZP_07448516.1| thioredoxin 2 [Escherichia coli NC101]
 gi|307139220|ref|ZP_07498576.1| thioredoxin 2 [Escherichia coli H736]
 gi|307313847|ref|ZP_07593463.1| thioredoxin [Escherichia coli W]
 gi|309784596|ref|ZP_07679231.1| thioredoxin [Shigella dysenteriae 1617]
 gi|309794363|ref|ZP_07688786.1| thioredoxin [Escherichia coli MS 145-7]
 gi|312965498|ref|ZP_07779730.1| thioredoxin [Escherichia coli 2362-75]
 gi|312973172|ref|ZP_07787344.1| thioredoxin [Escherichia coli 1827-70]
 gi|331643206|ref|ZP_08344341.1| thioredoxin [Escherichia coli H736]
 gi|331648329|ref|ZP_08349418.1| thioredoxin [Escherichia coli M605]
 gi|331664151|ref|ZP_08365061.1| thioredoxin [Escherichia coli TA143]
 gi|331669333|ref|ZP_08370181.1| thioredoxin [Escherichia coli TA271]
 gi|331674031|ref|ZP_08374794.1| thioredoxin [Escherichia coli TA280]
 gi|331678579|ref|ZP_08379254.1| thioredoxin [Escherichia coli H591]
 gi|84028854|sp|P0AGG6|THIO2_ECO57 RecName: Full=Thioredoxin-2; Short=Trx-2; AltName:
           Full=Protein-disulfide reductase
 gi|84028855|sp|P0AGG5|THIO2_ECOL6 RecName: Full=Thioredoxin-2; Short=Trx-2; AltName:
           Full=Protein-disulfide reductase
 gi|84028856|sp|P0AGG4|THIO2_ECOLI RecName: Full=Thioredoxin-2; Short=Trx-2; AltName:
           Full=Protein-disulfide reductase
 gi|84028857|sp|P0AGG7|THIO2_SHIFL RecName: Full=Thioredoxin-2; Short=Trx-2; AltName:
           Full=Protein-disulfide reductase
 gi|12517004|gb|AAG57699.1|AE005488_10 putative thioredoxin-like protein [Escherichia coli O157:H7 str.
           EDL933]
 gi|26109354|gb|AAN81556.1|AE016764_238 Thioredoxin 2 [Escherichia coli CFT073]
 gi|1788936|gb|AAC75635.1| thioredoxin 2 [Escherichia coli str. K-12 substr. MG1655]
 gi|2668567|gb|AAB88587.1| thioredoxin 2 [Escherichia coli]
 gi|13362919|dbj|BAB36871.1| putative thioredoxin-like protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|24053026|gb|AAN44140.1| putative thioredoxin-like protein [Shigella flexneri 2a str. 301]
 gi|30042239|gb|AAP17964.1| putative thioredoxin-like protein [Shigella flexneri 2a str. 2457T]
 gi|73856622|gb|AAZ89329.1| putative thioredoxin-like protein [Shigella sonnei Ss046]
 gi|81242158|gb|ABB62868.1| putative thioredoxin-like protein [Shigella dysenteriae Sd197]
 gi|85675470|dbj|BAA16469.2| thioredoxin 2 [Escherichia coli str. K12 substr. W3110]
 gi|91073484|gb|ABE08365.1| putative thioredoxin-like protein [Escherichia coli UTI89]
 gi|110344336|gb|ABG70573.1| thioredoxin 2 [Escherichia coli 536]
 gi|110616074|gb|ABF04741.1| putative thioredoxin-like protein [Shigella flexneri 5 str. 8401]
 gi|115513928|gb|ABJ02003.1| thioredoxin 2 [Escherichia coli APEC O1]
 gi|157067742|gb|ABV06997.1| putative thioredoxin [Escherichia coli HS]
 gi|157078691|gb|ABV18399.1| putative thioredoxin [Escherichia coli E24377A]
 gi|169754063|gb|ACA76762.1| thioredoxin [Escherichia coli ATCC 8739]
 gi|169890026|gb|ACB03733.1| thioredoxin 2 [Escherichia coli str. K-12 substr. DH10B]
 gi|170517953|gb|ACB16131.1| putative thioredoxin [Escherichia coli SMS-3-5]
 gi|187427879|gb|ACD07153.1| putative thioredoxin [Shigella boydii CDC 3083-94]
 gi|187770735|gb|EDU34579.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4196]
 gi|188014000|gb|EDU52122.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4113]
 gi|188489340|gb|EDU64443.1| thioredoxin [Escherichia coli 53638]
 gi|189003461|gb|EDU72447.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4076]
 gi|189355318|gb|EDU73737.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4401]
 gi|189362197|gb|EDU80616.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4486]
 gi|189365098|gb|EDU83514.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4501]
 gi|189370141|gb|EDU88557.1| putative thioredoxin [Escherichia coli O157:H7 str. EC869]
 gi|189376187|gb|EDU94603.1| putative thioredoxin [Escherichia coli O157:H7 str. EC508]
 gi|190901983|gb|EDV61730.1| putative thioredoxin [Escherichia coli B7A]
 gi|190905723|gb|EDV65345.1| putative thioredoxin [Escherichia coli F11]
 gi|192929272|gb|EDV82881.1| putative thioredoxin [Escherichia coli E22]
 gi|192958245|gb|EDV88685.1| putative thioredoxin [Escherichia coli E110019]
 gi|194412683|gb|EDX28978.1| putative thioredoxin [Escherichia coli B171]
 gi|194419670|gb|EDX35750.1| putative thioredoxin [Shigella dysenteriae 1012]
 gi|194423396|gb|EDX39387.1| putative thioredoxin [Escherichia coli 101-1]
 gi|208729251|gb|EDZ78852.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4206]
 gi|208735788|gb|EDZ84475.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4045]
 gi|208741661|gb|EDZ89343.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4042]
 gi|209157914|gb|ACI35347.1| putative thioredoxin [Escherichia coli O157:H7 str. EC4115]
 gi|209762738|gb|ACI79681.1| putative thioredoxin-like protein [Escherichia coli]
 gi|209762740|gb|ACI79682.1| putative thioredoxin-like protein [Escherichia coli]
 gi|209762742|gb|ACI79683.1| putative thioredoxin-like protein [Escherichia coli]
 gi|209762744|gb|ACI79684.1| putative thioredoxin-like protein [Escherichia coli]
 gi|209762746|gb|ACI79685.1| putative thioredoxin-like protein [Escherichia coli]
 gi|209913321|dbj|BAG78395.1| thioredoxin [Escherichia coli SE11]
 gi|215265997|emb|CAS10407.1| thioredoxin 2 [Escherichia coli O127:H6 str. E2348/69]
 gi|217320012|gb|EEC28437.1| putative thioredoxin [Escherichia coli O157:H7 str. TW14588]
 gi|218352943|emb|CAU98742.1| thioredoxin 2 [Escherichia coli 55989]
 gi|218355432|emb|CAQ88040.1| thioredoxin 2 [Escherichia fergusonii ATCC 35469]
 gi|218361934|emb|CAQ99535.1| thioredoxin 2 [Escherichia coli IAI1]
 gi|218366273|emb|CAR04020.1| thioredoxin 2 [Escherichia coli S88]
 gi|218371083|emb|CAR18912.1| thioredoxin 2 [Escherichia coli IAI39]
 gi|222034287|emb|CAP77028.1| Thioredoxin 2 [Escherichia coli LF82]
 gi|226901458|gb|EEH87717.1| thioredoxin 2 [Escherichia sp. 3_2_53FAA]
 gi|227835968|gb|EEJ46434.1| protein-disulfide reductase [Escherichia coli 83972]
 gi|238863645|gb|ACR65643.1| thioredoxin 2 [Escherichia coli BW2952]
 gi|242378182|emb|CAQ32957.1| reduced thioredoxin 2 [Escherichia coli BL21(DE3)]
 gi|253323562|gb|ACT28164.1| thioredoxin [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974458|gb|ACT40129.1| thioredoxin 2 [Escherichia coli B str. REL606]
 gi|253978625|gb|ACT44295.1| thioredoxin 2 [Escherichia coli BL21(DE3)]
 gi|254593934|gb|ACT73295.1| thioredoxin 2 [Escherichia coli O157:H7 str. TW14359]
 gi|257755325|dbj|BAI26827.1| thioredoxin 2 [Escherichia coli O26:H11 str. 11368]
 gi|257760415|dbj|BAI31912.1| thioredoxin 2 [Escherichia coli O103:H2 str. 12009]
 gi|257765624|dbj|BAI37119.1| thioredoxin 2 [Escherichia coli O111:H- str. 11128]
 gi|260448338|gb|ACX38760.1| thioredoxin [Escherichia coli DH1]
 gi|281179631|dbj|BAI55961.1| thioredoxin [Escherichia coli SE15]
 gi|281601994|gb|ADA74978.1| Thioredoxin-2 [Shigella flexneri 2002017]
 gi|290763732|gb|ADD57693.1| Thioredoxin-2 [Escherichia coli O55:H7 str. CB9615]
 gi|291323767|gb|EFE63195.1| thioredoxin 2 [Escherichia coli B088]
 gi|291433499|gb|EFF06478.1| thioredoxin 2 [Escherichia coli B185]
 gi|291471466|gb|EFF13950.1| thioredoxin 2 [Escherichia coli B354]
 gi|294489931|gb|ADE88687.1| putative thioredoxin [Escherichia coli IHE3034]
 gi|299881398|gb|EFI89609.1| thioredoxin [Escherichia coli MS 196-1]
 gi|300300898|gb|EFJ57283.1| thioredoxin [Escherichia coli MS 185-1]
 gi|300308936|gb|EFJ63456.1| thioredoxin [Escherichia coli MS 200-1]
 gi|300314583|gb|EFJ64367.1| thioredoxin [Escherichia coli MS 175-1]
 gi|300396400|gb|EFJ79938.1| thioredoxin [Escherichia coli MS 69-1]
 gi|300403767|gb|EFJ87305.1| thioredoxin [Escherichia coli MS 84-1]
 gi|300408793|gb|EFJ92331.1| thioredoxin [Escherichia coli MS 45-1]
 gi|300412321|gb|EFJ95631.1| thioredoxin [Escherichia coli MS 115-1]
 gi|300416925|gb|EFK00236.1| thioredoxin [Escherichia coli MS 182-1]
 gi|300449059|gb|EFK12679.1| thioredoxin [Escherichia coli MS 116-1]
 gi|300459105|gb|EFK22598.1| thioredoxin [Escherichia coli MS 21-1]
 gi|300464262|gb|EFK27755.1| thioredoxin [Escherichia coli MS 187-1]
 gi|300526490|gb|EFK47559.1| thioredoxin [Escherichia coli MS 119-7]
 gi|300529628|gb|EFK50690.1| thioredoxin [Escherichia coli MS 107-1]
 gi|300841884|gb|EFK69644.1| thioredoxin [Escherichia coli MS 124-1]
 gi|300843650|gb|EFK71410.1| thioredoxin [Escherichia coli MS 78-1]
 gi|301073623|gb|EFK88429.1| thioredoxin [Escherichia coli MS 146-1]
 gi|305851748|gb|EFM52200.1| thioredoxin 2 [Escherichia coli NC101]
 gi|306906348|gb|EFN36863.1| thioredoxin [Escherichia coli W]
 gi|307554601|gb|ADN47376.1| thioredoxin-like protein [Escherichia coli ABU 83972]
 gi|307625869|gb|ADN70173.1| thioredoxin 2 [Escherichia coli UM146]
 gi|308121819|gb|EFO59081.1| thioredoxin [Escherichia coli MS 145-7]
 gi|308927493|gb|EFP72965.1| thioredoxin [Shigella dysenteriae 1617]
 gi|310331767|gb|EFP99002.1| thioredoxin [Escherichia coli 1827-70]
 gi|312289918|gb|EFR17806.1| thioredoxin [Escherichia coli 2362-75]
 gi|312947154|gb|ADR27981.1| thioredoxin 2 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313648261|gb|EFS12705.1| thioredoxin [Shigella flexneri 2a str. 2457T]
 gi|315061901|gb|ADT76228.1| thioredoxin 2 [Escherichia coli W]
 gi|315137206|dbj|BAJ44365.1| thioredoxin-2 [Escherichia coli DH1]
 gi|315256610|gb|EFU36578.1| thioredoxin [Escherichia coli MS 85-1]
 gi|315287998|gb|EFU47400.1| thioredoxin [Escherichia coli MS 110-3]
 gi|315294517|gb|EFU53865.1| thioredoxin [Escherichia coli MS 153-1]
 gi|315615844|gb|EFU96476.1| thioredoxin [Escherichia coli 3431]
 gi|320176116|gb|EFW51183.1| Thioredoxin 2 [Shigella dysenteriae CDC 74-1112]
 gi|320182093|gb|EFW56997.1| Thioredoxin 2 [Shigella boydii ATCC 9905]
 gi|320188923|gb|EFW63582.1| Thioredoxin 2 [Escherichia coli O157:H7 str. EC1212]
 gi|320196418|gb|EFW71042.1| Thioredoxin 2 [Escherichia coli WV_060327]
 gi|320200146|gb|EFW74735.1| Thioredoxin 2 [Escherichia coli EC4100B]
 gi|320640831|gb|EFX10325.1| thioredoxin 2 [Escherichia coli O157:H7 str. G5101]
 gi|320646177|gb|EFX15117.1| thioredoxin 2 [Escherichia coli O157:H- str. 493-89]
 gi|320651472|gb|EFX19868.1| thioredoxin 2 [Escherichia coli O157:H- str. H 2687]
 gi|320657074|gb|EFX24893.1| thioredoxin 2 [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320662739|gb|EFX30078.1| thioredoxin 2 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667559|gb|EFX34479.1| thioredoxin 2 [Escherichia coli O157:H7 str. LSU-61]
 gi|323156242|gb|EFZ42401.1| thioredoxin [Escherichia coli EPECa14]
 gi|323159155|gb|EFZ45146.1| thioredoxin [Escherichia coli E128010]
 gi|323167779|gb|EFZ53474.1| thioredoxin [Shigella sonnei 53G]
 gi|323173099|gb|EFZ58730.1| thioredoxin [Escherichia coli LT-68]
 gi|323177287|gb|EFZ62875.1| thioredoxin [Escherichia coli 1180]
 gi|323184538|gb|EFZ69912.1| thioredoxin [Escherichia coli 1357]
 gi|323188303|gb|EFZ73595.1| thioredoxin [Escherichia coli RN587/1]
 gi|323377518|gb|ADX49786.1| thioredoxin [Escherichia coli KO11]
 gi|323936322|gb|EGB32613.1| thioredoxin [Escherichia coli E1520]
 gi|323941155|gb|EGB37340.1| thioredoxin [Escherichia coli E482]
 gi|323944582|gb|EGB40651.1| thioredoxin [Escherichia coli H120]
 gi|323949236|gb|EGB45127.1| thioredoxin [Escherichia coli H252]
 gi|323955818|gb|EGB51576.1| thioredoxin [Escherichia coli H263]
 gi|323961197|gb|EGB56810.1| thioredoxin [Escherichia coli H489]
 gi|323967626|gb|EGB63039.1| thioredoxin [Escherichia coli M863]
 gi|323971091|gb|EGB66338.1| thioredoxin [Escherichia coli TA007]
 gi|323978388|gb|EGB73473.1| thioredoxin [Escherichia coli TW10509]
 gi|324008439|gb|EGB77658.1| thioredoxin [Escherichia coli MS 57-2]
 gi|324014373|gb|EGB83592.1| thioredoxin [Escherichia coli MS 60-1]
 gi|324020042|gb|EGB89261.1| thioredoxin [Escherichia coli MS 117-3]
 gi|324113108|gb|EGC07084.1| thioredoxin [Escherichia fergusonii B253]
 gi|324118208|gb|EGC12104.1| thioredoxin [Escherichia coli E1167]
 gi|325496340|gb|EGC94199.1| thioredoxin 2 [Escherichia fergusonii ECD227]
 gi|326340388|gb|EGD64192.1| Thioredoxin 2 [Escherichia coli O157:H7 str. 1125]
 gi|326345071|gb|EGD68815.1| Thioredoxin 2 [Escherichia coli O157:H7 str. 1044]
 gi|327252292|gb|EGE63964.1| thioredoxin [Escherichia coli STEC_7v]
 gi|330912350|gb|EGH40860.1| thioredoxin 2 [Escherichia coli AA86]
 gi|331040004|gb|EGI12224.1| thioredoxin [Escherichia coli H736]
 gi|331042878|gb|EGI15019.1| thioredoxin [Escherichia coli M605]
 gi|331059950|gb|EGI31927.1| thioredoxin [Escherichia coli TA143]
 gi|331064527|gb|EGI36438.1| thioredoxin [Escherichia coli TA271]
 gi|331069304|gb|EGI40696.1| thioredoxin [Escherichia coli TA280]
 gi|331075039|gb|EGI46359.1| thioredoxin [Escherichia coli H591]
 gi|332088094|gb|EGI93219.1| thioredoxin [Shigella boydii 5216-82]
 gi|332089245|gb|EGI94352.1| thioredoxin [Shigella dysenteriae 155-74]
 gi|332344457|gb|AEE57791.1| thioredoxin protein [Escherichia coli UMNK88]
 gi|332753992|gb|EGJ84366.1| thioredoxin [Shigella flexneri 4343-70]
 gi|332755788|gb|EGJ86146.1| thioredoxin [Shigella flexneri 2747-71]
 gi|332761976|gb|EGJ92249.1| thioredoxin [Shigella flexneri K-671]
 gi|332766584|gb|EGJ96789.1| thioredoxin [Shigella flexneri 2930-71]
 gi|333000442|gb|EGK20024.1| thioredoxin [Shigella flexneri VA-6]
 gi|333000840|gb|EGK20412.1| thioredoxin [Shigella flexneri K-218]
 gi|333001675|gb|EGK21242.1| thioredoxin [Shigella flexneri K-272]
 gi|333015951|gb|EGK35286.1| thioredoxin [Shigella flexneri K-227]
 gi|333016811|gb|EGK36137.1| thioredoxin [Shigella flexneri K-304]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+R+ I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 135


>gi|309390232|gb|ADO78112.1| thioredoxin [Halanaerobium praevalens DSM 2228]
          Length = 106

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 65/87 (74%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          +KV  ++F+SEVL+    V+VDFWA WC PC  ++P+++++A E  D++K+ KL+++E+ 
Sbjct: 5  VKVTDQNFESEVLKADGKVLVDFWAEWCGPCRMIAPVLEELAAEYGDQIKVVKLNVDENQ 64

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
          + +  Y++ SIPT+++ + G+V D+++
Sbjct: 65 KTAAEYEVMSIPTMLVMEAGEVTDKLV 91


>gi|295097887|emb|CBK86977.1| thioredoxin [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PC   +PI +D+A+E + K++  K++ E   E+S R++I SIPT+++F
Sbjct: 54  PVVVDFWAPWCGPCRNFAPIFEDVAEERSGKMRFVKVNTEAERELSARFRIRSIPTIMIF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+VID M+ GA  ++    W+
Sbjct: 114 KNGEVID-MLNGAVPKAPFDSWL 135


>gi|269967726|ref|ZP_06181774.1| thioredoxin [Vibrio alginolyticus 40B]
 gi|269827632|gb|EEZ81918.1| thioredoxin [Vibrio alginolyticus 40B]
          Length = 144

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +L+   PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E   +++T++ I 
Sbjct: 49  SALLQSDMPVVVDFWAPWCNPCVGFAPVFSDVAHEQAGTARFVKIDTEAQQQLATQFGIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  ++   +W+
Sbjct: 109 SIPTIMVFKNGQRVD-MINGALPKTQFDQWL 138


>gi|120553412|ref|YP_957763.1| thioredoxin [Marinobacter aquaeolei VT8]
 gi|120323261|gb|ABM17576.1| thioredoxin [Marinobacter aquaeolei VT8]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL+   PV+VD+WA WC PC  ++P++++IADE   K+K+ KL+I+E+ 
Sbjct: 6   VNVTDASFEQDVLKSDVPVLVDYWAEWCGPCKMIAPVLEEIADEYDGKLKVCKLNIDENE 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   ++ I  IPTL+LFK+G V D    GA S+S +  ++ S +
Sbjct: 66  QTPPKFNIRGIPTLMLFKNGNV-DATKVGALSKSQLAAFLDSNL 108


>gi|317129853|ref|YP_004096135.1| thioredoxin [Bacillus cellulosilyticus DSM 2522]
 gi|315474801|gb|ADU31404.1| thioredoxin [Bacillus cellulosilyticus DSM 2522]
          Length = 104

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 65/90 (72%), Gaps = 2/90 (2%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + V  ++F +E  E    V+ DFWA WC PC  ++P+++++  E+ DKVKI KLD++
Sbjct: 1  MAIVNVSDQNFAAETGE--GVVLADFWAPWCGPCKMIAPVLEELDGEMGDKVKIVKLDVD 58

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ E + ++ + SIPTL++FKDG+V+D+++
Sbjct: 59 ENQETAGKFGVMSIPTLLVFKDGQVVDQVV 88


>gi|238755723|ref|ZP_04617057.1| Thioredoxin 2 [Yersinia ruckeri ATCC 29473]
 gi|238706090|gb|EEP98473.1| Thioredoxin 2 [Yersinia ruckeri ATCC 29473]
          Length = 135

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            P+V+DFWA WC PC   +PI +D+A E A K++  K++ 
Sbjct: 25  FDGEVVNATAETLDKLLQDDLPIVIDFWAPWCGPCRSFAPIFEDVAGERAGKIRFVKVNT 84

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E    +STR++I SIPT++L+K+GK++D M+ GA  ++    W+
Sbjct: 85  EAEPALSTRFRIRSIPTIMLYKNGKMVD-MLSGALPKAQFDSWL 127


>gi|145589488|ref|YP_001156085.1| thioredoxin [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047894|gb|ABP34521.1| thioredoxin [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV++DFWA WC PC  + PI+++++ E  DK++I K++++E+  +
Sbjct: 8   VTDASFEQDVLKSDKPVLLDFWAEWCGPCKMIGPILEELSGEYGDKLQIAKMNVDENQGV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ I  IPTLILFK+G V  + + GA ++S +  +I S +
Sbjct: 68  PAQFNIRGIPTLILFKNGTVAAQKV-GALAKSQLSAFIDSNI 108


>gi|37681366|ref|NP_935975.1| thiol-disulfide isomerase and thioredoxin [Vibrio vulnificus YJ016]
 gi|37200118|dbj|BAC95946.1| thiol-disulfide isomerase and thioredoxin [Vibrio vulnificus YJ016]
          Length = 112

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++  + F+++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+I+ ++
Sbjct: 10  LQLSDEGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDHNA 69

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 70  GTPPKFGIRGIPTLLLFKNGSVAATKV-GALSKTQLKEFL 108


>gi|266623101|ref|ZP_06116036.1| thioredoxin [Clostridium hathewayi DSM 13479]
 gi|288865139|gb|EFC97437.1| thioredoxin [Clostridium hathewayi DSM 13479]
          Length = 103

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 57/86 (66%), Gaps = 1/86 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MS   +   ++  EV+    PV++DFWA WC PC KLSP++D IA+E    +K+ K+++E
Sbjct: 1  MSVFSITNNNYHEEVVASGKPVLLDFWAPWCGPCKKLSPVVDKIAEE-NPHIKVGKVNVE 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVI 86
          E  E++ ++ I SIP L+L K+GK +
Sbjct: 60 EQRELAEKFHIMSIPALVLMKEGKAV 85


>gi|82545037|ref|YP_408984.1| thioredoxin 2 [Shigella boydii Sb227]
 gi|81246448|gb|ABB67156.1| putative thioredoxin-like protein [Shigella boydii Sb227]
 gi|320186385|gb|EFW61119.1| Thioredoxin 2 [Shigella flexneri CDC 796-83]
 gi|332092591|gb|EGI97663.1| thioredoxin [Shigella boydii 3594-74]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+R+ I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 135


>gi|158428381|pdb|2EIQ|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
 gi|158428382|pdb|2EIQ|B Chain B, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAACKV-GALSKGQLKEFL 103


>gi|89056558|ref|YP_512009.1| thioredoxin [Jannaschia sp. CCS1]
 gi|88866107|gb|ABD56984.1| thioredoxin [Jannaschia sp. CCS1]
          Length = 106

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   +FD+EV +   PVVVDFWA WC PC ++ P ++++++E   +VKI KL+++
Sbjct: 1   MATTAVTDATFDTEVKQSDIPVVVDFWAEWCGPCKQIGPALEELSEEYEGRVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E++    +  +  IP L +FKDG+V+   + GA+ ++ + +WI
Sbjct: 61  ENANAPMQLGVRGIPALFMFKDGEVVSNKV-GAAPKAALQKWI 102


>gi|15828461|ref|NP_302724.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           leprae TN]
 gi|221230938|ref|YP_002504354.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           leprae Br4923]
 gi|1174807|sp|P46843|TRXB_MYCLE RecName: Full=Bifunctional thioredoxin reductase/thioredoxin;
           Includes: RecName: Full=Thioredoxin reductase;
           Short=TRXR; Includes: RecName: Full=Thioredoxin
 gi|871419|emb|CAA61150.1| thioredoxin /thioredoxin reductase hybrid protein [Mycobacterium
           leprae]
 gi|886315|gb|AAB53131.1| thioredoxin reductase/thioredoxin [Mycobacterium leprae]
 gi|13093891|emb|CAC32235.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           leprae]
 gi|219934045|emb|CAR72803.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           leprae Br4923]
          Length = 458

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 70/97 (72%), Gaps = 1/97 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++V   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E  +++ + KLD++ + 
Sbjct: 352 IEVTDASFFADVLSSNKPVLVDFWATWCGPCKMVAPVLEEIASEQRNQLTVAKLDVDTNP 411

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E++  +Q+ SIPT+ILF+ G+ + R++ GA  ++ ++
Sbjct: 412 EMAREFQVVSIPTMILFQGGQPVKRIV-GAKGKAALL 447


>gi|329944760|ref|ZP_08292839.1| thioredoxin [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328529896|gb|EGF56786.1| thioredoxin [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL V   +F+ EVL+   PVV+DFWA WC PC +++PI+D++A +  DKVK  K+D++ +
Sbjct: 4   ALAVTDATFEEEVLKSEVPVVIDFWAEWCGPCRQMAPIVDEVAADFGDKVKFVKIDVDAN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRM---MPGASSQSDI 99
              +  Y + SIPT  + +DG+V  +     P AS ++++
Sbjct: 64  PATARSYGVRSIPTFAVVRDGEVFHQFSGSRPKASFKTEV 103


>gi|222143123|pdb|3DYR|A Chain A, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In
           Its Oxidized Form
 gi|222143124|pdb|3DYR|B Chain B, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In
           Its Oxidized Form
          Length = 111

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I   PTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGTPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|163842268|ref|YP_001626673.1| thioredoxin [Renibacterium salmoninarum ATCC 33209]
 gi|162955744|gb|ABY25259.1| thioredoxin [Renibacterium salmoninarum ATCC 33209]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 57/84 (67%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A  V   +F S+V+    PV+VDFWA WC PC K+ PI+D+I+ E ADKV + K+DI+E
Sbjct: 3  NAKAVTDATFQSDVISSEKPVIVDFWAEWCGPCRKVGPILDEISSEYADKVNVVKVDIDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKV 85
          +  I+    I+SIP + LF DG+V
Sbjct: 63 NPRIAAELGITSIPAIYLFADGEV 86


>gi|108757097|ref|YP_634591.1| thioredoxin [Myxococcus xanthus DK 1622]
 gi|108460977|gb|ABF86162.1| thioredoxin [Myxococcus xanthus DK 1622]
          Length = 109

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + +D   F  EVLE S PV+VDF A+WC PC  L+ ++D IA +   ++K+T L++++
Sbjct: 4   NVISLDDAHFQREVLESSEPVLVDFTATWCPPCRALALVLDAIAADFRGRLKVTSLNVDD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           + E + RY + ++P L+LFK+GKV+ R M GA  ++ +
Sbjct: 64  NPESAMRYGVRAVPALLLFKEGKVV-RQMLGAQPRAKL 100


>gi|16765969|ref|NP_461584.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56412528|ref|YP_149603.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62181224|ref|YP_217641.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161612631|ref|YP_001586596.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167553663|ref|ZP_02347410.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167994862|ref|ZP_02575952.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168232177|ref|ZP_02657235.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168238344|ref|ZP_02663402.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168245087|ref|ZP_02670019.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168262181|ref|ZP_02684154.1| thioredoxin [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168468063|ref|ZP_02701900.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168823162|ref|ZP_02835162.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194446345|ref|YP_002041916.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194449202|ref|YP_002046658.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194470584|ref|ZP_03076568.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194734992|ref|YP_002115661.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197247757|ref|YP_002147553.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197264620|ref|ZP_03164694.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197361463|ref|YP_002141099.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198242015|ref|YP_002216664.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|200388845|ref|ZP_03215457.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204929715|ref|ZP_03220789.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|224584504|ref|YP_002638302.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238912714|ref|ZP_04656551.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|16421199|gb|AAL21543.1| thioredoxin 2, redox factor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56126785|gb|AAV76291.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62128857|gb|AAX66560.1| thioredoxin 2, redox factor [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161361995|gb|ABX65763.1| hypothetical protein SPAB_00326 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405008|gb|ACF65230.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194407506|gb|ACF67725.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194456948|gb|EDX45787.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194710494|gb|ACF89715.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195628856|gb|EDX48270.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197092939|emb|CAR58368.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197211460|gb|ACH48857.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197242875|gb|EDY25495.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197288811|gb|EDY28184.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197936531|gb|ACH73864.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199605943|gb|EDZ04488.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204321434|gb|EDZ06634.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205321936|gb|EDZ09775.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205327358|gb|EDZ14122.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205333585|gb|EDZ20349.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205336127|gb|EDZ22891.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205340545|gb|EDZ27309.1| putative thioredoxin [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205349283|gb|EDZ35914.1| thioredoxin [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|224469031|gb|ACN46861.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261247847|emb|CBG25676.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267994790|gb|ACY89675.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159200|emb|CBW18715.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312913643|dbj|BAJ37617.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320085530|emb|CBY95309.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321226004|gb|EFX51057.1| Thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322613366|gb|EFY10308.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620430|gb|EFY17295.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625102|gb|EFY21931.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322629454|gb|EFY26230.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633841|gb|EFY30580.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635447|gb|EFY32158.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322639877|gb|EFY36556.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322644237|gb|EFY40781.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649929|gb|EFY46349.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654888|gb|EFY51205.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658184|gb|EFY54450.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322661744|gb|EFY57962.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322669725|gb|EFY65871.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673268|gb|EFY69373.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322674943|gb|EFY71030.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682966|gb|EFY78984.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322685627|gb|EFY81622.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|322715712|gb|EFZ07283.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323130987|gb|ADX18417.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323191945|gb|EFZ77183.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200422|gb|EFZ85503.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323201321|gb|EFZ86388.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208392|gb|EFZ93332.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211533|gb|EFZ96371.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215964|gb|EGA00696.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221745|gb|EGA06153.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323225647|gb|EGA09874.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229365|gb|EGA13489.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235320|gb|EGA19404.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323237494|gb|EGA21557.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245249|gb|EGA29250.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323246474|gb|EGA30455.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323253995|gb|EGA37817.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323259045|gb|EGA42693.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323261968|gb|EGA45533.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267751|gb|EGA51232.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269690|gb|EGA53142.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326624420|gb|EGE30765.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
 gi|332989578|gb|AEF08561.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A+E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIPT+++FK G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSARFGIRSIPTIMIFKHGQVVD-MLNGAVPKAPFDSWL 135


>gi|323693343|ref|ZP_08107559.1| hypothetical protein HMPREF9475_02422 [Clostridium symbiosum
           WAL-14673]
 gi|323502587|gb|EGB18433.1| hypothetical protein HMPREF9475_02422 [Clostridium symbiosum
           WAL-14673]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 67/96 (69%), Gaps = 3/96 (3%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
            +F+  VL+   PV+VDFWA WC  C +LSP I+ +++E  + VK+ KLDI+E  E++ +
Sbjct: 8   NNFEETVLKAKGPVIVDFWAPWCGYCRRLSPAIERMSEEYGETVKMVKLDIDEEPELAEK 67

Query: 69  YQISSIPTLILFKDGKVIDRMM-PGASSQSDIIEWI 103
           Y I +IP+L+LF+DG+++  ++ PG  SQ  + +W+
Sbjct: 68  YDIDTIPSLLLFRDGELVSSVVNPG--SQDAVEDWL 101


>gi|120406997|ref|YP_956826.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
 gi|119959815|gb|ABM16820.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
          Length = 110

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 64/92 (69%), Gaps = 1/92 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  +VL    PV+VDFWA+WC PC  ++P++++IA E A  + + K+D++E+   +  +
Sbjct: 14  SFSDDVLSSGTPVLVDFWATWCGPCKMVAPVLEEIASEKAGSLTVAKIDVDENPATARDF 73

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           Q+ SIPT+ILFKDGK + R++ GA  ++ ++ 
Sbjct: 74  QVVSIPTMILFKDGKPVKRIV-GAKGKAALLR 104


>gi|227540115|ref|ZP_03970164.1| thioredoxin [Sphingobacterium spiritivorum ATCC 33300]
 gi|300771840|ref|ZP_07081711.1| thioredoxin [Sphingobacterium spiritivorum ATCC 33861]
 gi|227239976|gb|EEI89991.1| thioredoxin [Sphingobacterium spiritivorum ATCC 33300]
 gi|300761226|gb|EFK58051.1| thioredoxin [Sphingobacterium spiritivorum ATCC 33861]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+  VL+   PV+VDFWA WC PC  + P++++IA E   K  + K+D++ +
Sbjct: 2   ALEITDSNFEELVLKSDKPVLVDFWAEWCGPCRMVGPVVEEIAKEYEGKAVVGKVDVDSN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            EIS R+ I +IP L+ FK+G+++D+ + GA  +S + E
Sbjct: 62  PEISVRFGIRNIPALLFFKNGEIVDKQV-GAVPKSVLTE 99


>gi|86134260|ref|ZP_01052842.1| thioredoxin [Polaribacter sp. MED152]
 gi|85821123|gb|EAQ42270.1| thioredoxin [Polaribacter sp. MED152]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 64/95 (67%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +FD  VL+   PV+VDFWA+WC PC  + PI+D+I  E   K  + K+D++ +
Sbjct: 2  ALEITDATFDEVVLQSDKPVLVDFWAAWCGPCRMVGPIVDEIHAEYDGKAVVGKVDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
           E + +Y + +IPT+++FK+G+V+D+ +  A  ++
Sbjct: 62 QEFAAKYGVRNIPTVLVFKNGEVVDKQVGVAPKKT 96


>gi|307154864|ref|YP_003890248.1| thioredoxin [Cyanothece sp. PCC 7822]
 gi|306985092|gb|ADN16973.1| thioredoxin [Cyanothece sp. PCC 7822]
          Length = 116

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EVL  S PV+VDFWA WC PC  ++PI+ ++A+  A  VK+ KL+IEE  +++++Y
Sbjct: 14  NFEREVLNSSIPVIVDFWAPWCGPCRVMNPIMAELAENFAGVVKVGKLNIEEYPQLASQY 73

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I +IP LI +  G V DR + G  S+  + E + S +
Sbjct: 74  RIEAIPHLIFYAQGNVSDRAI-GIISKKALFEKVQSLI 110


>gi|149241884|pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal
           (P61) Space Group
 gi|149241885|pdb|2H71|B Chain B, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IA+E   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|149241896|pdb|2H75|A Chain A, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal
           (P61) Space Group
 gi|149241897|pdb|2H75|B Chain B, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFETDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|149241890|pdb|2H73|A Chain A, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal
           (P61) Space Group
 gi|149241891|pdb|2H73|B Chain B, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+++IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILEEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|157738099|ref|YP_001490783.1| thioredoxin [Arcobacter butzleri RM4018]
 gi|114461654|gb|ABI75083.1| thioredoxin [Arcobacter butzleri]
 gi|157699953|gb|ABV68113.1| thioredoxin [Arcobacter butzleri RM4018]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 61/80 (76%), Gaps = 1/80 (1%)

Query: 22  VVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK 81
           V+VDFWA WC PC  L+P ID +A+E  +K KI K++ EE  ++++ YQ+ SIPT++ FK
Sbjct: 21  VLVDFWAPWCGPCRMLAPAIDQLAEEFENKAKICKVNTEEEPDLTSEYQVRSIPTILFFK 80

Query: 82  DGKVIDRMMPGASSQSDIIE 101
           +G+++D+M+ GA++++ + E
Sbjct: 81  NGEIVDQMI-GATTKAKLEE 99


>gi|205353692|ref|YP_002227493.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858003|ref|YP_002244654.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|205273473|emb|CAR38450.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|206709806|emb|CAR34158.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|326628797|gb|EGE35140.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A+E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCSPCRNFAPIFEDVAEERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIPT+++FK G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSARFGIRSIPTIMIFKHGQVVD-MLNGAVPKAPFDSWL 135


>gi|254302523|ref|ZP_04969881.1| thioredoxin [Fusobacterium nucleatum subsp. polymorphum ATCC
          10953]
 gi|148322715|gb|EDK87965.1| thioredoxin [Fusobacterium nucleatum subsp. polymorphum ATCC
          10953]
          Length = 103

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 67/88 (76%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K   ++F++EVL+ +  VVVDF A+WC PC  L PI+D++ +E  +K KI K+DI+
Sbjct: 1  MAIVKGTKENFEAEVLKANGVVVVDFGANWCGPCKSLVPILDEVVEEDPNK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ +Y+I S+PTL++F++G++ID+
Sbjct: 60 EQEELAAQYKIMSVPTLLVFRNGEIIDK 87


>gi|34112934|gb|AAQ62379.1| predicted thiol-disulfide isomerase/thioredoxin [uncultured
          marine gamma proteobacterium EBAC31A08]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 59/78 (75%)

Query: 7  DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
          D +SF+S+VL    PV+VDFWA WC PC +L+P ++ +A E ++ +K+ K+D++ + EI+
Sbjct: 9  DEESFNSDVLNSEKPVLVDFWAEWCGPCKQLAPTVETVAAEKSETLKVCKMDVDSNREIA 68

Query: 67 TRYQISSIPTLILFKDGK 84
           +Y I SIP+LI+FK+G+
Sbjct: 69 AKYGIRSIPSLIIFKNGE 86


>gi|195431658|ref|XP_002063845.1| GK15891 [Drosophila willistoni]
 gi|194159930|gb|EDW74831.1| GK15891 [Drosophila willistoni]
          Length = 145

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           TK F+ +V++   PVVVDF ASWC PC  L+P +++I  E   +V++ ++D++E  E++ 
Sbjct: 38  TKDFEKKVVQSDKPVVVDFHASWCTPCKALAPRLENIVSEQQGQVRLARVDVDEHCELAL 97

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            Y + S+P+L++  +GKVI+RM+ G  +   I +W+
Sbjct: 98  NYNVGSVPSLLVMHNGKVINRMV-GLQTTEYIRDWL 132


>gi|75909967|ref|YP_324263.1| thioredoxin [Anabaena variabilis ATCC 29413]
 gi|75703692|gb|ABA23368.1| Thioredoxin [Anabaena variabilis ATCC 29413]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 72/104 (69%), Gaps = 4/104 (3%)

Query: 7   DTKSFDS--EVLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + K F+S  E+L  S+ PV+VDF+A WC PC  ++ I+  + ++L D+++I K+D E+ +
Sbjct: 3   EKKQFNSFEEMLSGSDLPVLVDFYADWCGPCQMMATILQQVNNQLKDRIRIVKIDTEKYT 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++T+YQI ++PTL+LFK GK +DR + G     D+++ + S V
Sbjct: 63  ELATQYQIYALPTLVLFKQGKPVDR-IEGVLQTPDLVQRLQSFV 105


>gi|297181503|gb|ADI17690.1| thiol-disulfide isomerase and thioredoxins [uncultured gamma
          proteobacterium HF0130_23I23]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 67/92 (72%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           + VD ++F SEVL+    V+VDFWA WC PC +++P +D+I+++ ++ + + K+D++ +
Sbjct: 2  TISVDKETFSSEVLQNDKLVLVDFWAEWCGPCKQIAPRLDEISEKYSENLSVCKVDVDSN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGAS 94
           E++ +Y + SIP+L++FK+G++ID +M   S
Sbjct: 62 RELALQYNVRSIPSLMIFKEGEMIDSLMGAVS 93


>gi|269964191|ref|ZP_06178484.1| thioredoxin [Vibrio harveyi 1DA3]
 gi|269831074|gb|EEZ85240.1| thioredoxin [Vibrio harveyi 1DA3]
          Length = 144

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 59/91 (64%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +LE + PVVVDFWA WC PCV  +P+  D+A E     +  K+D E   +++ ++ I 
Sbjct: 49  SALLESNTPVVVDFWAPWCNPCVGFAPVFSDVAQEQTGNARFVKIDTEAQQQLAAQFGIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  ++   +W+
Sbjct: 109 SIPTIMVFKNGQRVD-MINGALPKTQFDQWL 138


>gi|261340881|ref|ZP_05968739.1| thioredoxin [Enterobacter cancerogenus ATCC 35316]
 gi|288317313|gb|EFC56251.1| thioredoxin [Enterobacter cancerogenus ATCC 35316]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PC   +P+ +D+A+E + K++  K++ E   E+S R++I SIPT+++F
Sbjct: 54  PVVVDFWAPWCGPCRNFAPVFEDVAEERSGKMRFVKVNTEAERELSARFRIRSIPTIMIF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+VID M+ GA  ++    W+
Sbjct: 114 KNGEVID-MLNGAVPKAPFESWL 135


>gi|167948252|ref|ZP_02535326.1| thioredoxin [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 189

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 61/82 (74%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+S+VL+ + PV++D+WA WC PC  ++P++D+IA E + K+K+ KL+I+++S
Sbjct: 21  VHVTDDSFESDVLQSTLPVLIDYWAEWCGPCKMIAPVLDEIAAEYSGKLKVAKLNIDDNS 80

Query: 64  EISTRYQISSIPTLILFKDGKV 85
               +Y I  IPTL+LFK+G+V
Sbjct: 81  NTPPQYGIRGIPTLMLFKNGEV 102


>gi|149910701|ref|ZP_01899337.1| thioredoxin [Moritella sp. PE36]
 gi|149806240|gb|EDM66217.1| thioredoxin [Moritella sp. PE36]
          Length = 114

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 60/77 (77%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F++E++  S PV V++WASWC PC+++ P++++IA   + KVKI KL+I+ S +I+ +Y
Sbjct: 18 NFEAELITGSQPVSVEYWASWCAPCLRVGPVLEEIAFAYSGKVKIGKLNIDTSPQIAAKY 77

Query: 70 QISSIPTLILFKDGKVI 86
           I ++P ++LFKDG+++
Sbjct: 78 GIRALPAMMLFKDGEIL 94


>gi|308187857|ref|YP_003931988.1| thioredoxin-like protein [Pantoea vagans C9-1]
 gi|308058367|gb|ADO10539.1| putative thioredoxin-like protein [Pantoea vagans C9-1]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 12/110 (10%)

Query: 5   KVDTKSFDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVK 53
           +   + FD EV+  ++           PVV+DFWA WC PCV  +P+  D+A E + KV+
Sbjct: 27  RCGNELFDGEVVNATSANFDKYLQDDLPVVIDFWAPWCGPCVNFAPVFKDVASERSGKVR 86

Query: 54  ITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             K++ E    +S R+ I SIPT++LFK+G+ +D M+ GA  ++   EW+
Sbjct: 87  FIKVNTEAEPALSARFNIRSIPTIMLFKNGERVD-MLNGAMPKAPFNEWL 135


>gi|256027660|ref|ZP_05441494.1| thioredoxin [Fusobacterium sp. D11]
 gi|289765618|ref|ZP_06524996.1| thioredoxin [Fusobacterium sp. D11]
 gi|289717173|gb|EFD81185.1| thioredoxin [Fusobacterium sp. D11]
          Length = 103

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 67/88 (76%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K   ++F++EVL+ +  VVVDF A+WC PC  L PI++++ +E   K KI K+DI+
Sbjct: 1  MAIIKGTKENFETEVLKANGVVVVDFGANWCGPCKSLVPILEEVVEEDPSK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++T+Y+I S+PTL++FK+G+++D+
Sbjct: 60 EQEELATQYKIMSVPTLLVFKNGEIVDK 87


>gi|237743252|ref|ZP_04573733.1| thioredoxin [Fusobacterium sp. 7_1]
 gi|260495269|ref|ZP_05815396.1| thioredoxin [Fusobacterium sp. 3_1_33]
 gi|229433548|gb|EEO43760.1| thioredoxin [Fusobacterium sp. 7_1]
 gi|260197047|gb|EEW94567.1| thioredoxin [Fusobacterium sp. 3_1_33]
          Length = 103

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 67/88 (76%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K   ++F++EVL+ +  VVVDF A+WC PC  L PI++++ +E   K KI K+DI+
Sbjct: 1  MAIIKGTKENFEAEVLKANGVVVVDFGANWCGPCKSLVPILEEVVEEDPSK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++T+Y+I S+PTL++FK+G+++D+
Sbjct: 60 EQEELATQYKIMSVPTLLVFKNGEIVDK 87


>gi|300113245|ref|YP_003759820.1| thioredoxin [Nitrosococcus watsonii C-113]
 gi|299539182|gb|ADJ27499.1| thioredoxin [Nitrosococcus watsonii C-113]
          Length = 110

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EVL+   P +VD+WA WC PC  ++PI+++IA++   K+KI KL+I+E+     RY
Sbjct: 14  TFEEEVLKSEQPALVDYWAEWCGPCKTVAPILEEIANDYQGKIKICKLNIDENPSTPPRY 73

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G V +    GA S+S +  +I S +
Sbjct: 74  GIRGIPTLMLFKNGNV-EATKVGALSKSQLSAFIDSNL 110


>gi|187932876|ref|YP_001886994.1| thioredoxin [Clostridium botulinum B str. Eklund 17B]
 gi|187721029|gb|ACD22250.1| thioredoxin [Clostridium botulinum B str. Eklund 17B]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 60/84 (71%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          ++++ F  +V      V+VDF+A WC PC  L+PI +D+++E  DK K+ KL++++S EI
Sbjct: 5  INSREFMEKVENTKGVVMVDFFADWCGPCKMLAPIFEDLSNEFNDKAKLFKLNVDQSGEI 64

Query: 66 STRYQISSIPTLILFKDGKVIDRM 89
          + +Y + SIPT+I+FKDGK ++ +
Sbjct: 65 AQKYGVFSIPTMIIFKDGKAVENL 88


>gi|224368278|ref|YP_002602441.1| TrxA1 [Desulfobacterium autotrophicum HRM2]
 gi|223690994|gb|ACN14277.1| TrxA1 [Desulfobacterium autotrophicum HRM2]
          Length = 148

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 62/91 (68%), Gaps = 1/91 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++FD EVL     V+VDFWASWC  C  + P++  +A   A ++KI K++++E++  + R
Sbjct: 51  QTFDQEVLAHRGGVIVDFWASWCGHCKTMEPVLSGLAKAYAGRIKIVKVNVDENASTAAR 110

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           Y+I S+P+L+ FK GKV+D  + GA S+ +I
Sbjct: 111 YRIMSLPSLVFFKAGKVVDSTV-GALSRGEI 140


>gi|158335030|ref|YP_001516202.1| thioredoxin [Acaryochloris marina MBIC11017]
 gi|158305271|gb|ABW26888.1| thioredoxin [Acaryochloris marina MBIC11017]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   +F  EV+E   PV+VDFWA WC PC  ++P++D+I+++   +VK+ K++ +E
Sbjct: 3  SAAPVTDATFKEEVIESDVPVLVDFWAPWCGPCRMVAPVVDEISEQYKGQVKVVKINTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +  ++++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 63 NPNVASQYGIRSIPTLMVFKGGQRVD-MVVGAVPKTTL 99


>gi|239993249|ref|ZP_04713773.1| thioredoxin [Alteromonas macleodii ATCC 27126]
 gi|332139979|ref|YP_004425717.1| thioredoxin [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550001|gb|AEA96719.1| thioredoxin [Alteromonas macleodii str. 'Deep ecotype']
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 64/93 (68%), Gaps = 1/93 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F+++V+    PV+VDFWA WC PC  ++PI++++A E   K+ + KL+++E++E   +Y 
Sbjct: 13  FEADVINAEGPVLVDFWAEWCGPCKMIAPILEEVATEFDGKLTVGKLNVDENNETPPKYG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I  IPTL+LFK+G V    + GA S++ + E++
Sbjct: 73  IRGIPTLLLFKNGNVAATKV-GALSKAQLTEFL 104


>gi|288817546|ref|YP_003431893.1| thioredoxin [Hydrogenobacter thermophilus TK-6]
 gi|288786945|dbj|BAI68692.1| thioredoxin [Hydrogenobacter thermophilus TK-6]
 gi|308751149|gb|ADO44632.1| thioredoxin [Hydrogenobacter thermophilus TK-6]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           ++ +EV+    PVVVDFWA WC PC  ++PII+++A EL DKVK  KL+ +E+  I+ +Y
Sbjct: 12  NWHAEVINSDKPVVVDFWAPWCGPCRIIAPIIEELAMELGDKVKFGKLNTDENPNIAMQY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I +IPT++LF  G++ D  + G   +  + + ILS +
Sbjct: 72  GIRAIPTIMLFSKGEIADTRI-GVQPKEALKQMILSHI 108


>gi|257094885|ref|YP_003168526.1| thioredoxin [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257047409|gb|ACV36597.1| thioredoxin [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 108

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +F  +VL+   PV+VD+WA WC PC  ++P++DDIA + A ++K+ KL+I+++ +
Sbjct: 7   HVTDDNFGIDVLQSDQPVLVDYWAEWCGPCKMIAPLLDDIASDYAGRLKVVKLNIDDNQK 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               Y I  IPTL+LFK+G V +    GA S+S +I +I S +
Sbjct: 67  TPASYGIRGIPTLMLFKNGNV-EATKVGALSRSQLITFIDSNL 108


>gi|326383898|ref|ZP_08205582.1| thioredoxin [Gordonia neofelifaecis NRRL B-59395]
 gi|326197357|gb|EGD54547.1| thioredoxin [Gordonia neofelifaecis NRRL B-59395]
          Length = 111

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 71/102 (69%), Gaps = 3/102 (2%)

Query: 2   SALKVDTKSFDSEVLE--CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           + + V   SF S+V+E   S PV+VDFWA+WC PC  ++P+++++A +  DK+ + K+D+
Sbjct: 4   NTVAVTDASFTSDVIESSASKPVLVDFWATWCGPCKMVAPVLEELARDNGDKLTVAKVDV 63

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +++  ++  YQI SIPT++LF+DGK +  +M GA  ++ ++ 
Sbjct: 64  DQNPNVAREYQIMSIPTMMLFQDGKPVKTIM-GAKPKAALLR 104


>gi|325274689|ref|ZP_08140736.1| thioredoxin [Pseudomonas sp. TJI-51]
 gi|324100177|gb|EGB97976.1| thioredoxin [Pseudomonas sp. TJI-51]
          Length = 109

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +F++EVL+   PV+VD+WA WC PC  ++P++DDIA     K+ + KL+I+++ E
Sbjct: 8   HVTDATFEAEVLQAQGPVLVDYWAEWCGPCKMIAPVLDDIASTYEGKLTVAKLNIDDNQE 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 68  TPAKHGVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFL 105


>gi|295095195|emb|CBK84285.1| thioredoxin [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 109

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGLILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGDVAATKV-GALSKGQLKEFL 104


>gi|225028897|ref|ZP_03718089.1| hypothetical protein EUBHAL_03186 [Eubacterium hallii DSM 3353]
 gi|224953781|gb|EEG34990.1| hypothetical protein EUBHAL_03186 [Eubacterium hallii DSM 3353]
          Length = 102

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 62/88 (70%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M  +KV   +F+ EVL+    V+VDFWA WC PC  LSPI+D++A E A  VK+ K++++
Sbjct: 1  MVIVKVTESNFEQEVLQAEGKVLVDFWAVWCGPCQMLSPIVDEVAAE-AGNVKVGKVNVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E   ++ ++ + SIPTL++F++GKV+ +
Sbjct: 60 EEPALAAKFGVMSIPTLLVFENGKVVKQ 87


>gi|300859518|ref|YP_003784501.1| thioredoxin [Corynebacterium pseudotuberculosis FRC41]
 gi|300686972|gb|ADK29894.1| thioredoxin [Corynebacterium pseudotuberculosis FRC41]
 gi|302331762|gb|ADL21956.1| Thioredoxin [Corynebacterium pseudotuberculosis 1002]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (65%), Gaps = 1/97 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F + V++   PV+VDFWA WC PC KL PII++IA E+ D+V + K+D++    +   +
Sbjct: 11  TFKTTVIDSDKPVLVDFWAEWCGPCKKLGPIINEIAAEMGDEVVVGKVDVDAERNLGAMF 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           QI SIPT+++FKDG+ +   + G   +S+I+  + S 
Sbjct: 71  QIMSIPTVLIFKDGQKVAEFV-GVRPKSEIVAKLRSH 106


>gi|305665419|ref|YP_003861706.1| thioredoxin [Maribacter sp. HTCC2170]
 gi|88710174|gb|EAR02406.1| thioredoxin [Maribacter sp. HTCC2170]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 61/88 (69%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +FD  VL+   PVVVDFWA+WC PC  + PIID+++ E   K  + K+D++ +
Sbjct: 2  ALEITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPIIDEVSTEYDGKAVVGKVDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E + +Y + +IPT+++FK G++++R +
Sbjct: 62 QEFAAKYGVRNIPTVLVFKGGEIVNRQV 89


>gi|325917112|ref|ZP_08179345.1| thioredoxin [Xanthomonas vesicatoria ATCC 35937]
 gi|325536688|gb|EGD08451.1| thioredoxin [Xanthomonas vesicatoria ATCC 35937]
          Length = 286

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 67/100 (67%), Gaps = 3/100 (3%)

Query: 6   VDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           V T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D+++  
Sbjct: 10  VTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYHGAFELAKVDVDKEQ 69

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I+  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 70  QIAAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|332706045|ref|ZP_08426117.1| thioredoxin [Lyngbya majuscula 3L]
 gi|332355137|gb|EGJ34605.1| thioredoxin [Lyngbya majuscula 3L]
          Length = 115

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 58/80 (72%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F++E+L  S PV+VDFWA WC PC  ++PI+ ++A E    VK+ KL++++  ++++ Y
Sbjct: 14 NFETEILNSSIPVIVDFWAPWCGPCRVMNPIVTELATEFDGVVKVGKLNVDDYEQLASHY 73

Query: 70 QISSIPTLILFKDGKVIDRM 89
           I +IP+L LF  GKV++R+
Sbjct: 74 HIEAIPSLFLFNQGKVVERL 93


>gi|239815306|ref|YP_002944216.1| thioredoxin [Variovorax paradoxus S110]
 gi|239801883|gb|ACS18950.1| thioredoxin [Variovorax paradoxus S110]
          Length = 110

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+ S PV+VD+WA WC PC  ++PI+D+++     K++I KL+++E+ +I  ++
Sbjct: 13  SFEADVLKSSQPVLVDYWAEWCGPCKMIAPILDEVSTAYEGKLQIAKLNVDENRDIPAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG++    + GA S++ +  +I
Sbjct: 73  GIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFI 105


>gi|62182391|ref|YP_218808.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62130024|gb|AAX67727.1| Thioredoxin 1 (TRX1) [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322716884|gb|EFZ08455.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 135

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF ++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 38  SFGTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 97

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 98  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 130


>gi|291618556|ref|YP_003521298.1| TrxC [Pantoea ananatis LMG 20103]
 gi|291153586|gb|ADD78170.1| TrxC [Pantoea ananatis LMG 20103]
 gi|327394936|dbj|BAK12358.1| thioredoxin 2 TrxC [Pantoea ananatis AJ13355]
          Length = 139

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PCV  +P+  D+A E + KV+  K++ E    +S+R++I SIPT+++F
Sbjct: 54  PVVVDFWAPWCGPCVNFAPVFKDVAQERSGKVRFIKVNTEAEPALSSRFRIRSIPTIMVF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K G+++D M+ GA  ++   EW+
Sbjct: 114 KKGEMVD-MLNGAMPKAPFNEWL 135


>gi|170724195|ref|YP_001751883.1| thioredoxin [Pseudomonas putida W619]
 gi|169762198|gb|ACA75514.1| thioredoxin [Pseudomonas putida W619]
          Length = 109

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +F++EVL+   PV+VD+WA WC PC  ++P++DDIA     K+ + KL+I+++ E
Sbjct: 8   HVTDATFEAEVLQAQGPVLVDYWAEWCGPCKMIAPVLDDIATTYEGKLTVAKLNIDDNQE 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 68  TPAKHGVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFL 105


>gi|17229385|ref|NP_485933.1| thioredoxin [Nostoc sp. PCC 7120]
 gi|17130983|dbj|BAB73592.1| thioredoxin [Nostoc sp. PCC 7120]
          Length = 105

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 71/104 (68%), Gaps = 4/104 (3%)

Query: 7   DTKSFDS--EVLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + K F+S  E+L  S+ PV+VDF+A WC PC  +  I+  + ++L D+++I K+D E+ +
Sbjct: 3   EKKQFNSFEEMLSGSDLPVLVDFYADWCGPCQMMGTILQQVNNQLKDRIRIVKIDTEKYT 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++T+YQI+++PTL+LFK GK +DR + G     D++  + S V
Sbjct: 63  ELATQYQIAALPTLVLFKQGKPVDR-IEGVLQTPDLVRRLQSFV 105


>gi|149241874|pdb|2H6Y|A Chain A, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal
           (P61) Space Group
 gi|149241875|pdb|2H6Y|B Chain B, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal
           (P61) Space Group
          Length = 108

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D+IAD+   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADDYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|23011138|ref|ZP_00051592.1| COG0526: Thiol-disulfide isomerase and thioredoxins
           [Magnetospirillum magnetotacticum MS-1]
          Length = 93

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 62/84 (73%), Gaps = 1/84 (1%)

Query: 20  NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLIL 79
           +PVVVDFWA WC PC ++ P +++I+ +L  KVKI K++++E+  I++ Y I SIPTL++
Sbjct: 7   SPVVVDFWAEWCGPCRQIGPALEEISVDLQGKVKIAKVNVDENPGIASTYGIRSIPTLMI 66

Query: 80  FKDGKVIDRMMPGASSQSDIIEWI 103
           FKDGK+  + + GA+ + D+  WI
Sbjct: 67  FKDGKLASQKV-GAAPKGDLSRWI 89


>gi|332520057|ref|ZP_08396521.1| thioredoxin [Lacinutrix algicola 5H-3-7-4]
 gi|332044616|gb|EGI80810.1| thioredoxin [Lacinutrix algicola 5H-3-7-4]
          Length = 105

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 61/88 (69%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F+ +VL    PV+VDFWA+WC PC  + PIID I++E   K  + K+D++ +
Sbjct: 2  ALEITDANFEEKVLNSDKPVMVDFWAAWCGPCRMVGPIIDQISEEYEGKAVVGKVDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E + +Y + +IPT+++F++G+V+ R +
Sbjct: 62 QEFAAKYGVRNIPTVLVFQNGEVVGRQV 89


>gi|156935888|ref|YP_001439804.1| thioredoxin [Cronobacter sakazakii ATCC BAA-894]
 gi|260596010|ref|YP_003208581.1| thioredoxin [Cronobacter turicensis z3032]
 gi|296105328|ref|YP_003615474.1| thioredoxin [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|156534142|gb|ABU78968.1| hypothetical protein ESA_03776 [Cronobacter sakazakii ATCC BAA-894]
 gi|260215187|emb|CBA27019.1| Thioredoxin-1 [Cronobacter turicensis z3032]
 gi|295059787|gb|ADF64525.1| thioredoxin [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 109

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+     +VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|51210005|ref|YP_063669.1| thioredoxin [Gracilaria tenuistipitata var. liui]
 gi|50657759|gb|AAT79744.1| thioredoxin [Gracilaria tenuistipitata var. liui]
          Length = 113

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L+V   SF+ EV++ S PV+VDFWA WC PC  ++P+++ IA E  DK+K+  L+ +
Sbjct: 1   MHVLEVMDASFNEEVIKSSYPVLVDFWAPWCGPCRMVAPVVNQIAHEYKDKLKVVTLNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           ++   +  Y I SIPTLI+F +G+ +  ++ GA  +S +I
Sbjct: 61  KNPSTAAEYGIRSIPTLIIFIEGQRVHTVV-GAIPKSTLI 99


>gi|464884|sp|P33791|THIO_STRAU RecName: Full=Thioredoxin; Short=Trx
 gi|939972|emb|CAA51317.1| thioredoxin [Streptomyces aureofaciens]
          Length = 106

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   +F S+VLE   PV+V F   WC PC  ++P++D+IA+E   KVK+ K++ +E
Sbjct: 2   ATVKVTNATFKSDVLESDKPVLVHFEGPWCGPCKMVAPVLDEIANEYEGKVKVAKVNTDE 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +++++Y + SIPT ++FK G+V   M+ GA+ ++ +  ++
Sbjct: 62  NPQLASQYGVRSIPTRLMFKGGEVAANMV-GAAPKTRLAAFL 102


>gi|266620817|ref|ZP_06113752.1| thioredoxin-1 [Clostridium hathewayi DSM 13479]
 gi|288867555|gb|EFC99853.1| thioredoxin-1 [Clostridium hathewayi DSM 13479]
          Length = 108

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + ++  +FD EVL+   PVV+DFWA WC  C +L P++D +A +   K+ + K+DI+
Sbjct: 1   MDIMTINKDNFDKEVLQAEKPVVLDFWAPWCGYCRRLGPVVDRLAAQYEGKLLVGKVDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMM-PGASSQSDIIEWI 103
           ES E+  +++I +IPTLI+++ G+  + ++ PG  S ++I +W+
Sbjct: 61  ESPELEEKHEIETIPTLIVYQGGRASEPLINPG--SMTEIEDWL 102


>gi|170724879|ref|YP_001758905.1| thioredoxin [Shewanella woodyi ATCC 51908]
 gi|169810226|gb|ACA84810.1| thioredoxin [Shewanella woodyi ATCC 51908]
          Length = 108

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V+  + PVVVDFWA WC PC  ++PI+DD+A+E   KV I K++++++S    +Y
Sbjct: 12  SFENDVINSTLPVVVDFWAEWCGPCKMIAPILDDVAEEYEGKVTIAKMNVDQNSVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL++FK+G++    + GA S++ + E+I
Sbjct: 72  GVRGIPTLLIFKNGELASTKV-GALSKTQLKEFI 104


>gi|157833946|pdb|1THO|A Chain A, Crystal Structure Of A Mutant Escherichia Coli Thioredoxin
           With An Arginine Insertion In The Active Site
          Length = 109

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 66/95 (69%), Gaps = 2/95 (2%)

Query: 10  SFDSEVLECSNPVVVDFWASWC-RPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           SFD++VL+    ++VDFWA WC RPC  ++PI+D+IADE   K+ + KL+I+++   + +
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGRPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPK 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  YGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|260586973|ref|ZP_05852886.1| thioredoxin [Blautia hansenii DSM 20583]
 gi|260542657|gb|EEX23226.1| thioredoxin [Blautia hansenii DSM 20583]
          Length = 102

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 62/86 (72%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A++  +++F  EVL+   PV+VDFWASWC PC  L+P+I+++A+E     K+ K+D++  
Sbjct: 2  AMEFTSENFAKEVLQSDVPVLVDFWASWCMPCKMLAPVIEELAEEANGNYKVGKIDVDAE 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDR 88
            ++ +Y I +IPT+++FK+G+V D+
Sbjct: 62 PSLAAQYGIMNIPTVLVFKNGQVADK 87


>gi|167772537|ref|ZP_02444590.1| hypothetical protein ANACOL_03915 [Anaerotruncus colihominis DSM
           17241]
 gi|167665015|gb|EDS09145.1| hypothetical protein ANACOL_03915 [Anaerotruncus colihominis DSM
           17241]
          Length = 103

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 69/103 (66%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V + +F++EVL    PV+VDFWA WC PC  +SP++D IA+E    VK+ K++++
Sbjct: 1   MATVTVTSNNFEAEVLNADRPVLVDFWAPWCGPCRMVSPVLDTIAEE-TPSVKVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++  +++ SIPTL  F+DGK+    + G  S++ I++ +
Sbjct: 60  EQPELAQTFKVMSIPTLAAFRDGKLTGTSV-GVRSKAQILQML 101


>gi|116619824|ref|YP_821980.1| thioredoxin [Candidatus Solibacter usitatus Ellin6076]
 gi|116222986|gb|ABJ81695.1| thioredoxin [Candidatus Solibacter usitatus Ellin6076]
          Length = 148

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + V  K+F + V + + PV+VD WA WC PC  ++P ++ +A E+A ++++ K+++++
Sbjct: 43  SPIVVTDKTFAAVVEQSAVPVLVDLWAPWCGPCRMVAPAVEALAAEMAGRLRVAKINVDD 102

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +S+R+ + SIPTL+L + G+ ++R++ GA  + DI  W+
Sbjct: 103 NPGVSSRFNVQSIPTLLLIRGGREVNRLV-GAQPKQDIARWL 143


>gi|188996320|ref|YP_001930571.1| thioredoxin [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931387|gb|ACD66017.1| thioredoxin [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 105

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 61/84 (72%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V+  +F+ EVL    PV+VDFWA WC PC  ++PI++++A EL  K K+ K++ +E+ 
Sbjct: 6  ISVNESNFEQEVLNSDVPVLVDFWAPWCGPCRLIAPIVEELAVELEGKAKVVKVNTDENP 65

Query: 64 EISTRYQISSIPTLILFKDGKVID 87
           ++ +Y I +IPT+++FK+G+V+D
Sbjct: 66 NLAMKYGIRAIPTIMVFKNGRVVD 89


>gi|330829354|ref|YP_004392306.1| thiol-disulfide isomerase and thioredoxins [Aeromonas veronii B565]
 gi|328804490|gb|AEB49689.1| Thiol-disulfide isomerase and thioredoxins [Aeromonas veronii B565]
          Length = 144

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWASWC PC + +P+  ++A EL  +++  K+D E+ S I+ RY I SIPTL++F
Sbjct: 57  PVVVDFWASWCGPCQQFAPVFHEVAHELEPRMRFAKVDTEQQSTIAARYAIRSIPTLMVF 116

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           + GK+++++  G+  +S   +W+
Sbjct: 117 QQGKLVNQIN-GSLPKSMFKQWL 138


>gi|294781867|ref|ZP_06747199.1| thioredoxin [Fusobacterium sp. 1_1_41FAA]
 gi|294481678|gb|EFG29447.1| thioredoxin [Fusobacterium sp. 1_1_41FAA]
          Length = 103

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 66/88 (75%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K   ++F++EVL+    VVVDF A+WC PC  L PI+D++ +E  +K KI K+DI+
Sbjct: 1  MAVIKGTKENFEAEVLKAEGIVVVDFGANWCGPCKSLVPILDEVVEEDPNK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ +Y+I S+PTL++F++G++ID+
Sbjct: 60 EEEELAAQYKIMSVPTLLVFRNGEIIDK 87


>gi|156976914|ref|YP_001447820.1| thioredoxin 2 [Vibrio harveyi ATCC BAA-1116]
 gi|156528508|gb|ABU73593.1| hypothetical protein VIBHAR_05698 [Vibrio harveyi ATCC BAA-1116]
          Length = 162

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +LE + PVVVDFWA WC PCV  +P+ +D+A E     +  K+D E   +++ ++ I 
Sbjct: 67  SVLLESNTPVVVDFWAPWCNPCVGFAPVFEDVAQEQTGNARFVKIDTEAQQQLAAQFGIR 126

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  ++   +W+
Sbjct: 127 SIPTIMVFKNGQRVD-MINGALPKTQFDQWL 156


>gi|318604498|emb|CBY25996.1| thioredoxin 2 [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 146

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVV+DFWASWC PC   +PI  ++A E A KV+  K++ E    +STR++I SIPT++L+
Sbjct: 54  PVVIDFWASWCGPCRSFAPIFTEVAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLY 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           ++GK++D M+ GA  ++    W+
Sbjct: 114 RNGKMVD-MLSGALPKAAFDNWL 135


>gi|298207575|ref|YP_003715754.1| thioredoxin [Croceibacter atlanticus HTCC2559]
 gi|83850211|gb|EAP88079.1| thioredoxin [Croceibacter atlanticus HTCC2559]
          Length = 105

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 61/88 (69%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F+  VL+   PV+VDFWA+WC PC  + PIIDDI+ +   K  + KLD++ +
Sbjct: 2  ALEITDANFEDTVLKSDKPVMVDFWAAWCGPCRMVGPIIDDISKDYEGKAVVGKLDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E + +Y + +IPT+++F++G+V+ R +
Sbjct: 62 QEFAAKYGVRNIPTVLVFQNGEVVGRQV 89


>gi|322421448|ref|YP_004200671.1| thioredoxin [Geobacter sp. M18]
 gi|320127835|gb|ADW15395.1| thioredoxin [Geobacter sp. M18]
          Length = 109

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 59/81 (72%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F+ EVL+   PV+VDFWA+WC PC  ++P+ID +A E   +VK+ K++++++     +Y
Sbjct: 13 NFEKEVLQSEIPVLVDFWATWCAPCKAIAPLIDTVASEYEGRVKVGKVNVDDNPATPGKY 72

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           +  IPT+IL KDGKV+D+++
Sbjct: 73 GVRGIPTVILIKDGKVLDQVV 93


>gi|126176119|ref|YP_001052268.1| thioredoxin [Shewanella baltica OS155]
 gi|153002455|ref|YP_001368136.1| thioredoxin [Shewanella baltica OS185]
 gi|160877174|ref|YP_001556490.1| thioredoxin [Shewanella baltica OS195]
 gi|217975024|ref|YP_002359775.1| thioredoxin [Shewanella baltica OS223]
 gi|304412473|ref|ZP_07394079.1| thioredoxin [Shewanella baltica OS183]
 gi|307307132|ref|ZP_07586870.1| thioredoxin [Shewanella baltica BA175]
 gi|125999324|gb|ABN63399.1| thioredoxin [Shewanella baltica OS155]
 gi|151367073|gb|ABS10073.1| thioredoxin [Shewanella baltica OS185]
 gi|160862696|gb|ABX51230.1| thioredoxin [Shewanella baltica OS195]
 gi|217500159|gb|ACK48352.1| thioredoxin [Shewanella baltica OS223]
 gi|304349115|gb|EFM13527.1| thioredoxin [Shewanella baltica OS183]
 gi|306910371|gb|EFN40802.1| thioredoxin [Shewanella baltica BA175]
 gi|315269378|gb|ADT96231.1| thioredoxin [Shewanella baltica OS678]
          Length = 108

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI+DD+++E A +V I KL++++++    +Y
Sbjct: 12  SFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVSEEYAGRVTIAKLNVDQNNVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTL+LFK+G++    + GA S++ + E+I +++
Sbjct: 72  GVRGIPTLLLFKNGELAATKV-GALSKTQLKEFIDAQI 108


>gi|189346343|ref|YP_001942872.1| thioredoxin [Chlorobium limicola DSM 245]
 gi|189340490|gb|ACD89893.1| thioredoxin [Chlorobium limicola DSM 245]
          Length = 109

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 61/87 (70%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L    ++F +E+LE     +VDFWA+WC PC+ L P+I+++A +   K  I K++++E+ 
Sbjct: 6  LAATDQNFKTEILESDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAVIAKVNVDENP 65

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
            + +Y I SIPT+++FK+G+V+D+M+
Sbjct: 66 NTAAQYGIRSIPTMLVFKNGQVVDQMV 92


>gi|323484058|ref|ZP_08089428.1| thioredoxin-disulfide reductase [Clostridium symbiosum WAL-14163]
 gi|323402500|gb|EGA94828.1| thioredoxin-disulfide reductase [Clostridium symbiosum WAL-14163]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 67/96 (69%), Gaps = 3/96 (3%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
            +F+  VL+   PV+VDFWA WC  C +LSP I+ +++E  + VK+ KLDI+E  E++ +
Sbjct: 8   NNFEETVLKAKGPVIVDFWAPWCGYCRRLSPAIERMSEEHGETVKMVKLDIDEEPELAEK 67

Query: 69  YQISSIPTLILFKDGKVIDRMM-PGASSQSDIIEWI 103
           Y I +IP+L+LF+DG+++  ++ PG  SQ  + +W+
Sbjct: 68  YDIDTIPSLLLFRDGELVSSVVNPG--SQDAVEDWL 101


>gi|319796122|ref|YP_004157762.1| thioredoxin [Variovorax paradoxus EPS]
 gi|315598585|gb|ADU39651.1| thioredoxin [Variovorax paradoxus EPS]
          Length = 148

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
           D  +FD  +     PV+VDFWA WC PC +++P  +  A +L   V++ K+D E    + 
Sbjct: 48  DAATFDRHIARNEIPVLVDFWAPWCGPCRQMAPGYEQAAAQLEPHVRLAKVDTEAVPALG 107

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            R+ I SIPTL LF+ G+ + R   GA   +DI+ W+
Sbjct: 108 ARFNIRSIPTLALFRGGREVARQA-GAMGAADIVRWV 143


>gi|229593268|ref|YP_002875387.1| thioredoxin [Pseudomonas fluorescens SBW25]
 gi|229365134|emb|CAY53370.1| thioredoxin [Pseudomonas fluorescens SBW25]
          Length = 109

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 62/90 (68%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+ + PV+VD+WA WC PC  ++P++DDIA     K+ I KL+I+++ E   ++
Sbjct: 13  TFEAEVLKAAGPVLVDYWAEWCGPCKMIAPVLDDIATTYEGKLTIAKLNIDDNQETPAKH 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            +  IPTL+LFK+G V +    GA S+S +
Sbjct: 73  GVRGIPTLMLFKNGNV-EATKVGALSKSQL 101


>gi|170767206|ref|ZP_02901659.1| putative thioredoxin [Escherichia albertii TW07627]
 gi|170123540|gb|EDS92471.1| putative thioredoxin [Escherichia albertii TW07627]
          Length = 139

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (61%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+R+ I SIPT+++FK+G+++D M+ GA  ++    W+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQIVD-MLNGAVPKAPFDSWL 135


>gi|169632014|ref|YP_001705663.1| thioredoxin (Trx) [Mycobacterium abscessus ATCC 19977]
 gi|169243981|emb|CAM65009.1| Thioredoxin (Trx) [Mycobacterium abscessus]
          Length = 109

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 66/91 (72%), Gaps = 1/91 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  +V+  + PV+VDFWA+WC PC  ++P++++IA +  + + I KLD++ + E +  +
Sbjct: 13  SFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDANPETARAF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           Q++SIPTLILF++G+   R++ GA S+S ++
Sbjct: 73  QVTSIPTLILFQNGEATKRIV-GAKSKSALL 102


>gi|153870631|ref|ZP_01999992.1| Thioredoxin [Beggiatoa sp. PS]
 gi|152072908|gb|EDN70013.1| Thioredoxin [Beggiatoa sp. PS]
          Length = 106

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 60/89 (67%), Gaps = 2/89 (2%)

Query: 4  LKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          + V  ++F SEV+E SN  PV+VDFWA WC PC  L PI+  + ++   +  + KL+I+E
Sbjct: 8  ITVTAQNFASEVIEKSNQVPVLVDFWAEWCAPCKILMPILTQLVEKYQGQFILAKLNIDE 67

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
            E++T+Y I S+PTL LF+ G+ ++ MM
Sbjct: 68 QKELATQYGIRSVPTLKLFRHGQAVEEMM 96


>gi|189500150|ref|YP_001959620.1| thioredoxin [Chlorobium phaeobacteroides BS1]
 gi|189495591|gb|ACE04139.1| thioredoxin [Chlorobium phaeobacteroides BS1]
          Length = 109

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           ++F + +L+     +VDFWA+WC PC  L P+I+++A E   K  I+KL+++E+ + + +
Sbjct: 11  QNFKASILDSDKVALVDFWAAWCGPCQMLGPVIEELAGEFEGKAVISKLNVDENPDTAAQ 70

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           Y + SIPT+++FK+G+V+D+M+ GA  ++ I E I +++
Sbjct: 71  YGVRSIPTMLIFKNGEVVDQMV-GAMPKNMIAEKINAQL 108


>gi|307133002|ref|YP_003885018.1| thioredoxin 1 [Dickeya dadantii 3937]
 gi|306530531|gb|ADN00462.1| thioredoxin 1 [Dickeya dadantii 3937]
          Length = 108

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+  +  +VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+E+   + +Y
Sbjct: 12  SFETDVLQSEHVTLVDFWADWCGPCKMIAPILDEIADEFDGKLTVAKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 108


>gi|312963770|ref|ZP_07778241.1| thioredoxin [Pseudomonas fluorescens WH6]
 gi|311281805|gb|EFQ60415.1| thioredoxin [Pseudomonas fluorescens WH6]
          Length = 109

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 62/90 (68%), Gaps = 1/90 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F++EVL+ + PV+VD+WA WC PC  ++P++DDIA     K+ I KL+I+++ E   ++
Sbjct: 13  TFEAEVLKATGPVLVDYWAEWCGPCKMIAPVLDDIATTYEGKLTIAKLNIDDNQETPAKH 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            +  IPTL+LFK+G V +    GA S+S +
Sbjct: 73  GVRGIPTLMLFKNGNV-EATKVGALSKSQL 101


>gi|158428377|pdb|2EIO|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And
          Multimers Through Analysis Of Crystal Contacts
 gi|158428378|pdb|2EIO|B Chain B, Design Of Disulfide-Linked Thioredoxin Dimers And
          Multimers Through Analysis Of Crystal Contacts
 gi|158428379|pdb|2EIO|C Chain C, Design Of Disulfide-Linked Thioredoxin Dimers And
          Multimers Through Analysis Of Crystal Contacts
 gi|158428380|pdb|2EIO|D Chain D, Design Of Disulfide-Linked Thioredoxin Dimers And
          Multimers Through Analysis Of Crystal Contacts
          Length = 108

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 56/76 (73%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11 SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70 QISSIPTLILFKDGKV 85
           I  IPTL+LFK+G+V
Sbjct: 71 GIRGIPTLLLFKNGEV 86


>gi|49079980|gb|AAT49956.1| PA5240 [synthetic construct]
          Length = 109

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 68/104 (65%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL+   PV+VD+WA WC PC  ++P++D++A +   K+K+ KL+I+E+ 
Sbjct: 6   VNVTDASFEQDVLKADGPVLVDYWAEWCGPCKMIAPVLDEVARDYQGKLKVCKLNIDENQ 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +Y +  IPTL+LFKDG V +    GA S+S +  ++ + +
Sbjct: 66  DTPPKYGVRGIPTLMLFKDGNV-EATKVGALSKSQLAAFLDANI 108


>gi|319901088|ref|YP_004160816.1| thioredoxin [Bacteroides helcogenes P 36-108]
 gi|319416119|gb|ADV43230.1| thioredoxin [Bacteroides helcogenes P 36-108]
          Length = 104

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 58/90 (64%)

Query: 8  TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
          T S   E++    PVV+DFWA WC PC  + PIID++A E   +V I K D++ES +++ 
Sbjct: 6  TDSNYQELVAGGKPVVIDFWAPWCGPCKMVGPIIDELAAEYEGRVVIGKCDVDESGDVAA 65

Query: 68 RYQISSIPTLILFKDGKVIDRMMPGASSQS 97
           Y I +IPT++ FKDGK++D+ +  A   +
Sbjct: 66 EYGIRNIPTVLFFKDGKLVDKQVGSAPKTA 95


>gi|301155858|emb|CBW15326.1| thioredoxin 1 [Haemophilus parainfluenzae T3T1]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L ++   F++ V++   PV+VDFWA WC PC  ++PI+D+IA E A K KI K++++++ 
Sbjct: 5   LHINDADFETAVVQSDIPVLVDFWAPWCGPCKMIAPILDEIAPEFAGKAKIVKINVDDNQ 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++ ++ + SIPTL+LFK+G+++   + GA  ++ +  +I
Sbjct: 65  LVAGQFGVRSIPTLLLFKNGQLVATQV-GALPKNQLAAFI 103


>gi|167042846|gb|ABZ07563.1| putative thioredoxin [uncultured marine microorganism
           HF4000_ANIW137J11]
          Length = 205

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 72/99 (72%), Gaps = 2/99 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A++V   +F+S + + +  V+VDFWA WC PC  ++P++++IADE  DKV I K++ +E
Sbjct: 102 NAIEVTDDTFESTIAD-NKLVLVDFWAPWCGPCRMVAPVLEEIADEHGDKVTIAKVNTDE 160

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +  +++++ I SIPT++LFKDG+ ID+M+ GA  +  I+
Sbjct: 161 NQAVASKHGIMSIPTMMLFKDGEKIDQMV-GALPKPQIM 198


>gi|319793172|ref|YP_004154812.1| thioredoxin [Variovorax paradoxus EPS]
 gi|315595635|gb|ADU36701.1| thioredoxin [Variovorax paradoxus EPS]
          Length = 110

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+ S PV+VD+WA WC PC  ++PI+D+++     K++I KL+++E+ +I  ++
Sbjct: 13  SFEADVLKSSQPVLVDYWAEWCGPCKMIAPILDEVSATYEGKLQIAKLNVDENRDIPAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG++    + GA S++ +  +I
Sbjct: 73  GIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFI 105


>gi|227506197|ref|ZP_03936246.1| possible thioredoxin [Corynebacterium striatum ATCC 6940]
 gi|227197221|gb|EEI77269.1| possible thioredoxin [Corynebacterium striatum ATCC 6940]
          Length = 109

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 75/106 (70%), Gaps = 4/106 (3%)

Query: 1   MSALK-VDTKSFDSEVLE--CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS +K V T SF +EV+E   S PVVVDFWA WC PC KLSPI+DD+A EL D VK+ K+
Sbjct: 1   MSNVKNVTTDSFRTEVIESSASKPVVVDFWAEWCGPCKKLSPILDDVAGELGDDVKVVKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +++E   +   +QI SIP++++F++G+ +D  + G  S+SDI+  I
Sbjct: 61  NVDEERTLGAMFQIMSIPSVLIFRNGEKVDEFV-GLRSKSDIVAQI 105


>gi|154491986|ref|ZP_02031612.1| hypothetical protein PARMER_01617 [Parabacteroides merdae ATCC
           43184]
 gi|218264824|ref|ZP_03478512.1| hypothetical protein PRABACTJOHN_04222 [Parabacteroides johnsonii
           DSM 18315]
 gi|154088227|gb|EDN87272.1| hypothetical protein PARMER_01617 [Parabacteroides merdae ATCC
           43184]
 gi|218221766|gb|EEC94416.1| hypothetical protein PRABACTJOHN_04222 [Parabacteroides johnsonii
           DSM 18315]
          Length = 104

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 68/98 (69%), Gaps = 2/98 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+ E++    P+V+DFWA WC PC  + PIID++A E   +V I K+D++ +
Sbjct: 2   ALQITDANFE-ELVNSGKPMVLDFWAEWCGPCRMVGPIIDELATEYEGRVTIGKMDVDNN 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +++  ++ I +IPT++ FKDGKV+D+ + GA+ ++  +
Sbjct: 61  NDVVAQFGIRNIPTVLFFKDGKVVDKQV-GAAPKTTFV 97


>gi|15600433|ref|NP_253927.1| thioredoxin [Pseudomonas aeruginosa PAO1]
 gi|107104342|ref|ZP_01368260.1| hypothetical protein PaerPA_01005417 [Pseudomonas aeruginosa PACS2]
 gi|116053387|ref|YP_793712.1| thioredoxin [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894342|ref|YP_002443212.1| thioredoxin [Pseudomonas aeruginosa LESB58]
 gi|254238063|ref|ZP_04931386.1| thioredoxin [Pseudomonas aeruginosa C3719]
 gi|254243878|ref|ZP_04937200.1| thioredoxin [Pseudomonas aeruginosa 2192]
 gi|296392098|ref|ZP_06881573.1| thioredoxin [Pseudomonas aeruginosa PAb1]
 gi|313110310|ref|ZP_07796202.1| thioredoxin [Pseudomonas aeruginosa 39016]
 gi|13878813|sp|Q9X2T1|THIO_PSEAE RecName: Full=Thioredoxin; Short=Trx
 gi|4773898|gb|AAD29108.2|AF053463_2 thioredoxin [Pseudomonas aeruginosa]
 gi|9951549|gb|AAG08625.1|AE004936_8 thioredoxin [Pseudomonas aeruginosa PAO1]
 gi|115588608|gb|ABJ14623.1| thioredoxin [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169994|gb|EAZ55505.1| thioredoxin [Pseudomonas aeruginosa C3719]
 gi|126197256|gb|EAZ61319.1| thioredoxin [Pseudomonas aeruginosa 2192]
 gi|218774571|emb|CAW30388.1| thioredoxin [Pseudomonas aeruginosa LESB58]
 gi|310882704|gb|EFQ41298.1| thioredoxin [Pseudomonas aeruginosa 39016]
          Length = 108

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 68/104 (65%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL+   PV+VD+WA WC PC  ++P++D++A +   K+K+ KL+I+E+ 
Sbjct: 6   VNVTDASFEQDVLKADGPVLVDYWAEWCGPCKMIAPVLDEVARDYQGKLKVCKLNIDENQ 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +Y +  IPTL+LFKDG V +    GA S+S +  ++ + +
Sbjct: 66  DTPPKYGVRGIPTLMLFKDGNV-EATKVGALSKSQLAAFLDANI 108


>gi|163785102|ref|ZP_02179811.1| thioredoxin [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879629|gb|EDP73424.1| thioredoxin [Hydrogenivirga sp. 128-5-R1-1]
          Length = 105

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 62/82 (75%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          ++ ++++ EVL    PV+VDFWA WC PC  ++P+I+++A+EL  K K+ KL+ +E+  I
Sbjct: 8  LNEQNWEQEVLNSDVPVLVDFWAPWCGPCRLIAPVIEELAEELEGKAKVCKLNTDENPNI 67

Query: 66 STRYQISSIPTLILFKDGKVID 87
          + +Y I +IPT+++FK+G+V+D
Sbjct: 68 AMKYGIRAIPTIMVFKNGQVVD 89


>gi|148555594|ref|YP_001263176.1| thioredoxin [Sphingomonas wittichii RW1]
 gi|148500784|gb|ABQ69038.1| thioredoxin [Sphingomonas wittichii RW1]
          Length = 106

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    +   SF  +V+    PV+VDFWA WC PC  + P +++IADEL +KV I K++I+
Sbjct: 1   MPTKAITDSSFHDDVISADKPVLVDFWAEWCGPCKMIGPALEEIADELGEKVTIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ++ +   +Y +  IPT+ILFK+G+     + GA+ +S +  W+
Sbjct: 61  DNPDAPGKYGVRGIPTMILFKNGQPTATKV-GAAPKSQLKGWL 102


>gi|319953454|ref|YP_004164721.1| thioredoxin [Cellulophaga algicola DSM 14237]
 gi|319422114|gb|ADV49223.1| thioredoxin [Cellulophaga algicola DSM 14237]
          Length = 105

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 61/88 (69%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +FD  VL+   PVVVDFWA+WC PC  + PIID+++ E   K  + K+D++ +
Sbjct: 2  ALEITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPIIDEVSTEYDGKAVVGKVDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E + +Y + +IPT+++FK+G+++ R +
Sbjct: 62 QEFAAKYGVRNIPTVLVFKNGEIVSRQV 89


>gi|163804084|ref|ZP_02197876.1| hypothetical protein 1103602000506_AND4_04273 [Vibrio sp. AND4]
 gi|159172102|gb|EDP57049.1| hypothetical protein AND4_04273 [Vibrio sp. AND4]
          Length = 139

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 59/91 (64%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +LE   PV+VDFWA WC PCV  +P+ +D+A E     +  K+D E   +++ ++ I 
Sbjct: 44  SALLESKTPVIVDFWAPWCNPCVGFAPVFEDVAHEQTGAARFVKIDTEAQQQLAAQFGIR 103

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  ++   +W+
Sbjct: 104 SIPTIMVFKNGQRVD-MLNGALPKTQFDQWL 133


>gi|89890045|ref|ZP_01201556.1| thiol-disulfide isomerase/thioredoxin [Flavobacteria bacterium
           BBFL7]
 gi|89518318|gb|EAS20974.1| thiol-disulfide isomerase/thioredoxin [Flavobacteria bacterium
           BBFL7]
          Length = 106

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 70/105 (66%), Gaps = 2/105 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+  VL    PV+VDFWA+WC PC  + PIID++A +   K  + K+D++ +
Sbjct: 2   ALEITDANFEETVLNSEKPVLVDFWAAWCGPCRMVGPIIDEVATDYDGKAVVGKMDVDAN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGA--SSQSDIIEWILS 105
            E + +Y + +IPT+++F++G+V+ R +  A  ++ +D I+ +L+
Sbjct: 62  QEFAAKYGVRNIPTVLVFQNGEVVGRQVGVAPKNAYTDAIDALLN 106


>gi|262067277|ref|ZP_06026889.1| thioredoxin [Fusobacterium periodonticum ATCC 33693]
 gi|291379003|gb|EFE86521.1| thioredoxin [Fusobacterium periodonticum ATCC 33693]
          Length = 103

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 66/88 (75%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K   ++F++EVL  +  VVVDF A+WC PC  L PI+D++ +E  +K KI K+DI+
Sbjct: 1  MAIIKGTKENFEAEVLNAAGIVVVDFGANWCGPCKSLVPILDEVVEEDPNK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ +Y+I S+PTL++F++G++ID+
Sbjct: 60 EEEELAAQYRIMSVPTLLVFRNGEIIDK 87


>gi|170078222|ref|YP_001734860.1| thioredoxin [Synechococcus sp. PCC 7002]
 gi|169885891|gb|ACA99604.1| thioredoxin [Synechococcus sp. PCC 7002]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 64/90 (71%), Gaps = 1/90 (1%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F  EVLE   PV+VDFWA WC PC  ++P++++IA++  D++K+ KL+ +E+  +++ Y
Sbjct: 11 TFQEEVLESDVPVLVDFWAPWCGPCRMVAPVVEEIAEQYQDQIKVFKLNTDENPGVASEY 70

Query: 70 QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           I SIPTL++FK GK +  M+ GA  ++ +
Sbjct: 71 GIRSIPTLMIFKGGKKVS-MVVGAVPKTTL 99


>gi|72382530|ref|YP_291885.1| thioredoxin [Prochlorococcus marinus str. NATL2A]
 gi|124026231|ref|YP_001015347.1| thioredoxin [Prochlorococcus marinus str. NATL1A]
 gi|72002380|gb|AAZ58182.1| thioredoxin [Prochlorococcus marinus str. NATL2A]
 gi|123961299|gb|ABM76082.1| Thioredoxin [Prochlorococcus marinus str. NATL1A]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A  V   SF+ EVL+   PV+VDFWA WC PC  ++PI+++I+ +   K+K+ KL+ +E
Sbjct: 3  TASAVTDSSFEQEVLQSDVPVLVDFWAPWCGPCRMVAPIVEEISKDFEGKIKVYKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMIFKGGQKVDTVV 91


>gi|188584778|ref|YP_001916323.1| thioredoxin [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179349465|gb|ACB83735.1| thioredoxin [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 73/103 (70%), Gaps = 3/103 (2%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L+V+  +F  +VLE   PV+V+FWA WC PC  ++P+++++A+E+  K+KI K++++E++
Sbjct: 5   LEVNDTNFKEQVLEADKPVLVEFWAPWCGPCKMVAPVLEELAEEMDGKIKICKVNVDENT 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRM---MPGASSQSDIIEWI 103
           + ++ Y + SIPT++L KDG+V +++   +P    Q+ I E I
Sbjct: 65  DTASDYGVMSIPTMVLIKDGEVQEQVVGYLPREELQNKIEENI 107


>gi|90023295|ref|YP_529122.1| thioredoxin [Saccharophagus degradans 2-40]
 gi|89952895|gb|ABD82910.1| thioredoxin [Saccharophagus degradans 2-40]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++V   SF+ +VL    PV+VD+WA+WC PC  ++P++D++A E   K+KI K+D++ + 
Sbjct: 6   VQVSDASFEQDVLSSDIPVLVDYWAAWCGPCKMIAPVLDELAKEYEGKIKICKMDVDANK 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   +Y I  IPTLI+FK G   +    GA S++ + E+I
Sbjct: 66  ETPAKYNIRGIPTLIMFKGGNA-EGTKVGALSKAQLKEFI 104


>gi|320532836|ref|ZP_08033611.1| thioredoxin [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320134951|gb|EFW27124.1| thioredoxin [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL V   +F+ EVL+   PVV+DFWA WC PC +++PI+D++A +  DKVK  K+D++ +
Sbjct: 4   ALAVTDATFEEEVLKSEVPVVIDFWAEWCGPCRQMAPIVDEVATDFGDKVKFVKVDVDAN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRM---MPGASSQSDI 99
              +  Y + SIPT  + +DG++  +     P AS ++++
Sbjct: 64  PATARSYGVRSIPTFAVVRDGEIFHQFSGSRPKASFKAEV 103


>gi|297539611|ref|YP_003675380.1| thioredoxin [Methylotenera sp. 301]
 gi|297258958|gb|ADI30803.1| thioredoxin [Methylotenera sp. 301]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            ++  SF+ +VL+   PV+VD+WA WC PC  ++PI+D+I+ E A ++K+ KL+I+++  
Sbjct: 7   HLNDASFEQDVLQSQLPVLVDYWAEWCGPCKMIAPILDEISKEYAGRLKVGKLNIDDNQL 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +Y I  IPTL+LFK+G V +    GA S+S +  +I S +
Sbjct: 67  TPPKYGIRGIPTLMLFKNGNV-EATKVGALSKSQLTAFIDSNI 108


>gi|84501211|ref|ZP_00999416.1| thioredoxin [Oceanicola batsensis HTCC2597]
 gi|84390502|gb|EAQ02990.1| thioredoxin [Oceanicola batsensis HTCC2597]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FDSEV     PVVVDFWA WC PC ++ P ++++++E  +K+KI K+D++
Sbjct: 1   MTTVAVTDDTFDSEVKNSEVPVVVDFWAEWCGPCKQIGPALEELSEEFGEKLKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +     +  +  IP L +FKDG+VI     GA+ ++ +  WI
Sbjct: 61  SNPNTPMQLGVRGIPALFIFKDGEVISNRA-GAAPKASLKAWI 102


>gi|186686280|ref|YP_001869476.1| thioredoxin [Nostoc punctiforme PCC 73102]
 gi|186468732|gb|ACC84533.1| thioredoxin [Nostoc punctiforme PCC 73102]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 58/89 (65%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S   V   +F  EVLE   PV+VDFWA WC PC  + P++D++A E   +VK  KL+ ++
Sbjct: 3  SITNVTEATFKQEVLESEIPVLVDFWAPWCGPCRMVGPVVDEVAAEYEGQVKFVKLNTDQ 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  +++ Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPTVASHYGIRSIPTLMVFKGGRQVDTVV 91


>gi|91791812|ref|YP_561463.1| thioredoxin [Shewanella denitrificans OS217]
 gi|91713814|gb|ABE53740.1| thioredoxin [Shewanella denitrificans OS217]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI+DD+A E A +V + KL++++++    +Y
Sbjct: 12  SFENDVLKSELPVLVDFWAEWCGPCKMIAPILDDVAQEYAGRVTVAKLNVDQNNVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTL++FK G+++   + GA S++ + E++ +++
Sbjct: 72  GVRGIPTLLMFKGGELVATKV-GALSKTQLKEFMDAQI 108


>gi|84514935|ref|ZP_01002298.1| thioredoxin [Loktanella vestfoldensis SKA53]
 gi|84511094|gb|EAQ07548.1| thioredoxin [Loktanella vestfoldensis SKA53]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV +   PVVVDFWA WC PC ++ P ++++++E+A KVKI K++++
Sbjct: 1   MATVAVTDATFDAEVRQSDIPVVVDFWAEWCGPCKQIGPALEELSNEMAGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ++     +  +  IP L +FK+G+V+     GA+ ++ I  WI
Sbjct: 61  DNPNSPAQMGVRGIPALFVFKNGQVVANKA-GAAPKAAIQGWI 102


>gi|292493688|ref|YP_003529127.1| thioredoxin [Nitrosococcus halophilus Nc4]
 gi|291582283|gb|ADE16740.1| thioredoxin [Nitrosococcus halophilus Nc4]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 66/104 (63%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F+ EV++   P +VD+WA WC PC  ++PI+++IA E   K+KI KL+I+E+ 
Sbjct: 6   ISVTDATFEEEVIKSEQPALVDYWAEWCGPCKMVAPILEEIAKEYEGKLKICKLNIDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               RY I  IPTL+LFK+G V +    GA S+S +  +I S +
Sbjct: 66  STPPRYGIRGIPTLMLFKNGNV-EATKVGALSKSQLAAFIDSNL 108


>gi|195057101|ref|XP_001995200.1| GH23019 [Drosophila grimshawi]
 gi|193899406|gb|EDV98272.1| GH23019 [Drosophila grimshawi]
          Length = 153

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 64/101 (63%), Gaps = 2/101 (1%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
           + K F++ V  C  PVVVDF ASWC PC  L+P +  I  E    + + ++DI+E +E++
Sbjct: 42  NIKDFENNVKRCEKPVVVDFHASWCTPCKALAPRVASIVSEQRGGIHLARVDIDELTELA 101

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             YQ+ S+P+L++  +GKV++RM+ G  +   I EW L RV
Sbjct: 102 LDYQVGSVPSLLVMHNGKVLNRMV-GLQTSEYIREW-LGRV 140


>gi|89075143|ref|ZP_01161579.1| thioredoxin 2 [Photobacterium sp. SKA34]
 gi|89049097|gb|EAR54663.1| thioredoxin 2 [Photobacterium sp. SKA34]
          Length = 144

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +L+   PVVVDFWA WC PCV  +P+  D++ E   +++  K+D E    ++ +Y+I 
Sbjct: 49  STLLKSDKPVVVDFWAPWCNPCVGFAPVFTDVSKERDGQIRCVKIDTEAQQALAAQYRIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+GK++D M+ GA  +S   +W+
Sbjct: 109 SIPTIMVFKEGKMVD-MLNGAMPKSHFDQWL 138


>gi|325578848|ref|ZP_08148895.1| thioredoxin [Haemophilus parainfluenzae ATCC 33392]
 gi|325159672|gb|EGC71804.1| thioredoxin [Haemophilus parainfluenzae ATCC 33392]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L ++   F++ V++   PV+VDFWA WC PC  ++PI+D+IA E A K KI K++++++ 
Sbjct: 5   LHINDADFETTVVQSDIPVLVDFWAPWCGPCKMIAPILDEIAPEFAGKAKIVKINVDDNQ 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            ++ ++ + SIPTL+LFK+G+++   + GA  ++ +  +I
Sbjct: 65  LVAGQFGVRSIPTLLLFKNGQLVATQV-GALPKNQLAAFI 103


>gi|297852128|ref|XP_002893945.1| hypothetical protein ARALYDRAFT_891327 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297339787|gb|EFH70204.1| hypothetical protein ARALYDRAFT_891327 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 174

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 65/101 (64%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A K    SFD  +     P++VDF+A+WC PC  + PI++++++ L DK+ + K+D E+ 
Sbjct: 67  AKKQTFNSFDDLLQNSDKPLLVDFYATWCGPCQLMVPILNEVSETLKDKIAVVKIDTEKY 126

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             ++ +YQI ++PT ILFKDGK+ DR   GA   + ++E I
Sbjct: 127 PSLANKYQIEALPTFILFKDGKLWDRFE-GALPANQLVERI 166


>gi|163732947|ref|ZP_02140391.1| thioredoxin [Roseobacter litoralis Och 149]
 gi|161393482|gb|EDQ17807.1| thioredoxin [Roseobacter litoralis Och 149]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L V   +FD+EV     PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATLAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPSLEELSAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +  +  IP L +FKDG+V+  M  GA+ ++ +  WI
Sbjct: 61  ENPNSPAQMGVRGIPALFIFKDGQVVSNMA-GANPKAALQGWI 102


>gi|78187123|ref|YP_375166.1| thioredoxin [Chlorobium luteolum DSM 273]
 gi|78167025|gb|ABB24123.1| thioredoxin [Chlorobium luteolum DSM 273]
          Length = 109

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 60/82 (73%)

Query: 9  KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
          ++F +EVLE     +VDFWA+WC PC+ L P+I+++A +   K  I K++++++   + +
Sbjct: 11 QNFKAEVLESGKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAVIAKVNVDDNPNTAAQ 70

Query: 69 YQISSIPTLILFKDGKVIDRMM 90
          Y I SIPT+++FK+G+V+D+M+
Sbjct: 71 YGIRSIPTMLVFKNGQVVDQMV 92


>gi|291536387|emb|CBL09499.1| thioredoxin [Roseburia intestinalis M50/1]
 gi|291538743|emb|CBL11854.1| thioredoxin [Roseburia intestinalis XB6B4]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +   +F++EVL    PVV+DFWA WC PC   SP+I+ +A+EL  KV   K++++
Sbjct: 1   MAVITITKDNFENEVLGAKLPVVLDFWAEWCAPCKMQSPVIEALAEELEGKVIFGKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E + ++ +YQI SIPTL++ K G   +R + G  ++ +II+ I
Sbjct: 61  EEAALALKYQIMSIPTLVVMKYGLFQNRAV-GLQTREEIIDMI 102


>gi|256819146|ref|YP_003140425.1| thioredoxin [Capnocytophaga ochracea DSM 7271]
 gi|315224572|ref|ZP_07866398.1| thioredoxin [Capnocytophaga ochracea F0287]
 gi|256580729|gb|ACU91864.1| thioredoxin [Capnocytophaga ochracea DSM 7271]
 gi|314945438|gb|EFS97461.1| thioredoxin [Capnocytophaga ochracea F0287]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 72/105 (68%), Gaps = 2/105 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F+  VL+ + PV+VDFWA WC PC  L+P++++I+ E   +V + K+D++ +
Sbjct: 2   ALEITDGNFEDLVLKSTQPVLVDFWAVWCGPCRMLAPVVEEISKEYEGRVVVGKVDVDNN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGA--SSQSDIIEWILS 105
            E + +Y I +IPT+++F++G+V+ R +  A   + +D ++ +LS
Sbjct: 62  QEFAAKYGIRNIPTVLVFQNGEVVGRQVGVAPKKTYTDALDGLLS 106


>gi|270308018|ref|YP_003330076.1| thioredoxin [Dehalococcoides sp. VS]
 gi|270153910|gb|ACZ61748.1| thioredoxin [Dehalococcoides sp. VS]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++  +SF +EVL+   PV+VDFWA WC PC  ++PIID ++ +   K K  KL+++E+ 
Sbjct: 3   MEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYEGKFKFCKLNVDENK 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             + +Y++ SIPTL+ FK G+V D M+ GA  +S + + I
Sbjct: 63  TTAAQYRVMSIPTLLFFKGGQVAD-MVVGAVPESALSQKI 101


>gi|90578149|ref|ZP_01233960.1| thioredoxin 2 [Vibrio angustum S14]
 gi|90441235|gb|EAS66415.1| thioredoxin 2 [Vibrio angustum S14]
          Length = 144

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +L+   PVVVDFWA WC PCV  +P+  D++ E   +++  K+D E    ++ +Y+I 
Sbjct: 49  STLLKSDKPVVVDFWAPWCNPCVGFAPVFADVSQERDGQIRCVKIDTEAQQALAAQYRIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+GK++D M+ GA  +S   +W+
Sbjct: 109 SIPTIMVFKEGKMVD-MLNGAMPKSHFDQWL 138


>gi|77166041|ref|YP_344566.1| thioredoxin [Nitrosococcus oceani ATCC 19707]
 gi|254436369|ref|ZP_05049875.1| thioredoxin [Nitrosococcus oceani AFC27]
 gi|76884355|gb|ABA59036.1| thioredoxin [Nitrosococcus oceani ATCC 19707]
 gi|207088059|gb|EDZ65332.1| thioredoxin [Nitrosococcus oceani AFC27]
          Length = 110

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EVL+   P +VD+WA WC PC  ++PI+++IA++   K+KI KL+I+E+     RY
Sbjct: 14  TFEEEVLKSEQPALVDYWAEWCGPCKTVAPILEEIANDYQGKLKICKLNIDENPSTPPRY 73

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G V +    GA S+S +  +I S +
Sbjct: 74  GIRGIPTLMLFKNGNV-EATKVGALSKSQLSAFIDSNL 110


>gi|331083919|ref|ZP_08333028.1| thioredoxin [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330403344|gb|EGG82904.1| thioredoxin [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 102

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 62/86 (72%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A++  +++F  EVL+   PV+VDFWASWC PC  L+P+I+++A+E     K+ K+D++  
Sbjct: 2  AMEFTSENFAKEVLQSDVPVLVDFWASWCMPCKMLAPVIEELAEEANGSYKVGKIDVDAE 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDR 88
            ++ +Y I +IPT+++FK+G+V D+
Sbjct: 62 PSLAAQYGIMNIPTVLVFKNGQVADK 87


>gi|309811354|ref|ZP_07705141.1| thioredoxin [Dermacoccus sp. Ellin185]
 gi|308434661|gb|EFP58506.1| thioredoxin [Dermacoccus sp. Ellin185]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 70/101 (69%), Gaps = 2/101 (1%)

Query: 1   MSALKVDT-KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M A K  T  +FD++VL+ S PV+VDFWA WC PC  ++PI+++IA   ADK+ + KL+ 
Sbjct: 1   MGATKPTTDATFDADVLKNSKPVLVDFWAEWCGPCRAVAPILEEIAAANADKIDVYKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +E+  IS +Y I+ IPT+ ++++G+V+  ++ GA  +  ++
Sbjct: 61  DENPAISAKYGITGIPTMNVYQNGEVVKTIV-GAMPKPKLL 100


>gi|240168394|ref|ZP_04747053.1| thioredoxin TrxC [Mycobacterium kansasii ATCC 12478]
          Length = 117

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF + VL  + PV+VDFWA+WC PC  ++P++++IA E +  + + KLD++ 
Sbjct: 9   ATIEVSDASFSTTVLSSNKPVLVDFWATWCGPCKMVAPVLEEIAAERSGSLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + + +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++  I
Sbjct: 69  NPQTARDFQVISIPTMILFKDGQPVKRIV-GAKGKAALLREI 109


>gi|34763779|ref|ZP_00144695.1| Thioredoxin [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|237741082|ref|ZP_04571563.1| thioredoxin [Fusobacterium sp. 4_1_13]
 gi|256846604|ref|ZP_05552060.1| thioredoxin [Fusobacterium sp. 3_1_36A2]
 gi|294784313|ref|ZP_06749604.1| thioredoxin [Fusobacterium sp. 3_1_27]
 gi|27886455|gb|EAA23714.1| Thioredoxin [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|229431126|gb|EEO41338.1| thioredoxin [Fusobacterium sp. 4_1_13]
 gi|256717824|gb|EEU31381.1| thioredoxin [Fusobacterium sp. 3_1_36A2]
 gi|294487885|gb|EFG35240.1| thioredoxin [Fusobacterium sp. 3_1_27]
          Length = 103

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 65/88 (73%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K   ++F++EVL  +  VVVDF A+WC PC  L PI+D++ +E   K KI K+DI+
Sbjct: 1  MAIIKGTKENFEAEVLNANGVVVVDFGANWCGPCKSLVPILDEVVEEDPSK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ +Y+I S+PTL++F++G++ID+
Sbjct: 60 EQEELAAKYKIMSVPTLLVFRNGEIIDK 87


>gi|284006574|emb|CBA71835.1| thioredoxin [Arsenophonus nasoniae]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 65/93 (69%), Gaps = 1/93 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F+  V     P++VDFWA WC PC  ++PI+D+IADE   K+ I KL+++ES +I+T Y 
Sbjct: 13  FEETVKSAKKPILVDFWAEWCGPCKMIAPILDEIADEYTAKLIIAKLNVDESIDIATIYG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I SIPTL+LFK+G+ + + + G  S++ + E++
Sbjct: 73  IRSIPTLMLFKNGEKVGQQV-GLLSKTQLKEFL 104


>gi|86141807|ref|ZP_01060331.1| thioredoxin (thioredoxin M) [Leeuwenhoekiella blandensis MED217]
 gi|85831370|gb|EAQ49826.1| thioredoxin (thioredoxin M) [Leeuwenhoekiella blandensis MED217]
          Length = 105

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 60/88 (68%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F+  VL+   PV+VDFWA+WC PC  + P+I++I+ E   K  + KLD++ +
Sbjct: 2  ALEITDANFEETVLQSDKPVLVDFWAAWCGPCRMVGPVIEEISTEYDGKAVVGKLDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E + +Y + +IPT+++FK G+V+ R +
Sbjct: 62 QEFAAKYGVRNIPTVLMFKGGEVVGRQV 89


>gi|325285769|ref|YP_004261559.1| thioredoxin [Cellulophaga lytica DSM 7489]
 gi|324321223|gb|ADY28688.1| thioredoxin [Cellulophaga lytica DSM 7489]
          Length = 105

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +FD  VL+   PVVVDFWA+WC PC  + PIID+++ E   K  + K+D++ +
Sbjct: 2   ALEITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPIIDEVSSEYEGKAVVGKVDVDAN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ--SDIIEWIL 104
            E + +Y + +IPT+++FK G+++ R +  +  Q  +D I+ +L
Sbjct: 62  QEFAAKYGVRNIPTVLVFKGGEMVSRQVGVSPKQVYTDAIDALL 105


>gi|213425880|ref|ZP_03358630.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi
          str. E02-1180]
          Length = 89

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 56/76 (73%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 12 SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70 QISSIPTLILFKDGKV 85
           I  IPTL+LFK+G+V
Sbjct: 72 GIRGIPTLLLFKNGEV 87


>gi|118473002|ref|YP_891128.1| thioredoxin [Mycobacterium smegmatis str. MC2 155]
 gi|118174289|gb|ABK75185.1| thioredoxin [Mycobacterium smegmatis str. MC2 155]
          Length = 110

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 65/92 (70%), Gaps = 1/92 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF ++VL  S PV+VDFWA+WC PC  ++P++++IA E  D++ + K+D++ +   +  +
Sbjct: 14  SFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDANPATARDF 73

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           Q+ SIPT+ILFKDG  + R++ GA  ++ ++ 
Sbjct: 74  QVVSIPTMILFKDGAPVKRIV-GAKGKAALLR 104


>gi|91788134|ref|YP_549086.1| thioredoxin [Polaromonas sp. JS666]
 gi|91697359|gb|ABE44188.1| thioredoxin [Polaromonas sp. JS666]
          Length = 110

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+++VL+ S PV+VD+WA WC PC  ++PI+D++A     K++I K++++E+ +I  ++
Sbjct: 13  TFEADVLKSSTPVLVDYWAEWCGPCKMIAPILDEVATGYDGKLQIAKMNVDENRDIPAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG++    + GA S++ +  +I
Sbjct: 73  GIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFI 105


>gi|329961869|ref|ZP_08299883.1| thioredoxin [Bacteroides fluxus YIT 12057]
 gi|328531309|gb|EGF58153.1| thioredoxin [Bacteroides fluxus YIT 12057]
          Length = 104

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 64/99 (64%), Gaps = 2/99 (2%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T S   E+L    PVV+DFWA WC PC  + PIID++A E   KV I K D++E+ +++ 
Sbjct: 6   TDSNYQELLAEGKPVVMDFWAPWCGPCKMVGPIIDELATEYEGKVIIGKCDVDENGDVAG 65

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGA--SSQSDIIEWIL 104
            Y I +IPT++ FKDGK++D+ +  A  S+ +  IE +L
Sbjct: 66  EYGIRNIPTVLFFKDGKLVDKQVGSAPKSTYAAKIEALL 104


>gi|209525941|ref|ZP_03274475.1| thioredoxin [Arthrospira maxima CS-328]
 gi|209493618|gb|EDZ93939.1| thioredoxin [Arthrospira maxima CS-328]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 71/104 (68%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           A+K   ++F  E+LE S  PV+VDF+A+WC PC  ++PI+ ++  E+ ++++I K+D ++
Sbjct: 5   AVKKQFQNF-QELLESSEVPVLVDFYATWCGPCQMMAPILQEVNQEMKEQIQIVKIDTDK 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
             +I++ YQI ++PTLI FK+G+ +DR   G     ++I+W+  
Sbjct: 64  YPKIASDYQIEALPTLIFFKNGQPVDR-FEGVKRAPELIQWLYG 106


>gi|156743275|ref|YP_001433404.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
 gi|156234603|gb|ABU59386.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
          Length = 259

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 56/81 (69%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD  V     PV+VDFWA WC PC  ++P+++ +A E A +  + KL+++E+   + R+
Sbjct: 158 TFDQVVGASHQPVLVDFWAPWCGPCRAVAPVVERLAQEFAGRAVVAKLNVDENPRTAQRF 217

Query: 70  QISSIPTLILFKDGKVIDRMM 90
            I SIP+L +FKDG+V++R++
Sbjct: 218 GIRSIPSLHIFKDGRVVERLI 238



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 53/102 (51%), Gaps = 2/102 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++   +S D  VL    PV++ F    C  C +L P ++ +A   A +  + ++D ++
Sbjct: 5   TPVRTSEQSID-RVLRAGLPVLLIFDRKECPTCQRLDPTLERLASIFAGRALLARVDADD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  ++ +Y I+++P LI  K+G  I R   G  ++  +  W+
Sbjct: 64  NPALAQQYGITALPGLIFVKNGAPIARTS-GVVAEEALRAWL 104


>gi|57234511|ref|YP_181437.1| thioredoxin [Dehalococcoides ethenogenes 195]
 gi|57234585|ref|YP_181403.1| thioredoxin [Dehalococcoides ethenogenes 195]
 gi|57224959|gb|AAW40016.1| thioredoxin [Dehalococcoides ethenogenes 195]
 gi|57225033|gb|AAW40090.1| thioredoxin [Dehalococcoides ethenogenes 195]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++  +SF +EVL+   PV+VDFWA WC PC  ++PIID ++ +   K K  KL+++E+ 
Sbjct: 3   MEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYEGKFKFCKLNVDENK 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             + +Y++ SIPTL+ FK G+V D M+ GA  +S + + I
Sbjct: 63  TTAAQYRVMSIPTLLFFKSGQVAD-MVVGAVPESALSQKI 101


>gi|262276727|ref|ZP_06054520.1| thioredoxin [alpha proteobacterium HIMB114]
 gi|262223830|gb|EEY74289.1| thioredoxin [alpha proteobacterium HIMB114]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M ALKV  ++F+  +     PV+V F A WC PC  ++  ++++ADE++D++ I   DI+
Sbjct: 1   MPALKVTDENFEETIGNKDKPVLVKFGAEWCGPCKMIAGPLNELADEMSDQIVIGDHDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            S    T++ +  +PT++LFK G+V+D  + GA+S+ DI  WI S+V
Sbjct: 61  NSPNAPTKFGVRGVPTMLLFKGGEVVDSKV-GAASKEDIKTWINSKV 106


>gi|237732568|ref|ZP_04563049.1| thioredoxin 2 [Citrobacter sp. 30_2]
 gi|226908107|gb|EEH94025.1| thioredoxin 2 [Citrobacter sp. 30_2]
          Length = 139

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVVVDFWA WC PC   +PI +D+A+E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVVDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIPT+++FK G+++D M+ GA  ++    W+
Sbjct: 93  EAERELSARFGIRSIPTIMIFKKGEIVD-MLNGAVPKAPFDSWL 135


>gi|305667462|ref|YP_003863749.1| thioredoxin C-2 [Maribacter sp. HTCC2170]
 gi|88709510|gb|EAR01743.1| thioredoxin C-2 [Maribacter sp. HTCC2170]
          Length = 99

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 62/86 (72%), Gaps = 1/86 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PV+VDF+A WC PC  L+PI+ D+ +EL D VKI K+D++++  I+++Y +  +PT++LF
Sbjct: 14  PVLVDFFAEWCGPCKMLAPILKDVKEELGDTVKIVKIDVDKNQSIASKYNVRGVPTMLLF 73

Query: 81  KDGKVIDRMMPGASSQSDIIEWILSR 106
           K+GK + R   G   ++DIIE I S+
Sbjct: 74  KNGKQVWR-QSGVLQKNDIIEIIQSQ 98


>gi|119385517|ref|YP_916573.1| thioredoxin [Paracoccus denitrificans PD1222]
 gi|119375284|gb|ABL70877.1| thioredoxin [Paracoccus denitrificans PD1222]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 61/98 (62%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V    FDSEV +   PVVVDFWA WC PC ++ P ++++A E   +VKI K++++E+ E 
Sbjct: 7   VSDAEFDSEVRQSPTPVVVDFWAEWCGPCRQIGPSLEELAAEYEGRVKIVKVNVDENPES 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
                +  IP L LFKDG+V+   + GA+ ++ +  WI
Sbjct: 67  PAALGVRGIPALFLFKDGQVVSNKI-GAAPKAALKAWI 103


>gi|330837016|ref|YP_004411657.1| thioredoxin [Spirochaeta coccoides DSM 17374]
 gi|329748919|gb|AEC02275.1| thioredoxin [Spirochaeta coccoides DSM 17374]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M   +V  + F++EVL+   PV+V FWA WC PC  ++P I  I ++    +K+ K+D++
Sbjct: 1   MGNKEVTHEDFEAEVLKAEVPVLVYFWADWCGPCKIIAPAIAQITEKHETTLKVVKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            S+ +++RY ++SIPTL+LFK+G+ +++ + GA+S S I  +++S +
Sbjct: 61  ASTGLASRYNVASIPTLVLFKNGEAVEQRI-GAASFSVIESFVMSYL 106


>gi|146312708|ref|YP_001177782.1| thioredoxin 2 [Enterobacter sp. 638]
 gi|145319584|gb|ABP61731.1| thioredoxin [Enterobacter sp. 638]
          Length = 139

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PC   +PI +D+A+E + K++  K++ E   E+S R++I SIPT+++F
Sbjct: 54  PVVVDFWAPWCGPCRNFAPIFEDVAEERSGKMRFVKVNTEAERELSARFRIRSIPTIMIF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+++D M+ GA  ++    W+
Sbjct: 114 KNGEMVD-MLNGAVPKAPFESWL 135


>gi|299137052|ref|ZP_07030235.1| thioredoxin [Acidobacterium sp. MP5ACTX8]
 gi|298601567|gb|EFI57722.1| thioredoxin [Acidobacterium sp. MP5ACTX8]
          Length = 118

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 65/103 (63%), Gaps = 2/103 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V+   F+  VL+   PV+VDFWA+WC PC  L+P++D +A+E   ++K+ K+D++ ++ 
Sbjct: 8   EVNDADFEKVVLQSETPVLVDFWAAWCGPCRALAPVVDAVAEEYKGQLKVMKMDVDRNNM 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              RY I  IP L++FK GKV ++++       D I+  L RV
Sbjct: 68  TPGRYGIRGIPALLIFKGGKVAEQIV--GFVPKDTIDQSLKRV 108


>gi|152968443|ref|YP_001364227.1| thioredoxin [Kineococcus radiotolerans SRS30216]
 gi|151362960|gb|ABS05963.1| thioredoxin [Kineococcus radiotolerans SRS30216]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 62/89 (69%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S   V   +FD+EVL+   PV+VDFWA WC PC +++PI+++IA E  DK+ + K++ +E
Sbjct: 3  STAPVTDDTFDAEVLQSDKPVLVDFWAPWCGPCRQVAPILEEIAAEHGDKITVVKVNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  I+ +Y ++SIPTL ++  G+V+  ++
Sbjct: 63 NPRIAAKYGVTSIPTLNVYSGGEVVKTVI 91


>gi|158428383|pdb|2EIR|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And
          Multimers Through Analysis Of Crystal Contacts
 gi|158428384|pdb|2EIR|B Chain B, Design Of Disulfide-Linked Thioredoxin Dimers And
          Multimers Through Analysis Of Crystal Contacts
 gi|158428385|pdb|2EIR|C Chain C, Design Of Disulfide-Linked Thioredoxin Dimers And
          Multimers Through Analysis Of Crystal Contacts
 gi|158428386|pdb|2EIR|D Chain D, Design Of Disulfide-Linked Thioredoxin Dimers And
          Multimers Through Analysis Of Crystal Contacts
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 56/76 (73%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11 SFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70 QISSIPTLILFKDGKV 85
           I  IPTL+LFK+G+V
Sbjct: 71 GIRGIPTLLLFKNGEV 86


>gi|255513317|gb|EET89583.1| thioredoxin [Candidatus Micrarchaeum acidiphilum ARMAN-2]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V+++ F+ EVL+   PVVVD WA WC PC   SPI+D++++E   KVK  KL+ +
Sbjct: 1   MAVADVNSRDFEDEVLKSKIPVVVDIWAEWCGPCRMFSPIVDEVSEEYKGKVKFVKLNAD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ EI+ +Y I SIPT +L + G V   +  GA  +    +WI S +
Sbjct: 61  ENEEIAAKYNIMSIPTALLIEKGNV-KAVNVGAIPKEPFKKWIDSNL 106


>gi|253579352|ref|ZP_04856622.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849450|gb|EES77410.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 101

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F +E+++    V++DFWA WC PC  + PII++IA E  D +K+ K++++
Sbjct: 1   MSAININKNNFQNEIMDSEKTVLLDFWAPWCAPCRMVVPIIEEIASERPD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E+++++ I SIPTL++ K+GK++ + + GA  +  I+E +
Sbjct: 60  EQPELASKFGIMSIPTLVVMKNGKIVTK-VSGARPKKAILEML 101


>gi|162146540|ref|YP_001600999.1| thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543462|ref|YP_002275691.1| thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785115|emb|CAP54659.1| putative thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531139|gb|ACI51076.1| thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 66/106 (62%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   +F+S+VL+   PV+VDFWA WC PC  ++P +D+I  E   K+ + K++I++
Sbjct: 4   NTVAVSDATFESDVLKAEGPVLVDFWAEWCGPCKMIAPALDEIGAEFKGKLTVAKVNIDD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     +Y +  IPTLILFK+G+     + GA  +S + EW+ S +
Sbjct: 64  NPGTPNKYAVRGIPTLILFKNGQPAATKV-GALPKSQLKEWVKSSL 108


>gi|298242647|ref|ZP_06966454.1| thioredoxin [Ktedonobacter racemifer DSM 44963]
 gi|297555701|gb|EFH89565.1| thioredoxin [Ktedonobacter racemifer DSM 44963]
          Length = 118

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 61/91 (67%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V  + F+ +VL+ S PV+VDFWA+WC PC  ++P  + ++DE   K+   K+D++E+ 
Sbjct: 8  IYVGDQDFEEKVLKSSTPVIVDFWAAWCGPCRMIAPHYERLSDEYQGKLVFAKMDVDENG 67

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMMPGAS 94
           +  ++ + +IPTL++FK G++I RM+  A 
Sbjct: 68 NVPRQFGVQAIPTLLVFKGGEIIGRMVGAAQ 98


>gi|262369828|ref|ZP_06063155.1| thioredoxin C-2 [Acinetobacter johnsonii SH046]
 gi|262314867|gb|EEY95907.1| thioredoxin C-2 [Acinetobacter johnsonii SH046]
          Length = 114

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 1   MSALKVDTK--SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V+T   +FD++VL+   PV+VDFWA WC PC  ++P+++ +A+E   KVKI K+D
Sbjct: 7   MSGNIVNTTDTNFDADVLQSDVPVLVDFWAGWCAPCKAIAPVLEVLANEYEGKVKIVKVD 66

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +      +  Y I +IP L++FK+G+V+ + + GA+ +S +  +I
Sbjct: 67  VTSCEATAVNYNIRNIPALLMFKNGEVVAQQV-GAAPKSKLTAFI 110


>gi|224368346|ref|YP_002602509.1| TrxA2 [Desulfobacterium autotrophicum HRM2]
 gi|223691062|gb|ACN14345.1| TrxA2 [Desulfobacterium autotrophicum HRM2]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L++D   F+ +VL    PVVVDFWA WC PC  + PI++++     + VK  K++++E+ 
Sbjct: 5  LEIDDDGFEKDVLNSDKPVVVDFWAPWCGPCRAIGPIVEELEATYGNTVKFVKVNVDENP 64

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
             ++Y I +IPTLI FKDGK+ D++  G  S+S +
Sbjct: 65 VTPSKYGIKAIPTLIFFKDGKIADQIT-GMVSKSKL 99


>gi|126724544|ref|ZP_01740387.1| thioredoxin [Rhodobacterales bacterium HTCC2150]
 gi|126705708|gb|EBA04798.1| thioredoxin [Rhodobacterales bacterium HTCC2150]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +F++EV   S PV+VDFWA WC PC ++ P +++++ E  + +KI K+D++
Sbjct: 1   MATIAVTDATFEAEVKNSSTPVLVDFWAEWCGPCKQIGPALEELSAEYGETIKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    I  IP L +FKDG+V+  M  GA+ ++ + +WI
Sbjct: 61  SNPNSAAAMGIRGIPALFIFKDGEVVSNMA-GAAPKASLKKWI 102


>gi|295394856|ref|ZP_06805069.1| thioredoxin [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972189|gb|EFG48051.1| thioredoxin [Brevibacterium mcbrellneri ATCC 49030]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A +V   +F  EVL    PV+VDFWA WC PC  + PI+D+IA E ADK+K+ KL+ +++
Sbjct: 2   AQEVTDATFKEEVLSSDLPVLVDFWAPWCGPCRMVGPIVDEIAQEQADKLKVVKLNTDDN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDIIEWI 103
            E ++ Y I+SIP L +FK G+V   ++   P  + + ++ E+I
Sbjct: 62  LETASAYGITSIPALYVFKGGEVAKTIIGARPKPALEQELAEFI 105


>gi|117926932|ref|YP_867549.1| thioredoxin [Magnetococcus sp. MC-1]
 gi|117610688|gb|ABK46143.1| thioredoxin [Magnetococcus sp. MC-1]
          Length = 110

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
            F+++VL+   PV+VDFWA WC PC +++P +D +A +    +K+ KL+I+E+  +  R+
Sbjct: 12  QFETDVLQAETPVLVDFWAEWCGPCKQVAPFLDQLAQDKVGSLKVVKLNIDENPNVPGRF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL++FK G++    + GA  +S + EW+
Sbjct: 72  GVRGIPTLMIFKGGQIQASKI-GAMPKSKLYEWV 104


>gi|190571104|ref|YP_001975462.1| thioredoxin [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|213019627|ref|ZP_03335433.1| thioredoxin [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|190357376|emb|CAQ54810.1| thioredoxin [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|212995049|gb|EEB55691.1| thioredoxin [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 108

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (64%), Gaps = 3/102 (2%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+ ++F+SEV      V+VDFWA WC PC  L P I+ +A++   K+KI K DI+  +E+
Sbjct: 8   VNDQNFESEVANHKGFVLVDFWAEWCGPCKSLMPRIEQLAEDRKGKIKICKFDIDGETEV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++Y + SIPTLI+F+DGK I R +    + +D+  W+ S +
Sbjct: 68  PSKYGVQSIPTLIIFQDGKEIARKI---GAINDLHSWVDSEI 106


>gi|145579981|pdb|2O8V|B Chain B, Paps Reductase In A Covalent Complex With Thioredoxin C35a
          Length = 128

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC P   ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 31  SFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 90

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 91  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 123


>gi|121607640|ref|YP_995447.1| thioredoxin [Verminephrobacter eiseniae EF01-2]
 gi|121552280|gb|ABM56429.1| thioredoxin [Verminephrobacter eiseniae EF01-2]
          Length = 111

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+++VL+   PV+VD+WA WC PC  ++P++DD AD    +++I K+D++++ +
Sbjct: 8   HVSDASFEADVLQADTPVLVDYWAPWCGPCKMIAPLLDDAADRYQGRLQIVKMDVDDNRQ 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ I  +PTL+LFKDG+     + GA  ++ + E++
Sbjct: 68  TPAKFGIRGVPTLMLFKDGQPAATQV-GALGRAQLTEFL 105


>gi|254294695|ref|YP_003060718.1| thioredoxin [Hirschia baltica ATCC 49814]
 gi|254043226|gb|ACT60021.1| thioredoxin [Hirschia baltica ATCC 49814]
          Length = 106

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +      FD +V++    ++VDFWA WC PC ++SP ++ +A E   ++KI K++++
Sbjct: 1   MTVIDTTDDKFDEDVIQSEGTIIVDFWAEWCGPCKQVSPHLEALAKEKEGEIKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+   S R+ +  +PTL++FKDGKV    + GA S+S I EW+
Sbjct: 61  ENPMTSGRFGVRGMPTLMIFKDGKVAATHL-GAMSKSRIEEWV 102


>gi|238921823|ref|YP_002935337.1| thioredoxin 1 [Eubacterium eligens ATCC 27750]
 gi|238873495|gb|ACR73203.1| thioredoxin 1 [Eubacterium eligens ATCC 27750]
          Length = 103

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 68/103 (66%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    V    F++EVL+   PV+VDFWA WC PC  L P+++ +A ++ D V+I K++++
Sbjct: 1   MEIKHVKASEFNNEVLKADKPVLVDFWADWCGPCKMLGPVLEQVAAKV-DDVQIVKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E S ++ +Y I SIPTL+LFK G+ + + + G  S+  ++E+I
Sbjct: 60  EESSVAEKYNIMSIPTLLLFKSGECVAKSV-GFISEGQVMEFI 101


>gi|145600736|ref|YP_001164812.1| thioredoxin 1 [Yersinia pestis Pestoides F]
 gi|145212432|gb|ABP41839.1| thioredoxin 1 [Yersinia pestis Pestoides F]
          Length = 108

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 57/77 (74%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SFD++VL+    V+VDFWA WC PC  ++PI+D+IA+E   ++ I KL+I+++   + +Y
Sbjct: 12 SFDTDVLKARGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLNIDDNQGTAPKY 71

Query: 70 QISSIPTLILFKDGKVI 86
           I  IPTL+LF+DG+V+
Sbjct: 72 GIRGIPTLLLFRDGEVV 88


>gi|224825638|ref|ZP_03698742.1| thioredoxin [Lutiella nitroferrum 2002]
 gi|224601862|gb|EEG08041.1| thioredoxin [Lutiella nitroferrum 2002]
          Length = 108

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +VL+   PV+VD+WA WC PC  ++PI+D+++ E   ++K+ KL+I+++ +   ++
Sbjct: 12  SFEQDVLKAQGPVLVDYWAEWCGPCKMIAPILDEVSKEYDGRLKVVKLNIDQNEQTPPKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL++FKDG V+   + GA ++S +  +I S +
Sbjct: 72  GIRGIPTLMIFKDGNVVATKV-GALAKSQLTAFIDSHI 108


>gi|289668260|ref|ZP_06489335.1| thioredoxin [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 285

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 66/98 (67%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D+++  +I
Sbjct: 12  TDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|238027055|ref|YP_002911286.1| thioredoxin [Burkholderia glumae BGR1]
 gi|237876249|gb|ACR28582.1| Thioredoxin [Burkholderia glumae BGR1]
          Length = 108

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +V+    PV++DFWA WC PC  ++PI+D+I+ E  DK+ I K+++++++    RY
Sbjct: 12  SFEQDVVRSDKPVLLDFWAEWCGPCKMIAPILDEISKEYGDKLTIAKINVDDNTATPARY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTLILFK+G V+     GA S+S +  ++ S +
Sbjct: 72  GVRGIPTLILFKNG-VLAAQKVGALSKSQLTAFLDSHL 108


>gi|149376212|ref|ZP_01893976.1| thioredoxin [Marinobacter algicola DG893]
 gi|149359409|gb|EDM47869.1| thioredoxin [Marinobacter algicola DG893]
          Length = 108

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL+   PV+VD+WA WC PC  ++P+++++A+E   K+K+ KL+I+E+ 
Sbjct: 6   VNVTDASFEQDVLQSDVPVLVDYWAEWCGPCKMIAPVLEEMAEEYEGKLKVCKLNIDENE 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   ++ I  IPTL+LFK+G V D    GA S+S +  ++ S +
Sbjct: 66  QTPPKFNIRGIPTLMLFKNGNV-DATKVGALSKSQLAAFLDSNL 108


>gi|108802362|ref|YP_642559.1| thioredoxin [Mycobacterium sp. MCS]
 gi|119871515|ref|YP_941467.1| thioredoxin [Mycobacterium sp. KMS]
 gi|126438342|ref|YP_001074033.1| thioredoxin [Mycobacterium sp. JLS]
 gi|108772781|gb|ABG11503.1| thioredoxin [Mycobacterium sp. MCS]
 gi|119697604|gb|ABL94677.1| thioredoxin [Mycobacterium sp. KMS]
 gi|126238142|gb|ABO01543.1| thioredoxin [Mycobacterium sp. JLS]
          Length = 109

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 64/92 (69%), Gaps = 1/92 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  +VL  S PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ +   +  +
Sbjct: 13  SFSEDVLTSSTPVLVDFWATWCGPCKMVAPVLEEIASEKAGALTVAKLDVDANPTTARDF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           Q+ SIPT+ILFKDG+ + R++ GA  ++ ++ 
Sbjct: 73  QVVSIPTMILFKDGEPVKRIV-GAKGKAALLR 103


>gi|294054471|ref|YP_003548129.1| thioredoxin [Coraliomargarita akajimensis DSM 45221]
 gi|293613804|gb|ADE53959.1| thioredoxin [Coraliomargarita akajimensis DSM 45221]
          Length = 105

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 63/79 (79%), Gaps = 1/79 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PC  ++PI++++ADEL D VKI K++++ +S+I+ ++ I +IPT+++F
Sbjct: 23  PVVVDFWAPWCGPCKAIAPILEELADELGDAVKICKVNVDNNSDIAGKFAIRAIPTILVF 82

Query: 81  KDGKVIDRMMPGASSQSDI 99
           KDG+V + ++ G +S+ D+
Sbjct: 83  KDGEVAETIV-GLTSKDDL 100


>gi|303326795|ref|ZP_07357237.1| thioredoxin [Desulfovibrio sp. 3_1_syn3]
 gi|302862783|gb|EFL85715.1| thioredoxin [Desulfovibrio sp. 3_1_syn3]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A +V   +F+S VL+   PV++DFWA WC PC  + PIID++A E   KV++ K++++E+
Sbjct: 2   AEQVTDATFESLVLKSDLPVLLDFWAPWCGPCRAVGPIIDELAKEYEGKVRVVKMNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               T++ I +IPTL++FK+G+ ++++  GA ++  + E + S+V
Sbjct: 62  PATPTKFGIRAIPTLVVFKNGETVEQIT-GAVTKVAMKELLDSKV 105


>gi|71901631|ref|ZP_00683710.1| Thioredoxin [Xylella fastidiosa Ann-1]
 gi|71728607|gb|EAO30759.1| Thioredoxin [Xylella fastidiosa Ann-1]
          Length = 113

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L V   +FD+ VL    PV+VDFWA WC PC  +S ++DD+A     ++KI K+DI+E+ 
Sbjct: 6  LHVSDANFDAMVLLSDQPVLVDFWAKWCGPCKIISTLLDDLAQSYEGRLKIAKVDIDENR 65

Query: 64 EISTRYQISSIPTLILFKDGKV 85
           ++ +Y + SIP L+LFKDG+V
Sbjct: 66 ALAIKYHVCSIPMLLLFKDGQV 87


>gi|225019125|ref|ZP_03708317.1| hypothetical protein CLOSTMETH_03077 [Clostridium methylpentosum
           DSM 5476]
 gi|224948098|gb|EEG29307.1| hypothetical protein CLOSTMETH_03077 [Clostridium methylpentosum
           DSM 5476]
          Length = 108

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 68/106 (64%), Gaps = 4/106 (3%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSAL ++   FD  VL    PV+VDFWA+WC PC  + P++D++AD+L  K  + K+DI+
Sbjct: 1   MSALHINADKFDEVVLNSDKPVLVDFWATWCSPCRMMGPVVDELADDLDGKALVVKMDID 60

Query: 61  ES---SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     ++    + +IP L+ FK+G  ++R++ G  S+ ++++ +
Sbjct: 61  ETDANKNLAIENGVQTIPCLVCFKNGHEVNRLI-GVQSKQNLLKMM 105


>gi|307823863|ref|ZP_07654091.1| thioredoxin [Methylobacter tundripaludum SV96]
 gi|307735157|gb|EFO06006.1| thioredoxin [Methylobacter tundripaludum SV96]
          Length = 143

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++  ++F   +     PVVVDFWASWC PC  ++P     A  L  KV++ KL+ E+  
Sbjct: 41  LELTGRNFQQHIARNDIPVVVDFWASWCGPCKMMAPAYAQAAAALEPKVRLAKLNTEQEQ 100

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+ ++ I SIPTL++FK G+ I R M GA S +DI+ W+ S V
Sbjct: 101 DIAGQFNIRSIPTLVIFKSGREIAR-MSGAMSAADIVRWVNSNV 143


>gi|262403796|ref|ZP_06080354.1| thioredoxin 2 [Vibrio sp. RC586]
 gi|262350300|gb|EEY99435.1| thioredoxin 2 [Vibrio sp. RC586]
          Length = 144

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 61/96 (63%), Gaps = 1/96 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T++  S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E    ++ 
Sbjct: 44  TEANFSALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEAQQNLAA 103

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +QI SIPT+++FK+G+ ID M+ GA  +    +W+
Sbjct: 104 HFQIRSIPTIMVFKNGQRID-MINGALPKFQFDQWL 138


>gi|111226206|ref|YP_717000.1| thioredoxin 1, redox factor [Frankia alni ACN14a]
 gi|111153738|emb|CAJ65496.1| thioredoxin 1, redox factor [Frankia alni ACN14a]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 64/91 (70%), Gaps = 1/91 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F +EVL+   PV+VDFWA WC PC  + P++++IA E  +K++I KL+I+E+ E +  Y
Sbjct: 11  TFTAEVLQSDVPVLVDFWAEWCGPCKMVGPVLEEIAKEHGEKLRIVKLNIDENPETARNY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           QI SIPT+ +F  G+V D+ + GA  ++ ++
Sbjct: 71  QIMSIPTMAVFVKGEV-DKSIVGAKPKAALL 100


>gi|90410072|ref|ZP_01218089.1| putative thioredoxin 2 [Photobacterium profundum 3TCK]
 gi|90329425|gb|EAS45682.1| putative thioredoxin 2 [Photobacterium profundum 3TCK]
          Length = 146

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 60/89 (67%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           +++   PVVVDFWA WC PCV  +PI +D+A E +   +  K+D E   E++ +Y+I SI
Sbjct: 51  LIQSDTPVVVDFWAPWCNPCVGFAPIFEDVAAERSGNARFVKIDTETQQELAAQYRIRSI 110

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           PT+++FK+G++++ +  GA  +S   +W+
Sbjct: 111 PTIMVFKNGQLLNNLN-GALPKSQFDQWL 138


>gi|325300437|ref|YP_004260354.1| thioredoxin [Bacteroides salanitronis DSM 18170]
 gi|324319990|gb|ADY37881.1| thioredoxin [Bacteroides salanitronis DSM 18170]
          Length = 104

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 70/95 (73%), Gaps = 2/95 (2%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL +   +F++ V E   PVV+DFWA+WC PC +++P I+D+A+E  DKV I K D++E+
Sbjct: 2  ALTIKDDNFEAIVAE-GKPVVLDFWATWCGPCRQIAPYIEDLAEEYKDKVNIGKCDVDEN 60

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          +++  ++ + +IPT++  K+G+V+D+ + GA++++
Sbjct: 61 ADLPAQFGVRNIPTVLFIKNGEVVDKQV-GATTKA 94


>gi|289674520|ref|ZP_06495410.1| thioredoxin [Pseudomonas syringae pv. syringae FF5]
          Length = 109

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD+EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL+I+++ +   ++
Sbjct: 13  NFDAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDEIASTYKGKLTVAKLNIDQNPDTPAKH 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFKDG V +    GA S+S +  ++
Sbjct: 73  GVRGIPTLMLFKDGNV-EATKVGALSKSQLAAFL 105


>gi|271970310|ref|YP_003344506.1| thioredoxin [Streptosporangium roseum DSM 43021]
 gi|270513485|gb|ACZ91763.1| thioredoxin [Streptosporangium roseum DSM 43021]
          Length = 106

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 59/90 (65%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M  + +  ++F  +VL+   PV+VDFWA WC PC  ++PI++ I  E  D+V I KL+ +
Sbjct: 1  MIMITLTAENFAEQVLQSDKPVLVDFWAEWCPPCRMIAPILEQIEAEHGDRVTIAKLNYD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E  EI+ RY +  +PTL L+K G+V+ +++
Sbjct: 61 EHQEIAARYGVMGLPTLNLYKGGEVVQQIV 90


>gi|320102012|ref|YP_004177603.1| thioredoxin [Isosphaera pallida ATCC 43644]
 gi|319749294|gb|ADV61054.1| thioredoxin [Isosphaera pallida ATCC 43644]
          Length = 110

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 58/81 (71%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          ++ +EV+E   PV+VDFWA WC PC  L+P I+ +A E   +VK+ K++ +E+  I    
Sbjct: 12 NWTTEVMESPIPVLVDFWAPWCGPCRTLAPTIEKLAAEFEGRVKVGKMNTDENPNIPGGL 71

Query: 70 QISSIPTLILFKDGKVIDRMM 90
          +IS+IPT+ILF +GKV+DR++
Sbjct: 72 RISAIPTVILFHEGKVVDRLV 92


>gi|254452651|ref|ZP_05066088.1| thioredoxin [Octadecabacter antarcticus 238]
 gi|198267057|gb|EDY91327.1| thioredoxin [Octadecabacter antarcticus 238]
          Length = 106

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV + + PVVVDFWA WC PC ++ P +++++ E+  K+KI K++++
Sbjct: 1   MATVAVTDDTFDAEVRQSTIPVVVDFWAEWCGPCKQIGPALEELSAEMDGKIKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +  +  IP L LFKDG+V+     GA+ ++ +  WI
Sbjct: 61  ENPNAPAQMGVRGIPALFLFKDGEVVSNKT-GAAPKAALKSWI 102


>gi|157413531|ref|YP_001484397.1| thioredoxin [Prochlorococcus marinus str. MIT 9215]
 gi|254526803|ref|ZP_05138855.1| thioredoxin [Prochlorococcus marinus str. MIT 9202]
 gi|157388106|gb|ABV50811.1| Thioredoxin [Prochlorococcus marinus str. MIT 9215]
 gi|221538227|gb|EEE40680.1| thioredoxin [Prochlorococcus marinus str. MIT 9202]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SFD +VL+   PV+VDFWA WC PC  ++P++++I+ +   K+K+ KL+ +E
Sbjct: 3  SAPAVTDSSFDKDVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMIFKGGQKVDTVV 91


>gi|156932877|ref|YP_001436793.1| thioredoxin 2 [Cronobacter sakazakii ATCC BAA-894]
 gi|156531131|gb|ABU75957.1| hypothetical protein ESA_00678 [Cronobacter sakazakii ATCC BAA-894]
          Length = 143

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVV+DFWA WC PC   +PI +D+A+E + K++  K++ E   E+S R++I SIPT+++F
Sbjct: 54  PVVIDFWAPWCGPCRSFAPIFEDVAEERSGKIRFVKVNTEAEPELSARFRIRSIPTIMMF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+++D M+ GA  ++    W+
Sbjct: 114 KNGQLVD-MLNGAVPKAPFDTWL 135


>gi|289705885|ref|ZP_06502264.1| thioredoxin [Micrococcus luteus SK58]
 gi|289557370|gb|EFD50682.1| thioredoxin [Micrococcus luteus SK58]
          Length = 184

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 66/106 (62%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V    FD +VL+   PV+VDFWA WC PC  L P+++D+A E   K  I KL+++
Sbjct: 23  MSTITVTDADFDQKVLQSELPVLVDFWAEWCGPCRMLGPVLEDMAVEHEGKAVIAKLNVD 82

Query: 61  ESSEISTRYQISSIPTLILFKDG-KVIDRMMPGASSQSDIIEWILS 105
           E+  I+ RY ++SIP ++ F++G KV++ +  GA  +    E +L 
Sbjct: 83  ENPAIAARYGVTSIPLVVGFQNGEKVVESV--GAKPKGRAGEGVLG 126


>gi|148556643|ref|YP_001264225.1| thioredoxin [Sphingomonas wittichii RW1]
 gi|148501833|gb|ABQ70087.1| thioredoxin [Sphingomonas wittichii RW1]
          Length = 147

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 60/98 (61%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           VD  +FD  V   S PV+VDFWASWC PC  ++P     A EL   V++ K+D E    I
Sbjct: 44  VDATAFDRHVGRGSLPVLVDFWASWCGPCRAMAPAFKAAAAELEPHVRLLKVDTEAEQGI 103

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           S RY+I SIPTLILFK G+ I R   GA  ++ ++ W+
Sbjct: 104 SGRYRIQSIPTLILFKGGREIARQA-GAMDRARLVAWV 140


>gi|329297880|ref|ZP_08255216.1| thioredoxin [Plautia stali symbiont]
          Length = 110

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+     +VDFWA WC PC  ++PI+D++A+E   K+ I KL+I+E+   + +Y
Sbjct: 13  SFDTDVLKADGVTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKLNIDENPGTAPKY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 73  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|238787891|ref|ZP_04631687.1| Thioredoxin 2 [Yersinia frederiksenii ATCC 33641]
 gi|238723839|gb|EEQ15483.1| Thioredoxin 2 [Yersinia frederiksenii ATCC 33641]
          Length = 138

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            P+V+DFWA WC PC   +PI  D+A E A KV+  K++ 
Sbjct: 25  FDGEVINATAETLDKLLQDDLPIVIDFWAPWCGPCRNFAPIFTDVAAERARKVRFVKVNT 84

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E    +STR++I SIPT++L+++GK++D M+ GA  ++    W+
Sbjct: 85  EAEPALSTRFRIRSIPTIMLYRNGKMVD-MLSGAVPKAPFDNWL 127


>gi|310779480|ref|YP_003967813.1| thioredoxin [Ilyobacter polytropus DSM 2926]
 gi|309748803|gb|ADO83465.1| thioredoxin [Ilyobacter polytropus DSM 2926]
          Length = 104

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 63/87 (72%), Gaps = 2/87 (2%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          +++D  +F +EVLE    V+VDFWASWC PC  L PI++++++E+     I K++++E S
Sbjct: 5  IQLDEATFKTEVLEGKGVVLVDFWASWCGPCKMLGPILEELSEEVT--ANICKVNVDEYS 62

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
           ++  Y I SIPT+I+FKDGK +D+++
Sbjct: 63 GLAAEYGIRSIPTMIVFKDGKKVDQLV 89


>gi|149176738|ref|ZP_01855349.1| thioredoxin [Planctomyces maris DSM 8797]
 gi|148844379|gb|EDL58731.1| thioredoxin [Planctomyces maris DSM 8797]
          Length = 108

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 64/89 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          + L+    +F SEVLE S PV+VDFWA WC PC  + P I++IA + + +V++ KL+ +E
Sbjct: 4  NVLEFTDANFQSEVLEASEPVLVDFWAPWCGPCKMMMPTIEEIASDYSGRVRVGKLNTDE 63

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  I++   I++IPT++L+K+G+V+++ +
Sbjct: 64 NPGIASASSINAIPTVMLYKNGEVVEKFV 92


>gi|78779455|ref|YP_397567.1| thioredoxin [Prochlorococcus marinus str. MIT 9312]
 gi|123968699|ref|YP_001009557.1| thioredoxin [Prochlorococcus marinus str. AS9601]
 gi|126696505|ref|YP_001091391.1| thioredoxin [Prochlorococcus marinus str. MIT 9301]
 gi|78712954|gb|ABB50131.1| thioredoxin [Prochlorococcus marinus str. MIT 9312]
 gi|123198809|gb|ABM70450.1| Thioredoxin [Prochlorococcus marinus str. AS9601]
 gi|126543548|gb|ABO17790.1| Thioredoxin [Prochlorococcus marinus str. MIT 9301]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 63/89 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          SA  V   SFD +VL+   PV+VDFWA WC PC  ++P++++I+ +   K+K+ KL+ +E
Sbjct: 3  SAPAVTDSSFDKDVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDE 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +  ++++Y I SIPTL++FK G+ +D ++
Sbjct: 63 NPNVASQYGIRSIPTLMIFKGGQKVDTVV 91


>gi|329938648|ref|ZP_08288044.1| thioredoxin [Streptomyces griseoaurantiacus M045]
 gi|329302139|gb|EGG46031.1| thioredoxin [Streptomyces griseoaurantiacus M045]
          Length = 110

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 67/97 (69%), Gaps = 3/97 (3%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+ EVL+   PV+VDFWA+WC PC +++P ++ IA E  DK++I KL+I+E+   + RY
Sbjct: 12  TFEQEVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHGDKIQIVKLNIDENPGTAARY 71

Query: 70  QISSIPTLILFKDGKVIDRMM---PGASSQSDIIEWI 103
            + SIPTL +++ G+V   ++   P A+ + D+ ++I
Sbjct: 72  GVMSIPTLNVYQGGEVAKTIVGAKPKAAIERDLADFI 108


>gi|76812139|ref|YP_333769.1| thioredoxin 1 [Burkholderia pseudomallei 1710b]
 gi|76581592|gb|ABA51067.1| thioredoxin 1 [Burkholderia pseudomallei 1710b]
          Length = 146

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +V++   PV++DFWA WC PC  ++PI+D++A +  DK++I K++++E+     ++
Sbjct: 50  SFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQATPAKF 109

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 110 GVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 146


>gi|83950791|ref|ZP_00959524.1| thioredoxin [Roseovarius nubinhibens ISM]
 gi|83838690|gb|EAP77986.1| thioredoxin [Roseovarius nubinhibens ISM]
          Length = 106

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV     PVVVDFWA WC PC ++ P +++IA E+  KVKI K+D++
Sbjct: 1   MATVAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEEIAAEMGGKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   + +  +  IP L +FK+G+V+     GA+ ++ +  WI
Sbjct: 61  SNPNSAAQMGVRGIPALFIFKNGEVVSNRA-GAAPKAALQSWI 102


>gi|119776348|ref|YP_929088.1| thioredoxin [Shewanella amazonensis SB2B]
 gi|119768848|gb|ABM01419.1| thioredoxin [Shewanella amazonensis SB2B]
          Length = 108

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+   PV+VDFWA WC PC  ++PI+DD+A E   KV + KL+++ ++    +Y
Sbjct: 12  SFENDVLKSELPVLVDFWAEWCGPCKMIAPILDDVAAEYEGKVTVAKLNVDHNNASPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL++FK G+++   + GA S++ + E+I
Sbjct: 72  GVRGIPTLLMFKGGELVATKV-GALSKTQLKEFI 104


>gi|198274348|ref|ZP_03206880.1| hypothetical protein BACPLE_00492 [Bacteroides plebeius DSM
          17135]
 gi|198272838|gb|EDY97107.1| hypothetical protein BACPLE_00492 [Bacteroides plebeius DSM
          17135]
          Length = 105

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 70/95 (73%), Gaps = 2/95 (2%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL +   +F++ V E   PVV+DFWA+WC PC +++P I+++A+E  DKV I K D++E+
Sbjct: 2  ALNIKDDNFEAIVAE-GKPVVLDFWATWCGPCKQIAPYIEELAEEYKDKVNIGKCDVDEN 60

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          +++  ++ + +IPT++  K+G+V+D+ + GA+++S
Sbjct: 61 ADLPAQFGVRNIPTVLFIKNGEVVDKQV-GATTKS 94


>gi|21325864|dbj|BAC00485.1| Thiol-disulfide isomerase and thioredoxins [Corynebacterium
           glutamicum ATCC 13032]
          Length = 124

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V  ++F S V++   PV+VDFWA WC PC KLSPII++IA E  DK  +  +D++ 
Sbjct: 20  NVVAVTEQTFKSTVIDSDKPVIVDFWAEWCGPCKKLSPIIEEIAGEYGDKAVVASVDVDA 79

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
              +   +QI SIP++++FK+G  ++  + G   +++I+E
Sbjct: 80  ERTLGAMFQIMSIPSVLIFKNGAKVEEFV-GLRPKNEIVE 118


>gi|297180544|gb|ADI16756.1| thiol-disulfide isomerase and thioredoxins [uncultured gamma
          proteobacterium HF0010_11B23]
          Length = 105

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 67/89 (75%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          V+ ++F SEVLE +  V+VDFWA WC PC +++P ++++A++ ++ + + K+D++ + E+
Sbjct: 5  VNNETFTSEVLEQTKLVLVDFWAEWCGPCKQIAPTLEELAEKYSENLSVCKVDVDANREL 64

Query: 66 STRYQISSIPTLILFKDGKVIDRMMPGAS 94
          + +Y + SIP+L++FK+G+++D ++   S
Sbjct: 65 ALQYNVRSIPSLMIFKNGEMVDSLIGAVS 93


>gi|166711415|ref|ZP_02242622.1| thioredoxin [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 285

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 66/98 (67%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D+++  +I
Sbjct: 12  TDTFETEVLQKSLTTPVLVDFWAAWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|195952996|ref|YP_002121286.1| thioredoxin [Hydrogenobaculum sp. Y04AAS1]
 gi|195932608|gb|ACG57308.1| thioredoxin [Hydrogenobaculum sp. Y04AAS1]
          Length = 108

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 60/78 (76%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          ++++EV+  S PV+VDFWA WC PC  ++P+++ +A E A ++K+ KL+ +++  +S RY
Sbjct: 12 NWENEVINSSVPVLVDFWAPWCGPCRIIAPVVEKLAGEFAGQIKVGKLNTDDNPGVSMRY 71

Query: 70 QISSIPTLILFKDGKVID 87
           I +IPT+++FK+G+V+D
Sbjct: 72 GIRAIPTIMMFKNGEVVD 89


>gi|149178434|ref|ZP_01857024.1| thioredoxin [Planctomyces maris DSM 8797]
 gi|148842751|gb|EDL57124.1| thioredoxin [Planctomyces maris DSM 8797]
          Length = 155

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   +F   VLE   PV+V+FWA WCRPC+++ P++++ +++ A +VKI ++ I+E+  
Sbjct: 33  EVTDSNFQKSVLEADQPVLVEFWAPWCRPCIEMIPLLEEASEQFAGRVKILRMRIDENPA 92

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + +Y+I + P  +LF +GKV  R + G  +Q+ +   I
Sbjct: 93  TAAKYEIDAPPAFLLFNEGKVFKRRL-GKQTQAQLTSLI 130


>gi|111020640|ref|YP_703612.1| thioredoxin [Rhodococcus jostii RHA1]
 gi|110820170|gb|ABG95454.1| thioredoxin [Rhodococcus jostii RHA1]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 59/81 (72%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          SF  +V+    PV+VDFWA+WC PC  ++P++++IA E ++K+ I KLDI+ +   +  +
Sbjct: 11 SFQQDVISSDKPVLVDFWATWCGPCKMIAPVLEEIAGEHSEKLTIAKLDIDANPGAARDF 70

Query: 70 QISSIPTLILFKDGKVIDRMM 90
          Q+ SIPTLILFKDGK I+ ++
Sbjct: 71 QVMSIPTLILFKDGKPINTIV 91


>gi|21243510|ref|NP_643092.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
 gi|21109072|gb|AAM37628.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
          Length = 286

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 66/98 (67%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D+++  +I
Sbjct: 12  TDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|194336618|ref|YP_002018412.1| thioredoxin [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309095|gb|ACF43795.1| thioredoxin [Pelodictyon phaeoclathratiforme BU-1]
          Length = 114

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 59/81 (72%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F +E+L+     +VDFWA+WC PC+ L P+I+++A +   K  I KL+++E+   + +Y
Sbjct: 17 NFKTEILDSDKVALVDFWAAWCGPCMMLGPVIEELAGDFEGKAVIAKLNVDENPNTAAQY 76

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           I SIP+L++FK+G+V+D+M+
Sbjct: 77 GIRSIPSLLVFKNGQVVDQML 97


>gi|168007903|ref|XP_001756647.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162692243|gb|EDQ78601.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 186

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+ +++   VLE + PV+VDFWA WC PC  ++P+ID++A + A K+K  KL+ +ES  I
Sbjct: 84  VNEETWKELVLESTIPVLVDFWAPWCGPCRMIAPLIDELAKQYAGKIKCLKLNTDESPGI 143

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +T Y I SIPT++LFK+G+  D ++ GA  +S +
Sbjct: 144 ATEYGIRSIPTVMLFKNGEKKDTVI-GAVPKSTL 176


>gi|15839287|ref|NP_299975.1| thioredoxin [Xylella fastidiosa 9a5c]
 gi|9107939|gb|AAF85495.1|AE004075_10 thioredoxin [Xylella fastidiosa 9a5c]
          Length = 113

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L V   +FD+ VL    PV+VDFWA WC PC  +S ++DD+A     ++KI K+DI+E+ 
Sbjct: 6  LHVSDANFDAVVLLSDQPVLVDFWAKWCSPCKIISTLLDDLAQSYKGRLKIAKVDIDENR 65

Query: 64 EISTRYQISSIPTLILFKDGKV 85
           ++ +Y + SIP L+LFKDG+V
Sbjct: 66 ALAIKYHVCSIPMLLLFKDGQV 87


>gi|332298779|ref|YP_004440701.1| thioredoxin [Treponema brennaborense DSM 12168]
 gi|332181882|gb|AEE17570.1| thioredoxin [Treponema brennaborense DSM 12168]
          Length = 103

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 62/90 (68%), Gaps = 1/90 (1%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +F  EV E   PV+VDF+A+WC PC  ++PI+D++A EL  + K+ K+DI++   ++T++
Sbjct: 9  NFQKEVFESDKPVLVDFFATWCGPCKMMAPIVDELAKELDGEAKVFKVDIDQEEALATKF 68

Query: 70 QISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           I SIPT ++ K+GK+  +  PG  S+ D+
Sbjct: 69 GIMSIPTFMVVKNGKITAQ-EPGGRSKEDL 97


>gi|315022288|gb|EFT35316.1| Thioredoxin [Riemerella anatipestifer RA-YM]
          Length = 105

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F   V+    PV+VDFWA WC PC  L PI++++A++   K  + KLD++ +
Sbjct: 2   ALEITDSNFKEVVINSDKPVLVDFWAVWCGPCRMLGPIVEELANDFEGKAVVGKLDVDNN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            +++  Y I +IPT+++FK+G+V+D+++ G S +  I E
Sbjct: 62  QQVAMEYGIRNIPTVLIFKNGEVVDKLV-GVSPKEVIAE 99


>gi|71275291|ref|ZP_00651578.1| Thioredoxin [Xylella fastidiosa Dixon]
 gi|71902031|ref|ZP_00684075.1| Thioredoxin [Xylella fastidiosa Ann-1]
 gi|170731295|ref|YP_001776728.1| thioredoxin [Xylella fastidiosa M12]
 gi|71164100|gb|EAO13815.1| Thioredoxin [Xylella fastidiosa Dixon]
 gi|71728210|gb|EAO30397.1| Thioredoxin [Xylella fastidiosa Ann-1]
 gi|167966088|gb|ACA13098.1| thioredoxin [Xylella fastidiosa M12]
          Length = 113

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L V   +FD+ VL    PV+VDFWA WC PC  +S ++DD+A     ++KI K+DI+E+ 
Sbjct: 6  LHVSDANFDAMVLLSDQPVLVDFWAKWCGPCKIISTLLDDLAQSYEGRLKIVKVDIDENR 65

Query: 64 EISTRYQISSIPTLILFKDGKV 85
           ++ +Y + SIP L+LFKDG+V
Sbjct: 66 ALAIKYHVCSIPMLLLFKDGQV 87


>gi|110677843|ref|YP_680850.1| thioredoxin [Roseobacter denitrificans OCh 114]
 gi|109453959|gb|ABG30164.1| thioredoxin [Roseobacter denitrificans OCh 114]
          Length = 106

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L V   +FD+EV     PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATLAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPSLEELSAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +  +  IP L +FKDG+V+  M  GA  ++ +  WI
Sbjct: 61  ENPNSPAQMGVRGIPALFIFKDGQVVSNMA-GAKPKAALQGWI 102


>gi|294666094|ref|ZP_06731353.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292604153|gb|EFF47545.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 285

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 66/98 (67%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D+++  +I
Sbjct: 12  TDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|289663247|ref|ZP_06484828.1| thioredoxin [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 285

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 65/98 (66%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D++   +I
Sbjct: 12  TDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDREQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|226226656|ref|YP_002760762.1| thioredoxin [Gemmatimonas aurantiaca T-27]
 gi|226089847|dbj|BAH38292.1| thioredoxin [Gemmatimonas aurantiaca T-27]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 62/89 (69%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A++V   +F +E+ +     VVDFWA+WC PC  ++PI++ +A + A + K+ KLD++ 
Sbjct: 3  NAVEVKDDTFATEIEQHEGLAVVDFWATWCAPCRMIAPIVEQLATDYAGQAKVAKLDVDN 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +   + R+ + SIPT++ FKDGK++D+++
Sbjct: 63 NQRTAARFNVRSIPTILFFKDGKLVDQVV 91


>gi|312200967|ref|YP_004021028.1| thioredoxin [Frankia sp. EuI1c]
 gi|311232303|gb|ADP85158.1| thioredoxin [Frankia sp. EuI1c]
          Length = 108

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 67/98 (68%), Gaps = 5/98 (5%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD+EVL+   PV+VDFWA WC PC  ++P++++IA    D++++ KL+I+E+ + +  Y
Sbjct: 12  TFDAEVLKSDKPVLVDFWAEWCGPCKMVAPVLEEIAATHGDQLRVVKLNIDENPQTARAY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQS----DIIEWI 103
           QI SIPT+ +F DG +   ++ GA  +S    D+ E+I
Sbjct: 72  QIMSIPTMAVFVDGAIAKSIV-GAKPKSVLLKDLAEYI 108


>gi|51893542|ref|YP_076233.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
 gi|51857231|dbj|BAD41389.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
          Length = 112

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 64/81 (79%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          ++ +EV + S PV+VDFWA WC PC  ++P++++IA +   ++K+ KL+++E+++++ RY
Sbjct: 13 NWAAEVEQSSLPVLVDFWAVWCGPCRMIAPVVEEIAADYEGRMKVGKLNVDENNDLAARY 72

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           + SIPTLILFK+G+ ++R++
Sbjct: 73 GVMSIPTLILFKNGEPVERIV 93


>gi|51244662|ref|YP_064546.1| thioredoxin [Desulfotalea psychrophila LSv54]
 gi|50875699|emb|CAG35539.1| probable thioredoxin [Desulfotalea psychrophila LSv54]
          Length = 108

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 65/97 (67%), Gaps = 2/97 (2%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V+   FD+ ++    P +VDFWA WC PC  + P+I+D+A+E   KV I K++++++  
Sbjct: 8   QVNDGDFDT-LISSGQPTLVDFWAPWCGPCKAIGPVIEDLANEFDGKVTIAKMNVDDNPN 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
              +Y I +IPT+ILFKDG+ ID++  GA  ++ +++
Sbjct: 67  TPGKYGIRAIPTIILFKDGEAIDQLT-GAVGKTQLVD 102


>gi|53719131|ref|YP_108117.1| thioredoxin 1 [Burkholderia pseudomallei K96243]
 gi|53723575|ref|YP_103023.1| thioredoxin [Burkholderia mallei ATCC 23344]
 gi|67639667|ref|ZP_00438507.1| thioredoxin [Burkholderia mallei GB8 horse 4]
 gi|121601527|ref|YP_993172.1| thioredoxin [Burkholderia mallei SAVP1]
 gi|124384408|ref|YP_001026053.1| thioredoxin [Burkholderia mallei NCTC 10229]
 gi|126440945|ref|YP_001059243.1| thioredoxin [Burkholderia pseudomallei 668]
 gi|126449535|ref|YP_001080679.1| thioredoxin [Burkholderia mallei NCTC 10247]
 gi|126454139|ref|YP_001066510.1| thioredoxin [Burkholderia pseudomallei 1106a]
 gi|134277757|ref|ZP_01764472.1| thioredoxin [Burkholderia pseudomallei 305]
 gi|167003445|ref|ZP_02269231.1| thioredoxin [Burkholderia mallei PRL-20]
 gi|167719244|ref|ZP_02402480.1| thioredoxin 1 [Burkholderia pseudomallei DM98]
 gi|167738241|ref|ZP_02411015.1| thioredoxin 1 [Burkholderia pseudomallei 14]
 gi|167815431|ref|ZP_02447111.1| thioredoxin 1 [Burkholderia pseudomallei 91]
 gi|167823841|ref|ZP_02455312.1| thioredoxin 1 [Burkholderia pseudomallei 9]
 gi|167845382|ref|ZP_02470890.1| thioredoxin 1 [Burkholderia pseudomallei B7210]
 gi|167893925|ref|ZP_02481327.1| thioredoxin 1 [Burkholderia pseudomallei 7894]
 gi|167902377|ref|ZP_02489582.1| thioredoxin 1 [Burkholderia pseudomallei NCTC 13177]
 gi|167910617|ref|ZP_02497708.1| thioredoxin 1 [Burkholderia pseudomallei 112]
 gi|167918642|ref|ZP_02505733.1| thioredoxin 1 [Burkholderia pseudomallei BCC215]
 gi|217421391|ref|ZP_03452895.1| thioredoxin [Burkholderia pseudomallei 576]
 gi|226197085|ref|ZP_03792662.1| thioredoxin [Burkholderia pseudomallei Pakistan 9]
 gi|237812567|ref|YP_002897018.1| thioredoxin [Burkholderia pseudomallei MSHR346]
 gi|242317808|ref|ZP_04816824.1| thioredoxin [Burkholderia pseudomallei 1106b]
 gi|254177698|ref|ZP_04884353.1| thioredoxin [Burkholderia mallei ATCC 10399]
 gi|254179533|ref|ZP_04886132.1| thioredoxin [Burkholderia pseudomallei 1655]
 gi|254189075|ref|ZP_04895586.1| thioredoxin [Burkholderia pseudomallei Pasteur 52237]
 gi|254197327|ref|ZP_04903749.1| thioredoxin [Burkholderia pseudomallei S13]
 gi|254199968|ref|ZP_04906334.1| thioredoxin [Burkholderia mallei FMH]
 gi|254206301|ref|ZP_04912653.1| thioredoxin [Burkholderia mallei JHU]
 gi|254258295|ref|ZP_04949349.1| thioredoxin [Burkholderia pseudomallei 1710a]
 gi|254297412|ref|ZP_04964865.1| thioredoxin [Burkholderia pseudomallei 406e]
 gi|254358285|ref|ZP_04974558.1| thioredoxin [Burkholderia mallei 2002721280]
 gi|52209545|emb|CAH35498.1| thioredoxin 1 [Burkholderia pseudomallei K96243]
 gi|52426998|gb|AAU47591.1| thioredoxin [Burkholderia mallei ATCC 23344]
 gi|121230337|gb|ABM52855.1| thioredoxin [Burkholderia mallei SAVP1]
 gi|124292428|gb|ABN01697.1| thioredoxin [Burkholderia mallei NCTC 10229]
 gi|126220438|gb|ABN83944.1| thioredoxin [Burkholderia pseudomallei 668]
 gi|126227781|gb|ABN91321.1| thioredoxin [Burkholderia pseudomallei 1106a]
 gi|126242405|gb|ABO05498.1| thioredoxin [Burkholderia mallei NCTC 10247]
 gi|134251407|gb|EBA51486.1| thioredoxin [Burkholderia pseudomallei 305]
 gi|147749564|gb|EDK56638.1| thioredoxin [Burkholderia mallei FMH]
 gi|147753744|gb|EDK60809.1| thioredoxin [Burkholderia mallei JHU]
 gi|148027412|gb|EDK85433.1| thioredoxin [Burkholderia mallei 2002721280]
 gi|157808016|gb|EDO85186.1| thioredoxin [Burkholderia pseudomallei 406e]
 gi|157936754|gb|EDO92424.1| thioredoxin [Burkholderia pseudomallei Pasteur 52237]
 gi|160698737|gb|EDP88707.1| thioredoxin [Burkholderia mallei ATCC 10399]
 gi|169654068|gb|EDS86761.1| thioredoxin [Burkholderia pseudomallei S13]
 gi|184210073|gb|EDU07116.1| thioredoxin [Burkholderia pseudomallei 1655]
 gi|217395133|gb|EEC35151.1| thioredoxin [Burkholderia pseudomallei 576]
 gi|225930464|gb|EEH26474.1| thioredoxin [Burkholderia pseudomallei Pakistan 9]
 gi|237503934|gb|ACQ96252.1| thioredoxin [Burkholderia pseudomallei MSHR346]
 gi|238520254|gb|EEP83716.1| thioredoxin [Burkholderia mallei GB8 horse 4]
 gi|242141047|gb|EES27449.1| thioredoxin [Burkholderia pseudomallei 1106b]
 gi|243061008|gb|EES43194.1| thioredoxin [Burkholderia mallei PRL-20]
 gi|254216984|gb|EET06368.1| thioredoxin [Burkholderia pseudomallei 1710a]
          Length = 108

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +V++   PV++DFWA WC PC  ++PI+D++A +  DK++I K++++E+     ++
Sbjct: 12  SFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQATPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 72  GVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|15807833|ref|NP_285488.1| thioredoxin 1 [Deinococcus radiodurans R1]
 gi|6460496|gb|AAF12202.1|AE001862_28 thioredoxin 1 [Deinococcus radiodurans R1]
          Length = 142

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 58/75 (77%)

Query: 16  LECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIP 75
           L+ S PV+VDFWA WC PC  + P+++D+A +L  KV++ K++++E+   + R+++ SIP
Sbjct: 49  LQTSVPVLVDFWAPWCGPCRVMGPVLEDLARDLPGKVRVVKVNVDENPRTAARFEVRSIP 108

Query: 76  TLILFKDGKVIDRMM 90
           TL++FKDG+ +D+M+
Sbjct: 109 TLLMFKDGEEVDQMV 123


>gi|15606934|ref|NP_214315.1| thioredoxin [Aquifex aeolicus VF5]
 gi|2984180|gb|AAC07712.1| thioredoxin [Aquifex aeolicus VF5]
          Length = 139

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 75/102 (73%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++++ ++++ EVL+   PV+VDFWA WC PC  ++PII++IA+EL DKVK+ KL+ +E+ 
Sbjct: 6   IELNEQNWEQEVLQSDKPVLVDFWAPWCGPCRIIAPIIEEIAEELGDKVKVGKLNTDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            I+ RY I +IPT+ILFK+G+V+D  + G   +  + +W LS
Sbjct: 66  NIAMRYGIRAIPTIILFKNGEVVDTRI-GVQPKERLNKWFLS 106


>gi|311278484|ref|YP_003940715.1| thioredoxin [Enterobacter cloacae SCF1]
 gi|308747679|gb|ADO47431.1| thioredoxin [Enterobacter cloacae SCF1]
          Length = 142

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (62%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  ++           PVVVDFWA WC PC   +PI +D+A+E + K++  K++ 
Sbjct: 34  FDGEVVNATDATLDKLLKDDLPVVVDFWAPWCGPCRSFAPIFEDVAEERSGKMRFVKVNT 93

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E    +S R++I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 94  EAEQALSARFRIRSIPTIMMFKNGEVVD-MLNGAVPKAPFDSWL 136


>gi|269104204|ref|ZP_06156900.1| thioredoxin 2 [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268160844|gb|EEZ39341.1| thioredoxin 2 [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 144

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVVVDFWA WC PCV  +P+  D+A+E    V+  K+D E   E++ +Y+I SIPT+++F
Sbjct: 57  PVVVDFWAPWCGPCVGFAPVFKDVAEEREGDVRFVKVDTEAQQELAMQYRIRSIPTIMVF 116

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+++D ++ GA  ++   EW+
Sbjct: 117 KNGQMVD-VINGALPKTHFNEWL 138


>gi|260913061|ref|ZP_05919543.1| thioredoxin-1 [Pasteurella dagmatis ATCC 43325]
 gi|260632648|gb|EEX50817.1| thioredoxin-1 [Pasteurella dagmatis ATCC 43325]
          Length = 106

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L     +F ++V+    PV++DFWA WC PC  +SPI+D+IA E + KVK+ K++I+
Sbjct: 1   MEVLHSTDATFAADVVNSDVPVLLDFWAPWCGPCRMISPILDEIATEFSGKVKVVKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +  + SIPTL+LFKDGK +   + GA  ++ +  +I
Sbjct: 61  ENQATPAQLGVRSIPTLVLFKDGKPVATQV-GALPKNQLANFI 102


>gi|257464116|ref|ZP_05628499.1| thioredoxin [Fusobacterium sp. D12]
 gi|317061633|ref|ZP_07926118.1| thioredoxin [Fusobacterium sp. D12]
 gi|313687309|gb|EFS24144.1| thioredoxin [Fusobacterium sp. D12]
          Length = 103

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (71%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ ++V  ++F  EVLE   PV+VDF+A+WC PC  L P+++D+  E + K KI K+DI+
Sbjct: 1  MAIIQVTKENFKKEVLEADQPVIVDFFATWCGPCKSLGPVLEDVIAEDSFK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
             E++  Y+I S+PTL+LFK G+V+++
Sbjct: 60 AEPELAAEYKIMSVPTLLLFKHGEVVEK 87


>gi|251772135|gb|EES52705.1| thioredoxin [Leptospirillum ferrodiazotrophum]
          Length = 152

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 66/97 (68%), Gaps = 2/97 (2%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F   V+    PV+VDFWA WC PC +++P+++D+A E   +V + KL+++E+   +  ++
Sbjct: 57  FSERVINSRLPVLVDFWAPWCGPCRQVAPVLEDLAREYRGRVIVAKLNVDENGYTAREFR 116

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +SSIPTL+L +DG  ++RM+ GA S+   IE +LS V
Sbjct: 117 VSSIPTLVLIRDGNELNRMV-GAQSRPH-IERLLSMV 151


>gi|157960227|ref|YP_001500261.1| thioredoxin [Shewanella pealeana ATCC 700345]
 gi|157845227|gb|ABV85726.1| thioredoxin [Shewanella pealeana ATCC 700345]
          Length = 108

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V+    PV+VDFWA WC PC  ++PI+DD+A+E   K+KI KL++++++    +Y
Sbjct: 12  SFENDVINSELPVLVDFWAEWCGPCKMIAPILDDVAEEYEGKIKIAKLNVDQNNVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFK G++    + GA S++ + E+I
Sbjct: 72  GVRGIPTLLLFKAGELAATKV-GALSKTQLKEFI 104


>gi|332980872|ref|YP_004462313.1| thioredoxin [Mahella australiensis 50-1 BON]
 gi|332698550|gb|AEE95491.1| thioredoxin [Mahella australiensis 50-1 BON]
          Length = 106

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++V   +F  EVL+   PV+VDFWA WC PC  ++PII++IA+E  D  K+ KL+++E+ 
Sbjct: 5   IEVTDTNFSKEVLQSDKPVLVDFWAPWCGPCRMMAPIIEEIAEE-NDDFKVAKLNVDENP 63

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I++ Y+I SIPTL +FK G+++D+++ G + +  ++  + + V
Sbjct: 64  LIASTYRIMSIPTLGIFKGGRMVDQIV-GVTPKQRVVNAVKALV 106


>gi|85705744|ref|ZP_01036841.1| thioredoxin [Roseovarius sp. 217]
 gi|85669734|gb|EAQ24598.1| thioredoxin [Roseovarius sp. 217]
          Length = 106

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV   + PVVVDFWA WC PC ++ P++++++ E++ K+KI K+D++
Sbjct: 1   MATVAVTDATFDAEVKNSNIPVVVDFWAEWCGPCKQIGPVLEELSTEMSGKIKIVKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI
Sbjct: 61  SNPNSAVAMGVRGIPALFIFKDGQVVSNRA-GAAPKAALQSWI 102


>gi|329957521|ref|ZP_08297996.1| thioredoxin [Bacteroides clarus YIT 12056]
 gi|328522398|gb|EGF49507.1| thioredoxin [Bacteroides clarus YIT 12056]
          Length = 104

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F  E+L    PVV+DFWA WC PC  + PIID++A E   KV I K D++E+
Sbjct: 2  ALEITDNNF-KEILAEGKPVVIDFWAPWCGPCKMVGPIIDELAGEYEGKVLIGKCDVDEN 60

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGA 93
           +++  Y I +IPT++ FK+G+++D+ +  A
Sbjct: 61 GDVAAEYGIRNIPTVLFFKNGELVDKQVGSA 91


>gi|320160914|ref|YP_004174138.1| thioredoxin [Anaerolinea thermophila UNI-1]
 gi|319994767|dbj|BAJ63538.1| thioredoxin [Anaerolinea thermophila UNI-1]
          Length = 117

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 58/87 (66%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V   +F+  VL+ + PV+VDFWA WC PC  ++P+++ IA E A KV + K++ +E+ 
Sbjct: 6  IHVTDAAFEKTVLQSTLPVIVDFWAPWCGPCKMIAPVLEKIAKEYAGKVIVAKVNTDENP 65

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
          E + +Y I  IPTL+ F +GK++ R +
Sbjct: 66 EWAMKYGIQGIPTLLFFSNGKIVHRQV 92


>gi|271502411|ref|YP_003335437.1| thioredoxin [Dickeya dadantii Ech586]
 gi|270345966|gb|ACZ78731.1| thioredoxin [Dickeya dadantii Ech586]
          Length = 108

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+  +  +VDFWA WC PC  ++PI+D+IADE   K+ I KL+I+++   + +Y
Sbjct: 12  SFETDVLQSEHVTLVDFWADWCGPCKMIAPILDEIADEYEGKLTIAKLNIDDNPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 108


>gi|188577788|ref|YP_001914717.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188522240|gb|ACD60185.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 285

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 65/98 (66%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL  S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D+++  +I
Sbjct: 12  TDTFETEVLHKSLTTPVLVDFWAAWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|302186814|ref|ZP_07263487.1| thioredoxin [Pseudomonas syringae pv. syringae 642]
          Length = 109

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +F++EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL+I+E+ +
Sbjct: 8   HVTDATFEAEVLQAQGPVLVDYWAEWCGPCKMIAPVLDEIASTYQGKLTVAKLNIDENQD 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 68  TPAKHGVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFL 105


>gi|294624225|ref|ZP_06702941.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292601478|gb|EFF45499.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 285

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 66/98 (67%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D+++  +I
Sbjct: 12  TDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|240145637|ref|ZP_04744238.1| thioredoxin [Roseburia intestinalis L1-82]
 gi|257202258|gb|EEV00543.1| thioredoxin [Roseburia intestinalis L1-82]
          Length = 108

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +   +F++EVL    PVV+DFWA WC PC   SP+I+ +A+EL  KV   K++++
Sbjct: 1   MAVITITKDNFENEVLGAKLPVVLDFWAEWCAPCKMQSPVIEALAEELEGKVIFGKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E + ++ +YQI SIPTL++ K G   +R + G  ++ +II+ I
Sbjct: 61  EEAVLALKYQIMSIPTLVVMKYGLFQNRAV-GLQTREEIIDMI 102


>gi|90994416|ref|YP_536906.1| thioredoxin [Porphyra yezoensis]
 gi|1729949|sp|P50254|THIO_PORYE RecName: Full=Thioredoxin; Short=Trx
 gi|509277|emb|CAA54077.1| thioredoxin [Porphyra yezoensis]
 gi|90818980|dbj|BAE92349.1| thioredoxin [Porphyra yezoensis]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MS  +V   SF  EV+  + PV+VDFWA WC PC  +SP++D+IA+E    +K+ K++ +
Sbjct: 1  MSVSQVTDASFKQEVINNNLPVLVDFWAPWCGPCRMVSPVVDEIAEEYESSIKVVKINTD 60

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          ++  I+  Y I SIPTL++FK G+ +D ++ GA  +S +
Sbjct: 61 DNPTIAAEYGIRSIPTLMIFKAGERVDTVI-GAVPKSTL 98


>gi|54303437|ref|YP_133430.1| thioredoxin 2 [Photobacterium profundum SS9]
 gi|46916867|emb|CAG23630.1| putative thioredoxin 2 [Photobacterium profundum SS9]
          Length = 146

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 60/89 (67%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           +++   PVVVDFWA WC PCV  +PI +D+A E +   +  K+D E   E++ +Y+I SI
Sbjct: 51  LIQSDTPVVVDFWAPWCNPCVGFAPIFEDVAAERSGDARFVKIDTEAQQELAAQYRIRSI 110

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           PT+++FK+G++++ +  GA  +S   +W+
Sbjct: 111 PTIMVFKNGQLLNNLN-GALPKSQFNQWL 138


>gi|313202512|ref|YP_004041169.1| thioredoxin [Paludibacter propionicigenes WB4]
 gi|312441828|gb|ADQ78184.1| thioredoxin [Paludibacter propionicigenes WB4]
          Length = 99

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 59/78 (75%), Gaps = 1/78 (1%)

Query: 8  TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
          T +FDS + E + PV+VDF A WC PC   SPI+  +A+EL ++V++ K+D++++  I+ 
Sbjct: 2  TGNFDSIINE-NRPVIVDFHAVWCGPCKTQSPILKQVAEELGERVRVIKIDVDKNQAIAG 60

Query: 68 RYQISSIPTLILFKDGKV 85
          RYQI S+PTL++FK+G++
Sbjct: 61 RYQIQSVPTLMIFKNGEI 78


>gi|311281533|ref|YP_003943764.1| thioredoxin [Enterobacter cloacae SCF1]
 gi|308750728|gb|ADO50480.1| thioredoxin [Enterobacter cloacae SCF1]
          Length = 109

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEFDGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK G+V+   + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKQGEVVATKV-GALSKGQLKEFL 104


>gi|226309506|ref|YP_002769468.1| thioredoxin [Rhodococcus erythropolis PR4]
 gi|229491192|ref|ZP_04385020.1| thioredoxin [Rhodococcus erythropolis SK121]
 gi|226188625|dbj|BAH36729.1| thioredoxin [Rhodococcus erythropolis PR4]
 gi|229321930|gb|EEN87723.1| thioredoxin [Rhodococcus erythropolis SK121]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 65/92 (70%), Gaps = 1/92 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF  +VL    PV+VDFWA+WC PC  ++P++++IA E ++K+ + KLDI+ +   +  +
Sbjct: 11  SFKQDVLGSDKPVLVDFWATWCGPCKMVAPVLEEIAGENSEKLTVAKLDIDANPAAARDF 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           Q+ SIPT+ILFKDGK I + + GA  ++ +++
Sbjct: 71  QVMSIPTMILFKDGKPI-KTIVGAKGKAALLK 101


>gi|302388339|ref|YP_003824161.1| thioredoxin [Clostridium saccharolyticum WM1]
 gi|302198967|gb|ADL06538.1| thioredoxin [Clostridium saccharolyticum WM1]
          Length = 106

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F+SEV++ S   +VDFWA+WC PC   +P+I++IA+     VK+ K+D++
Sbjct: 1   MAVITLTQENFESEVVKSSGIALVDFWATWCGPCKMFAPVIEEIAEGNFPDVKVGKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +++ ++++ SIPTL+LFKDGK     + G  S+ +++E I
Sbjct: 61  QQPDLAGQFKVMSIPTLVLFKDGKAAATSV-GVKSKKEVLEMI 102


>gi|326317371|ref|YP_004235043.1| thioredoxin [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374207|gb|ADX46476.1| thioredoxin [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 110

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++VL+    V+VD+WA WC PC  ++PI+D++AD    K+ + K++++E+ E+  ++
Sbjct: 13  SFEADVLQPGTTVLVDYWAEWCGPCKMIAPILDEVADSYQGKLTVAKMNVDENREVPAKF 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFKDG++    + GA S++ +  +I
Sbjct: 73  GIRGIPTLMLFKDGQLAATKV-GAMSKAQLTSFI 105


>gi|20513169|emb|CAD20141.1| thioredoxin [Buchnera aphidicola (Pemphigus spyrothecae)]
          Length = 110

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 65/93 (69%), Gaps = 1/93 (1%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V+ ++F+  +L+  N ++VDFWA WC PC  L+PI+++IA+E  DK+ + K++I+E+ 
Sbjct: 7  INVNEENFEKNILQEKNFILVDFWAEWCNPCKILAPILEEIANEYQDKLIVAKINIDENP 66

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96
           I+ +Y I  IP L+LFK+G ++   + GA S+
Sbjct: 67 NIAPKYSIRGIPALLLFKNGTLLKTKI-GALSK 98


>gi|167747399|ref|ZP_02419526.1| hypothetical protein ANACAC_02119 [Anaerostipes caccae DSM 14662]
 gi|317471129|ref|ZP_07930500.1| thioredoxin [Anaerostipes sp. 3_2_56FAA]
 gi|167652761|gb|EDR96890.1| hypothetical protein ANACAC_02119 [Anaerostipes caccae DSM 14662]
 gi|316901344|gb|EFV23287.1| thioredoxin [Anaerostipes sp. 3_2_56FAA]
          Length = 147

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 66/92 (71%), Gaps = 1/92 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
            ++F +EVL+   PV+VD +A+WC PC  + P+++++A E    VK+ KLDI+E+S+I+ 
Sbjct: 49  NENFQAEVLDSEQPVLVDMFATWCGPCRMMGPVVEELAKEYEGSVKVGKLDIDENSDIAG 108

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +Y + S+PT ++FK+G+V  +++ GA  + ++
Sbjct: 109 QYGVMSVPTFLVFKNGQVAAKVV-GAVPKEEL 139


>gi|156182335|gb|ABU55298.1| thiroredoxin [Flavobacterium columnare]
          Length = 84

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 58/84 (69%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL +   +FD  VL+   PV+VDFWA+WC PC  + P+ID+IA E   K  I K+D++ +
Sbjct: 1  ALAITDATFDEVVLQSDKPVLVDFWAAWCGPCRMVGPVIDEIATEYEGKAVIGKVDVDAN 60

Query: 63 SEISTRYQISSIPTLILFKDGKVI 86
           E + +Y + +IPT+++F++G+V+
Sbjct: 61 QEFAAKYGVRNIPTVLIFQNGEVV 84


>gi|78048496|ref|YP_364671.1| thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|78036926|emb|CAJ24619.1| thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
          Length = 285

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 66/98 (67%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++ K+D+++  +I
Sbjct: 12  TDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGEIVD-GFPGAMPEGQVREFL 108


>gi|260598963|ref|YP_003211534.1| thioredoxin 2 [Cronobacter turicensis z3032]
 gi|260218140|emb|CBA32951.1| Thioredoxin-2 [Cronobacter turicensis z3032]
          Length = 158

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVV+DFWA WC PC   +PI +D+A+E   K++  K++ E   E+S R++I SIPT+++F
Sbjct: 69  PVVIDFWAPWCGPCRSFAPIFEDVAEERNGKMRFVKVNTEAEPELSARFRIRSIPTIMMF 128

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K+G+++D M+ GA  ++    W+
Sbjct: 129 KNGQLVD-MLNGAVPKAPFDTWL 150


>gi|238892386|ref|YP_002917120.1| thioredoxin [Klebsiella pneumoniae NTUH-K2044]
 gi|290513186|ref|ZP_06552548.1| thioredoxin [Klebsiella sp. 1_1_55]
 gi|238544702|dbj|BAH61053.1| thioredoxin [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|289774397|gb|EFD82403.1| thioredoxin [Klebsiella sp. 1_1_55]
          Length = 113

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ + KL+I+++   + +Y
Sbjct: 16  SFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQNPGTAPKY 75

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 76  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 108


>gi|283832026|ref|ZP_06351767.1| thioredoxin [Citrobacter youngae ATCC 29220]
 gi|291071643|gb|EFE09752.1| thioredoxin [Citrobacter youngae ATCC 29220]
          Length = 139

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVVVDFWA WC PC   +PI +D+A+E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVVDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIPT+++F+ G+++D M+ GA  ++    W+
Sbjct: 93  EAERELSARFGIRSIPTIMIFRKGEIVD-MLNGAVPKAPFDSWL 135


>gi|19554281|ref|NP_602283.1| thioredoxin [Corynebacterium glutamicum ATCC 13032]
 gi|62391938|ref|YP_227340.1| thioredoxin [Corynebacterium glutamicum ATCC 13032]
 gi|145297085|ref|YP_001139906.1| hypothetical protein cgR_2981 [Corynebacterium glutamicum R]
 gi|41223085|emb|CAF19030.1| THIOREDOXIN [Corynebacterium glutamicum ATCC 13032]
 gi|140847005|dbj|BAF56004.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V  ++F S V++   PV+VDFWA WC PC KLSPII++IA E  DK  +  +D++ 
Sbjct: 3   NVVAVTEQTFKSTVIDSDKPVIVDFWAEWCGPCKKLSPIIEEIAGEYGDKAVVASVDVDA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
              +   +QI SIP++++FK+G  ++  + G   +++I+E
Sbjct: 63  ERTLGAMFQIMSIPSVLIFKNGAKVEEFV-GLRPKNEIVE 101


>gi|226946749|ref|YP_002801822.1| Thioredoxin 1, trx1 [Azotobacter vinelandii DJ]
 gi|226721676|gb|ACO80847.1| Thioredoxin 1, trx1 [Azotobacter vinelandii DJ]
          Length = 108

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+ +VL+   PV+VD+WA WC PC  ++P++++IA +   ++KI KL+I+E+  
Sbjct: 7   NVSDASFEQDVLQAEGPVLVDYWAEWCGPCKMIAPVLNEIAKDYEGRLKICKLNIDENQG 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +Y +  IPTL+LFK G V +    GA S+S +  ++ S +
Sbjct: 67  TPAKYGVRGIPTLMLFKGGNV-EATKVGALSKSQLAAFLDSNI 108


>gi|168000122|ref|XP_001752765.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162695928|gb|EDQ82269.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 104

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 67/101 (66%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A K    SFD  +     P++VDF+A+WC PC  + PI+ ++++ + DK+++ K+D E+ 
Sbjct: 1   ATKQTFSSFDDMLENSKVPMLVDFYATWCGPCQMMVPILSEVSNIMQDKLRVVKIDTEKY 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            E+++R+ I ++PT++LFK GKV DR + GA    DII+ I
Sbjct: 61  PELASRFNIRALPTMVLFKGGKVADR-IEGALRAEDIIDRI 100


>gi|91224652|ref|ZP_01259913.1| thioredoxin 2 [Vibrio alginolyticus 12G01]
 gi|91190540|gb|EAS76808.1| thioredoxin 2 [Vibrio alginolyticus 12G01]
          Length = 144

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 59/91 (64%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +L+   PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E   +++ ++ I 
Sbjct: 49  SALLQSDMPVVVDFWAPWCNPCVGFAPVFSDVAHEQAGTARFVKIDTEAQQQLAAQFGIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  ++   +W+
Sbjct: 109 SIPTIMVFKNGQRVD-MINGALPKTQFDQWL 138


>gi|85544680|pdb|2FD3|A Chain A, Crystal Structure Of Thioredoxin Mutant P34h
 gi|85544681|pdb|2FD3|B Chain B, Crystal Structure Of Thioredoxin Mutant P34h
          Length = 108

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC  C  ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGHCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|297180046|gb|ADI16271.1| thiol-disulfide isomerase and thioredoxins [uncultured bacterium
          HF0010_16H03]
          Length = 108

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 58/76 (76%)

Query: 9  KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
          ++F+ +VL    PV+VDFWA WC PC +LSP +++IA E  +K+K+ K+D++ + EI+ +
Sbjct: 11 ENFNDDVLNSDKPVLVDFWAEWCGPCKQLSPTVEEIALENQEKLKVCKMDVDSNREIAAK 70

Query: 69 YQISSIPTLILFKDGK 84
          Y I SIP+LI+FK+G+
Sbjct: 71 YGIRSIPSLIIFKNGE 86


>gi|212633328|ref|YP_002309853.1| thioredoxin [Shewanella piezotolerans WP3]
 gi|212554812|gb|ACJ27266.1| Thioredoxin [Shewanella piezotolerans WP3]
          Length = 108

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V+    PV+VDFWA WC PC  ++PI+DD+A+E A K+ + KL++++++    +Y
Sbjct: 12  SFENDVINSELPVLVDFWAEWCGPCKMIAPILDDVAEEYAGKITVAKLNVDQNNVSPAKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTL+LFK G++    + GA S++ + E+I
Sbjct: 72  GVRGIPTLLLFKAGELAATKV-GALSKTQLKEFI 104


>gi|117617736|ref|YP_854623.1| thioredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117559143|gb|ABK36091.1| thioredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 108

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V++    V+VDFWA WC PC  ++PI++++A E A +V + KL+I+ +++   +Y
Sbjct: 12  SFEADVIKADGAVLVDFWAEWCGPCKMIAPILNEVAQEYAGRVTVAKLNIDHNADTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKTQLKEFL 104


>gi|167627498|ref|YP_001677998.1| thioredoxin [Francisella philomiragia subsp. philomiragia ATCC
          25017]
 gi|241668068|ref|ZP_04755646.1| thioredoxin [Francisella philomiragia subsp. philomiragia ATCC
          25015]
 gi|254876603|ref|ZP_05249313.1| thioredoxin [Francisella philomiragia subsp. philomiragia ATCC
          25015]
 gi|167597499|gb|ABZ87497.1| thioredoxin [Francisella philomiragia subsp. philomiragia ATCC
          25017]
 gi|254842624|gb|EET21038.1| thioredoxin [Francisella philomiragia subsp. philomiragia ATCC
          25015]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 55/75 (73%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           F+SEVL    PV++DFWA WC PC  LSPI++ +A+   DKVK+ K++I+++ E + ++
Sbjct: 11 QFESEVLNSDTPVLLDFWAPWCGPCKMLSPILEQVAEHYGDKVKVCKINIDDNEETAMKF 70

Query: 70 QISSIPTLILFKDGK 84
           +  +PTL++FKDG+
Sbjct: 71 GVRGVPTLMVFKDGE 85


>gi|255534910|ref|YP_003095281.1| Thioredoxin [Flavobacteriaceae bacterium 3519-10]
 gi|255341106|gb|ACU07219.1| Thioredoxin [Flavobacteriaceae bacterium 3519-10]
          Length = 105

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A+++  +SF   VL    PV+VDFWA WC PC  L PI+++I+ +   +  + K+D++ +
Sbjct: 2   AIEITDQSFQDTVLNSDKPVLVDFWAVWCGPCRMLGPIVEEISADFEGRAVVGKVDVDNN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            ++S  Y I +IPTL++FK+G+V+D+++ G + +  I E
Sbjct: 62  QQVSVDYGIRNIPTLLIFKNGQVVDKIV-GVAPKETIAE 99


>gi|253579607|ref|ZP_04856876.1| thioredoxin 1 [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849108|gb|EES77069.1| thioredoxin 1 [Ruminococcus sp. 5_1_39BFAA]
          Length = 100

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A ++ T +F++EVL+   PV++DFWA+WC PC++  P+++++A+E      + K+D++++
Sbjct: 2  AKEITTANFETEVLKSEKPVLIDFWATWCGPCMRQGPVVEELAEE---GYAVGKVDVDQN 58

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            ++ ++++ SIPTLILFKDG  + R + G +S+ ++
Sbjct: 59 MALAQQFRVVSIPTLILFKDGAEVKRFV-GLTSKEEL 94


>gi|254436635|ref|ZP_05050129.1| thioredoxin [Octadecabacter antarcticus 307]
 gi|198252081|gb|EDY76395.1| thioredoxin [Octadecabacter antarcticus 307]
          Length = 106

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD EV + + PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATVAVTDDTFDVEVRQSTIPVVVDFWAEWCGPCKQIGPALEELSAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +  +  IP L LFKDG+V+     GA+ ++ +  WI
Sbjct: 61  ENPNAPAQMGVRGIPALFLFKDGEVVSNKT-GAAPKAALQSWI 102


>gi|28199915|ref|NP_780229.1| thioredoxin [Xylella fastidiosa Temecula1]
 gi|182682667|ref|YP_001830827.1| thioredoxin [Xylella fastidiosa M23]
 gi|28058046|gb|AAO29878.1| thioredoxin [Xylella fastidiosa Temecula1]
 gi|182632777|gb|ACB93553.1| thioredoxin [Xylella fastidiosa M23]
 gi|307578948|gb|ADN62917.1| thioredoxin [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 113

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L +   +FD+ VL    PV+VDFWA WC PC  +S ++DD+A     ++KI K+DI+E+ 
Sbjct: 6  LHISDANFDAMVLLSDQPVLVDFWAKWCGPCKIISTLLDDLAQSYEGRLKIAKVDIDENR 65

Query: 64 EISTRYQISSIPTLILFKDGKV 85
           ++ +Y + SIP L+LFKDG+V
Sbjct: 66 ALAIKYHVCSIPMLLLFKDGQV 87


>gi|300714782|ref|YP_003739585.1| Thioredoxin 1 [Erwinia billingiae Eb661]
 gi|299060618|emb|CAX57725.1| Thioredoxin 1 [Erwinia billingiae Eb661]
          Length = 110

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFDS+VL+     +VDFWA WC PC  ++PI+D++A+E   K+ I KL+I+++   + +Y
Sbjct: 13  SFDSDVLKAEGLTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKLNIDDNPGTAPKY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 73  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|289812222|ref|ZP_06542851.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. AG3]
          Length = 108

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (59%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A+E + KV+  K++ 
Sbjct: 2   FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNT 61

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIP +++FK G+V+D M+ GA  ++    W+
Sbjct: 62  EAERELSARFGIRSIPMIMIFKHGQVVD-MLNGAVPKAPFDSWL 104


>gi|195439940|ref|XP_002067817.1| GK12639 [Drosophila willistoni]
 gi|194163902|gb|EDW78803.1| GK12639 [Drosophila willistoni]
          Length = 141

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T+ FD +V     PV+VDF+A+WC PC  L+P I++I  E A  +K+ K+DI+E SE++ 
Sbjct: 38  TEDFDKKVKNSQTPVIVDFFATWCNPCKLLTPRIENIVGEQAGSIKLAKVDIDEHSELAL 97

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            Y ++++P L++ ++GK + RM+ G   +  I  W+ + V
Sbjct: 98  DYDVAAVPVLVVMQNGKELQRMV-GLQDEDKIRAWVAAAV 136


>gi|284993428|ref|YP_003411983.1| thioredoxin [Geodermatophilus obscurus DSM 43160]
 gi|284066674|gb|ADB77612.1| thioredoxin [Geodermatophilus obscurus DSM 43160]
          Length = 108

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   +F  +VL    PV+VDFWA WC PC  ++P++++IA E ADK+ I KL+I+E
Sbjct: 4   NTVTVTDATFADDVLGSDKPVLVDFWAEWCGPCKMVAPVLEEIAAEHADKLTIAKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMM---PGASSQSDIIEWI 103
           + +I+  YQ+ SIPT+ +F+ GK +  ++   P  +  SD+ +++
Sbjct: 64  NPQIARDYQVMSIPTMTVFQGGKPVKSIIGAKPKGAILSDLADYL 108


>gi|152972775|ref|YP_001337921.1| thioredoxin [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206577583|ref|YP_002241151.1| thioredoxin [Klebsiella pneumoniae 342]
 gi|262040903|ref|ZP_06014129.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|288937790|ref|YP_003441849.1| thioredoxin [Klebsiella variicola At-22]
 gi|330012118|ref|ZP_08307280.1| thioredoxin [Klebsiella sp. MS 92-3]
 gi|150957624|gb|ABR79654.1| thioredoxin [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206566641|gb|ACI08417.1| thioredoxin [Klebsiella pneumoniae 342]
 gi|259041792|gb|EEW42837.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|288892499|gb|ADC60817.1| thioredoxin [Klebsiella variicola At-22]
 gi|328533933|gb|EGF60592.1| thioredoxin [Klebsiella sp. MS 92-3]
          Length = 109

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ + KL+I+++   + +Y
Sbjct: 12  SFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQNPGTAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 104


>gi|15602859|ref|NP_245931.1| TrxM [Pasteurella multocida subsp. multocida str. Pm70]
 gi|20140774|sp|Q9CM49|THIO_PASMU RecName: Full=Thioredoxin; Short=Trx
 gi|12721321|gb|AAK03078.1| TrxM [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 106

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L     +F ++V+    PV++DFWA WC PC  +SPI+D+IA E + KVK+ K++I+
Sbjct: 1   MEVLHSTDATFTADVVNSDVPVLLDFWAPWCGPCRMISPILDEIAAEFSGKVKVVKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +  + SIPTL+LFK+GK +   + GA  ++ +  +I
Sbjct: 61  ENQATPAQLGVRSIPTLVLFKNGKAVATQV-GALPKNQLANFI 102


>gi|291549063|emb|CBL25325.1| thioredoxin [Ruminococcus torques L2-14]
          Length = 131

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 73/103 (70%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+ T +F+ EVL+   PV+VDF+A WC PC  ++PI++ +++EL+D VK+  ++I+
Sbjct: 30  MAVVKLTTDNFEQEVLQAQQPVLVDFYADWCGPCKMMAPIVEALSEELSD-VKVCHINID 88

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ +I+ +Y++ SIPT I FK G+   R + GA  ++ +++ +
Sbjct: 89  ENIDIAQKYRVMSIPTFIAFKGGEESGRQI-GAIPKTALVDLV 130


>gi|317475169|ref|ZP_07934436.1| thioredoxin [Bacteroides eggerthii 1_2_48FAA]
 gi|316908622|gb|EFV30309.1| thioredoxin [Bacteroides eggerthii 1_2_48FAA]
          Length = 104

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 63/95 (66%), Gaps = 1/95 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F  E+L    PVV+DFWA WC PC  + PII+++A E   KV I K D++E+
Sbjct: 2  ALEITDNNF-KEILAEGKPVVIDFWAPWCGPCKMVGPIIEELAGEYEGKVLIGKCDVDEN 60

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          S+++  Y I +IPT++ FK+G+++D+ +  A   +
Sbjct: 61 SDVAAEYGIRNIPTVLFFKNGELVDKQVGSAPKPT 95


>gi|331684232|ref|ZP_08384828.1| thioredoxin [Escherichia coli H299]
 gi|331079184|gb|EGI50386.1| thioredoxin [Escherichia coli H299]
          Length = 139

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+ + I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSSHFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 135


>gi|291570870|dbj|BAI93142.1| thioredoxin M [Arthrospira platensis NIES-39]
          Length = 108

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           A+K    +F  E+L+ S  PV+VDF+A+WC PC  ++PI+ ++  E+ +++KI K+D ++
Sbjct: 5   AVKKQFHNF-QELLDGSEVPVLVDFYATWCGPCQMMAPILQEVNQEMKEQIKIVKIDTDK 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
             +I++ YQI ++PTLI FK+G+ +DR   G     ++I+W+  
Sbjct: 64  YPQIASDYQIEALPTLIFFKNGQPVDR-FEGVKRAPELIKWLYG 106


>gi|255630923|gb|ACU15824.1| unknown [Glycine max]
          Length = 175

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           + A K    SFD  +     PV+VDF+A+WC PC  + PI+++++  L DK+++ K+D E
Sbjct: 66  VQAKKQTYNSFDDLLANSEKPVLVDFYATWCGPCQFMVPILNEVSTRLKDKIQVVKIDTE 125

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +   I+ +Y+I ++PT I+FKDG+  DR   GA +   +IE I
Sbjct: 126 KYPSIADKYRIEALPTFIMFKDGEPYDRFE-GALTADQLIERI 167


>gi|225027321|ref|ZP_03716513.1| hypothetical protein EUBHAL_01577 [Eubacterium hallii DSM 3353]
 gi|224955323|gb|EEG36532.1| hypothetical protein EUBHAL_01577 [Eubacterium hallii DSM 3353]
          Length = 101

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 73/103 (70%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F +E+++    V++DFWASWC PC  + PII++IA E  D +K+ K++++
Sbjct: 1   MSAININKNNFQNEIMDSEKTVLLDFWASWCAPCRMVVPIIEEIAGERPD-IKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E+++++ I SIPTL++ K+ K++ + + GA  ++ I+E +
Sbjct: 60  EQPELASKFGIMSIPTLVVMKNRKIVQQ-VSGARPKNAILEML 101


>gi|119713321|gb|ABL97385.1| thioredoxin [uncultured marine bacterium EB80_02D08]
          Length = 108

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 59/78 (75%)

Query: 7  DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
          D ++F+++VL    PV+VDFWA WC PC +L+P + ++A E ++ +K+ K+D++ + EI+
Sbjct: 9  DEENFNNDVLNSEMPVLVDFWAEWCGPCKQLAPTVAEVASEKSETIKVCKMDVDSNREIA 68

Query: 67 TRYQISSIPTLILFKDGK 84
           +Y I SIP+LI+FK+G+
Sbjct: 69 AKYGIRSIPSLIIFKNGE 86


>gi|291295275|ref|YP_003506673.1| thioredoxin [Meiothermus ruber DSM 1279]
 gi|290470234|gb|ADD27653.1| thioredoxin [Meiothermus ruber DSM 1279]
          Length = 141

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 64/94 (68%), Gaps = 2/94 (2%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T+    E L+ S PV+VDFWA WC PC  ++P++++IA E A ++K+ KL+++      +
Sbjct: 44  TQGLTPE-LQASVPVLVDFWAEWCGPCKMIAPVLEEIAREYAGRLKVVKLNVDHHPLAQS 102

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            Y +  IPTLILFK+G+ ++R++ GA+ +  +++
Sbjct: 103 AYHVQGIPTLILFKNGQPVERIV-GAAPKHMLLQ 135


>gi|115352027|ref|YP_773866.1| thioredoxin [Burkholderia ambifaria AMMD]
 gi|115282015|gb|ABI87532.1| thioredoxin [Burkholderia ambifaria AMMD]
          Length = 109

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 69/106 (65%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+     T  F+ +V++   PV+VDFWA WC PC  ++P +++I++EL  K+++ K+DI+
Sbjct: 1   MATRSTTTFDFEDDVIQSKTPVLVDFWAPWCPPCRAIAPSLEEISNELEGKLQVIKVDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRM---MPGASSQSDIIEWI 103
           ++ E++ R+ + SIPTL +F DGKV   +   MP  + Q+ I  ++
Sbjct: 61  QNPELAQRFGVRSIPTLKVFVDGKVAKEIVGAMPKQALQAQIAPFV 106


>gi|284050712|ref|ZP_06380922.1| thioredoxin [Arthrospira platensis str. Paraca]
          Length = 105

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           A+K    +F  E+L+ S  PV+VDF+A+WC PC  ++PI+ ++  E+ +++KI K+D ++
Sbjct: 2   AVKKQFHNF-QELLDGSEVPVLVDFYATWCGPCQMMAPILQEVNQEMKEQIKIVKIDTDK 60

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
             +I++ YQI ++PTLI FK+G+ +DR   G     ++I+W+  
Sbjct: 61  YPQIASDYQIEALPTLIFFKNGQPVDR-FEGVKRAPELIKWLYG 103


>gi|161527718|ref|YP_001581544.1| thioredoxin [Nitrosopumilus maritimus SCM1]
 gi|160339019|gb|ABX12106.1| thioredoxin [Nitrosopumilus maritimus SCM1]
          Length = 108

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 63/91 (69%)

Query: 7  DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
          D KS++ +V+    PV VDFWA WC PC  + P+++++A +   KVK  K++++E++E++
Sbjct: 8  DAKSWEVDVINSDLPVFVDFWAEWCGPCRMVGPVVEELASDYDGKVKFVKVNVDEANELA 67

Query: 67 TRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          ++Y + SIPTLIL   G+++ + +  AS +S
Sbjct: 68 SKYNVFSIPTLILLNKGEIVSQQVGAASKES 98


>gi|254467229|ref|ZP_05080640.1| thioredoxin [Rhodobacterales bacterium Y4I]
 gi|206688137|gb|EDZ48619.1| thioredoxin [Rhodobacterales bacterium Y4I]
          Length = 106

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 62/103 (60%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A E   KVKI K+D++
Sbjct: 1   MSTVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELAVEFDGKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    +  IP L +FKDG+VI     GA+ ++ +  WI
Sbjct: 61  SNPNAAAAMGVRGIPALFIFKDGQVISNRA-GAAPKAALQSWI 102


>gi|108762690|ref|YP_630871.1| thioredoxin [Myxococcus xanthus DK 1622]
 gi|108466570|gb|ABF91755.1| thioredoxin [Myxococcus xanthus DK 1622]
          Length = 110

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 63/93 (67%), Gaps = 1/93 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F  +VL+   PV+VDFWA+WC PC  ++P I+ +A +   +VK  KL+I+E+ +    Y 
Sbjct: 14  FKQQVLDSQEPVLVDFWATWCAPCRAIAPSIEALASQYKGQVKFAKLNIDENQDTPQEYG 73

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I SIPTL+LFK G+V+++++ GA  ++ I E +
Sbjct: 74  IRSIPTLLLFKGGRVVEQIV-GAVPKARIEEAV 105


>gi|16761507|ref|NP_457124.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29140796|ref|NP_804138.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|213026637|ref|ZP_03341084.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. 404ty]
 gi|213161474|ref|ZP_03347184.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213417426|ref|ZP_03350568.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
 gi|213425262|ref|ZP_03358012.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213583758|ref|ZP_03365584.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
 gi|213615730|ref|ZP_03371556.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|213646340|ref|ZP_03376393.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|213861078|ref|ZP_03385782.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
 gi|289825484|ref|ZP_06544691.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|25282764|pir||AB0831 thioredoxin 2 [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16503808|emb|CAD05833.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29136421|gb|AAO67987.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 139

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (59%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A+E + KV+  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S R+ I SIP +++FK G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSARFGIRSIPMIMIFKHGQVVD-MLNGAVPKAPFDSWL 135


>gi|320158675|ref|YP_004191053.1| thioredoxin 2 [Vibrio vulnificus MO6-24/O]
 gi|319933987|gb|ADV88850.1| thioredoxin 2 [Vibrio vulnificus MO6-24/O]
          Length = 144

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           + +L+   PVVVDFWA WC PCV  +P+  D+A E   KV+  K++ E   +++ ++QI 
Sbjct: 49  AHLLQSEQPVVVDFWAPWCNPCVGFAPVFQDVAAERKGKVRFIKINTEIEQQLAAQFQIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D ++ GA  +S   +W+
Sbjct: 109 SIPTVMVFKNGQRVD-VINGALPKSQFDQWL 138


>gi|297625172|ref|YP_003706606.1| thioredoxin [Truepera radiovictrix DSM 17093]
 gi|297166352|gb|ADI16063.1| thioredoxin [Truepera radiovictrix DSM 17093]
          Length = 139

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 65/92 (70%), Gaps = 2/92 (2%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF +E LE   PV+VDFWA WC PC  ++P+++++A E A K+K+ KL+++E+ + + RY
Sbjct: 43  SFAAE-LEAPVPVLVDFWAPWCGPCRMVAPVVEELAREQAGKLKVVKLNVDENPQTAGRY 101

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           ++ SIP L LF+DG+ +  ++ GA  +  +++
Sbjct: 102 RVQSIPMLTLFRDGQALTTVV-GALPKGALLQ 132


>gi|225574123|ref|ZP_03782734.1| hypothetical protein RUMHYD_02188 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038674|gb|EEG48920.1| hypothetical protein RUMHYD_02188 [Blautia hydrogenotrophica DSM
           10507]
          Length = 110

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + +   +F  EV+    PV++DFWA WC PC +++PII++I++E +D +K+ K++++
Sbjct: 1   MSIINIHKSNFQREVMNSDKPVLLDFWAPWCGPCRRVTPIIEEISNERSD-IKVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++  + I SIPTL+  K+G+V+ + + GA  ++ I+E +
Sbjct: 60  EEPELAGEFGIMSIPTLVTVKNGQVVGQTV-GARPKNMILEML 101


>gi|116784111|gb|ABK23218.1| unknown [Picea sitchensis]
 gi|116791789|gb|ABK26109.1| unknown [Picea sitchensis]
 gi|116792223|gb|ABK26280.1| unknown [Picea sitchensis]
          Length = 191

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 68/98 (69%), Gaps = 1/98 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL+V+  ++   VLE + PV+VDFWA WC PC  ++P+ID++A + A K+   KL+ +ES
Sbjct: 85  ALEVNDSTWQKLVLESNIPVLVDFWAPWCGPCRMIAPLIDELAKQYAGKIMCLKLNTDES 144

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
             I+T Y I SIPT+++FK+G+  D ++ GA  ++ +I
Sbjct: 145 PNIATEYGIRSIPTVMVFKNGEKKDTVI-GAVPKTTLI 181


>gi|262204652|ref|YP_003275860.1| thioredoxin [Gordonia bronchialis DSM 43247]
 gi|262087999|gb|ACY23967.1| thioredoxin [Gordonia bronchialis DSM 43247]
          Length = 112

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 59/83 (71%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          + + V+  +F   VL    PV+VDFWA+WC PC  ++P++++IA + ADK+ I KLD++E
Sbjct: 4  NTVAVNDTTFKDTVLGSDKPVLVDFWATWCGPCRMVAPVLEEIAGDHADKLTIAKLDVDE 63

Query: 62 SSEISTRYQISSIPTLILFKDGK 84
          S   +  +QI SIPT+ILF++G+
Sbjct: 64 SPATARDFQIMSIPTMILFENGQ 86


>gi|206889683|ref|YP_002249716.1| thioredoxin [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741621|gb|ACI20678.1| thioredoxin [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 110

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 62/87 (71%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          +++ +  +++EVL     ++VDFWA WC PC  ++P I+++A E   K+K+ KL+ +E+ 
Sbjct: 6  VELTSSKWETEVLNSKGVIMVDFWAPWCGPCRIIAPTIEELAKEYEGKIKVGKLNTDENP 65

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMM 90
          EI+TRY I  IPT++ FKDG+ +D+++
Sbjct: 66 EIATRYGIMGIPTIMFFKDGQRVDQIV 92


>gi|262395383|ref|YP_003287236.1| thioredoxin 2 [Vibrio sp. Ex25]
 gi|262338977|gb|ACY52771.1| thioredoxin 2 [Vibrio sp. Ex25]
          Length = 144

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 58/91 (63%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           S +L+   PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E    ++ ++ I 
Sbjct: 49  SVLLQSDTPVVVDFWAPWCNPCVGFAPVFSDVAHEQAGTARFVKIDTEAQQALAAQFGIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D M+ GA  +S   +W+
Sbjct: 109 SIPTIMVFKNGQRVD-MINGALPKSQFDQWL 138


>gi|16331825|ref|NP_442553.1| thioredoxin [Synechocystis sp. PCC 6803]
 gi|1729952|sp|P52231|THIO_SYNY3 RecName: Full=Thioredoxin; Short=Trx
 gi|515940|emb|CAA56653.1| thioredoxin [Synechocystis sp. PCC 6803]
 gi|1208455|dbj|BAA10623.1| thioredoxin [Synechocystis sp. PCC 6803]
          Length = 107

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%), Gaps = 2/100 (2%)

Query: 1  MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
          MSA  +V   SF  +VL+   PV+VDFWA WC PC  ++P++D+I+ +   KVK+ KL+ 
Sbjct: 1  MSATPQVSDASFKEDVLDSELPVLVDFWAPWCGPCRMVAPVVDEISQQYEGKVKVVKLNT 60

Query: 60 EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          +E+   +++Y I SIPTL++FK G+ +D M+ GA  ++ +
Sbjct: 61 DENPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTL 99


>gi|218690699|ref|YP_002398911.1| thioredoxin 2 [Escherichia coli ED1a]
 gi|331658727|ref|ZP_08359671.1| thioredoxin [Escherichia coli TA206]
 gi|218428263|emb|CAR09039.1| thioredoxin 2 [Escherichia coli ED1a]
 gi|315300562|gb|EFU59791.1| thioredoxin [Escherichia coli MS 16-3]
 gi|331054392|gb|EGI26419.1| thioredoxin [Escherichia coli TA206]
          Length = 139

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E + K +  K++ 
Sbjct: 33  FDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKGRFVKVNT 92

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E   E+S+R+ I SIPT+++FK+G+V+D M+ GA  ++    W+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQVVD-MLNGAVPKAPFDSWL 135


>gi|113476942|ref|YP_723003.1| thioredoxin [Trichodesmium erythraeum IMS101]
 gi|110167990|gb|ABG52530.1| thioredoxin [Trichodesmium erythraeum IMS101]
          Length = 107

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 62/87 (71%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A+K    +FD  +     PV+VDF+A+WC PC  ++PI++ +  ++ DK++I K+D ++ 
Sbjct: 2  AIKKKFNNFDELLAGSDLPVLVDFYATWCGPCKMMTPILEQVNQQIKDKLRIVKIDTDKY 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRM 89
           ++++RY I S+PTL+LFK+G+ +DR+
Sbjct: 62 PQLASRYHIESLPTLVLFKNGQPVDRI 88


>gi|262089570|gb|ACY24669.1| thioredoxin family protein [uncultured organism]
          Length = 146

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 57/102 (55%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           +D  SFD  +     P++VDFWA WC PC  ++P     A  L  KV++ K+D E    +
Sbjct: 44  LDEASFDKHLKRSQIPLLVDFWAPWCGPCQAMAPAYVQAAGLLEPKVRLAKVDTEAHQAL 103

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             R+QI SIPTL LF  G+ + R   GA +  DI  W+ S++
Sbjct: 104 GARFQIRSIPTLALFVGGREVARQA-GAMAAGDIARWVQSKL 144


>gi|294084827|ref|YP_003551587.1| thioredoxin [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664402|gb|ADE39503.1| thioredoxin [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 106

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  K     F ++VL+   PV+VDFWA WC PC  + P +++I+++  D + I KL+I+
Sbjct: 1   MATTKTTDSDFSTQVLQSDKPVLVDFWAEWCGPCKAIGPALEEISEDKGDSLSIVKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+     +Y +  IPTL++FKDG V+   + GA  +S +  WI
Sbjct: 61  ENPLTPQQYNVRGIPTLLIFKDGAVVAEKV-GALPKSQLENWI 102


>gi|21232053|ref|NP_637970.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66767821|ref|YP_242583.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|188990935|ref|YP_001902945.1| thioredoxin [Xanthomonas campestris pv. campestris str. B100]
 gi|21113794|gb|AAM41894.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66573153|gb|AAY48563.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|167732695|emb|CAP50889.1| thioredoxin [Xanthomonas campestris pv. campestris]
          Length = 285

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 67/100 (67%), Gaps = 3/100 (3%)

Query: 6   VDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           V T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A +     ++ K+D+++  
Sbjct: 10  VTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAADYNGAFELAKVDVDKEQ 69

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I+  +QI S+PT+ L K G+++D   PGA  +  I E++
Sbjct: 70  QIAAAFQIRSVPTVFLVKGGELVD-GFPGAMPEGQIREFL 108


>gi|237738861|ref|ZP_04569342.1| thioredoxin [Fusobacterium sp. 2_1_31]
 gi|229423964|gb|EEO39011.1| thioredoxin [Fusobacterium sp. 2_1_31]
          Length = 103

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 65/88 (73%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +K    +F++EVL+    VVVDF A+WC PC  L PI+D++ +E  +K KI K+DI+
Sbjct: 1  MAIIKGTKDNFEAEVLKAEGIVVVDFGANWCGPCKSLVPILDEVVEEDPNK-KIVKVDID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  E++ +Y+I S+PTL++F++G++ID+
Sbjct: 60 EEEELAAQYKIMSVPTLLVFRNGEIIDK 87


>gi|293331527|ref|NP_001168881.1| hypothetical protein LOC100382686 [Zea mays]
 gi|223973467|gb|ACN30921.1| unknown [Zea mays]
          Length = 167

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 70/107 (65%), Gaps = 6/107 (5%)

Query: 2   SALKVDTK-----SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITK 56
           + L+V+ K     SFD  + +   P++VDF+A+WC PC  + PI+ +++++L DK+++ K
Sbjct: 54  ATLRVEAKKQTFSSFDELLEKSEKPLLVDFYATWCGPCQYMVPILQEVSEKLGDKIQVVK 113

Query: 57  LDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +D E+ + I++RY+I ++PT I+FKDGK   R   GA     +IE I
Sbjct: 114 IDTEKYTSIASRYRIEALPTFIIFKDGKPCYRFE-GALPVDQMIEQI 159


>gi|145301125|ref|YP_001143966.1| thioredoxin [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853897|gb|ABO92218.1| thioredoxin [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 108

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V++    V+VDFWA WC PC  ++PI++++A E A +V + KL+I+ +++   +Y
Sbjct: 12  SFEADVIKADGAVLVDFWAEWCGPCKMIAPILNEVAQEYAGRVTVAKLNIDHNADTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKNGEVAATKV-GALSKTQLKEFL 104


>gi|285019242|ref|YP_003376953.1| thioredoxin domain-containing protein [Xanthomonas albilineans GPE
           PC73]
 gi|283474460|emb|CBA16961.1| putative thioredoxin domain-containing protein [Xanthomonas
           albilineans]
          Length = 288

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 67/98 (68%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T++F++EVL+ S   PV+VDFWASWC PC  L+P+++ +A E      + K+++++  +I
Sbjct: 12  TETFETEVLQHSMQTPVLVDFWASWCGPCKALTPLLEKLATEYNGGFVLAKVNVDQEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L KDG+++D   PGA  ++ +  ++
Sbjct: 72  AAAFQIRSVPTVFLVKDGQLVD-GFPGALPENQLRAFL 108


>gi|88801398|ref|ZP_01116926.1| thioredoxin M [Polaribacter irgensii 23-P]
 gi|88782056|gb|EAR13233.1| thioredoxin M [Polaribacter irgensii 23-P]
          Length = 105

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 61/88 (69%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F+  VL+   PV+VDFWA+WC PC  + PI+D+I  E   K  + K+D++ +
Sbjct: 2  ALEITDANFEELVLKSDKPVLVDFWAAWCGPCRMVGPIVDEIYTEYDGKAVVGKVDVDAN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMM 90
           E + +Y + +IPT+++FK+G+V+D+ +
Sbjct: 62 QEFAAKYGVRNIPTVLIFKNGEVVDKQV 89


>gi|319442207|ref|ZP_07991363.1| thioredoxin [Corynebacterium variabile DSM 44702]
          Length = 107

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 57/84 (67%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A+ V   SF S V++   PV+VDFWASWC PC ++ P++ DIA+E   +  + K+++EE 
Sbjct: 4  AVTVTQDSFRSSVIDADQPVIVDFWASWCGPCKQMEPVLRDIAEEYDGRATVAKVNVEEE 63

Query: 63 SEISTRYQISSIPTLILFKDGKVI 86
            +++ YQI SIP L++F +GK +
Sbjct: 64 RLLASMYQIMSIPALLVFNEGKKV 87


>gi|331002703|ref|ZP_08326218.1| thioredoxin [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330407116|gb|EGG86620.1| thioredoxin [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 102

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 63/88 (71%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+   + +++F+SEVL    PV+VD WA WC PC  LSPI+D++A+E A    + K++ +
Sbjct: 1  MAVKTITSENFESEVLNAKEPVLVDIWAPWCGPCKMLSPIVDEVAEE-AVGFSVAKINAD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E+ E+  ++ + SIPTL++FK+G+V+++
Sbjct: 60 ENPELVNKFHVMSIPTLLVFKNGEVVNK 87


>gi|326424222|ref|NP_762319.2| thioredoxin [Vibrio vulnificus CMCP6]
 gi|319999607|gb|AAO07309.2| thioredoxin [Vibrio vulnificus CMCP6]
          Length = 144

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           + +L+   PVVVDFWA WC PCV  +P+  D+A E   KV+  K++ E   +++ ++QI 
Sbjct: 49  THLLQSDQPVVVDFWAPWCNPCVGFAPVFQDVAAERKGKVRFIKINTEIEQQLAAQFQIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D ++ GA  +S   +W+
Sbjct: 109 SIPTVMVFKNGQRVD-VINGALPKSQFDQWL 138


>gi|307103142|gb|EFN51405.1| hypothetical protein CHLNCDRAFT_33111 [Chlorella variabilis]
          Length = 164

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
            A  V   +++  VL+   PV+VDFWA WC PC  ++P++D+IA E  DK++  KL+ +E
Sbjct: 59  GAGPVTDSTWEELVLKSPVPVLVDFWAPWCGPCRMIAPLVDEIAAEYGDKLRTLKLNTDE 118

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           S  ++T Y I SIPT+++FK+G+ +D ++ GA  +  +++
Sbjct: 119 SPNVATEYGIRSIPTVMVFKNGQKMDAVI-GAVPKGTLVQ 157


>gi|124266476|ref|YP_001020480.1| thioredoxin 1 [Methylibium petroleiphilum PM1]
 gi|124259251|gb|ABM94245.1| thioredoxin 1 [Methylibium petroleiphilum PM1]
          Length = 109

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SFD +VL+   PV+VD+WA WC PC  ++PI+D++A +   K++I K++++E+ +
Sbjct: 8   HVSDASFDDDVLKSGTPVLVDYWAEWCGPCKMIAPILDEVAKDYGSKLQIAKMNVDENRD 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  ++ I  IPTL+LFK G++    + GA ++S +  ++
Sbjct: 68  VPAKFGIRGIPTLMLFKGGQLAATKV-GALNKSQLTAFL 105


>gi|85711916|ref|ZP_01042971.1| Thioredoxin [Idiomarina baltica OS145]
 gi|85694313|gb|EAQ32256.1| Thioredoxin [Idiomarina baltica OS145]
          Length = 108

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+++V+    PV+VDFWA WC PC  ++PI+DDI+ +   ++ I KL+++ + +   +Y
Sbjct: 12  SFEADVINSDKPVLVDFWAEWCGPCKMIAPILDDISKDYEGRLTIGKLNVDHNDQTPPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V+   + GA S++ + E++
Sbjct: 72  GIRGIPTLLLFKNGEVVATKV-GALSRAQLTEFL 104


>gi|332160629|ref|YP_004297206.1| thioredoxin 2 [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325664859|gb|ADZ41503.1| thioredoxin 2 [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 146

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 57/83 (68%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVV+DFWASWC PC   +PI  ++A E   KV+  K++ E    +STR++I SIPT++L+
Sbjct: 54  PVVIDFWASWCGPCRSFAPIFTEVAAERTGKVRFVKVNTEAEPALSTRFRIRSIPTIMLY 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           ++GK++D M+ GA  ++    W+
Sbjct: 114 RNGKMVD-MLSGALPKAAFDNWL 135


>gi|1351239|sp|P48384|TRXM_PEA RecName: Full=Thioredoxin M-type, chloroplastic; Short=Trx-M;
           Flags: Precursor
 gi|431957|emb|CAA53900.1| thioredoxin m [Pisum sativum]
          Length = 172

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 64/96 (66%), Gaps = 1/96 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  S+D  V+    PV+VDFWA WC PC  ++PIID++A E A K+K  KL+ +ES   
Sbjct: 72  VNDSSWDELVIGSETPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNTDESPNT 131

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +T+Y I SIPT++ FK+G+  D ++ GA  ++ + E
Sbjct: 132 ATKYGIRSIPTVLFFKNGERKDSVI-GAVPKATLSE 166


>gi|295695287|ref|YP_003588525.1| thioredoxin [Bacillus tusciae DSM 2912]
 gi|295410889|gb|ADG05381.1| thioredoxin [Bacillus tusciae DSM 2912]
          Length = 106

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 62/86 (72%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
          +V   +F S V + + PV+VDFWA WC PC  L+P++D++  E A K++I +L+++++  
Sbjct: 4  EVTDATFASRVEQVAGPVLVDFWAPWCGPCRMLAPVLDELEKEWAGKLEIYRLNVDDNPS 63

Query: 65 ISTRYQISSIPTLILFKDGKVIDRMM 90
           + R+ I SIPTL+LFK+G+V+ +++
Sbjct: 64 TAGRFGIMSIPTLLLFKNGQVVQQVI 89


>gi|291615698|ref|YP_003518440.1| TrxA [Pantoea ananatis LMG 20103]
 gi|291150728|gb|ADD75312.1| TrxA [Pantoea ananatis LMG 20103]
 gi|327395963|dbj|BAK13385.1| thioredoxin 1 TrxA [Pantoea ananatis AJ13355]
          Length = 110

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++PI+D++A+E   K+ I KL+I+++   + +Y
Sbjct: 13  SFDTDVLKADGVILVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKLNIDDNPGTAPKY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 73  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|66043570|ref|YP_233411.1| thioredoxin [Pseudomonas syringae pv. syringae B728a]
 gi|63254277|gb|AAY35373.1| Thioredoxin [Pseudomonas syringae pv. syringae B728a]
 gi|330971842|gb|EGH71908.1| thioredoxin [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 116

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +FD+EVLE   PV+VD+WA WC PC  ++P++D+IA     ++ + KL+I+++ +
Sbjct: 8   HVTDGTFDAEVLEAQGPVLVDYWAEWCGPCKMIAPVLDEIASTYKGRLTVAKLNIDQNPD 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFK G V +    GA S+S +  ++
Sbjct: 68  TPAKHGVRGIPTLMLFKGGNV-EATKVGALSKSQLTAFL 105


>gi|326329113|ref|ZP_08195442.1| thioredoxin [Nocardioidaceae bacterium Broad-1]
 gi|325953195|gb|EGD45206.1| thioredoxin [Nocardioidaceae bacterium Broad-1]
          Length = 109

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 66/91 (72%), Gaps = 1/91 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           FDS VL+   PV+VDFWA WC PC ++SPI++++A E  DKV  TK++++E+    + Y+
Sbjct: 13  FDSTVLKSDKPVLVDFWAEWCGPCRQVSPILEELAGEHGDKVTFTKMNVDENPVTPSNYR 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           ++ IPT+ ++++G+V+  ++ GA  ++ +++
Sbjct: 73  VTGIPTINVYQNGEVVKSIV-GAKPKAALLK 102


>gi|227873742|ref|ZP_03991972.1| thioredoxin [Oribacterium sinus F0268]
 gi|227840422|gb|EEJ50822.1| thioredoxin [Oribacterium sinus F0268]
          Length = 104

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (64%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MSA  +    F+ +VL+   PV+VDFWA WC PC  LSPII +IA E A   K+  ++ +
Sbjct: 3  MSAPNITAAEFEEKVLQSKEPVLVDFWADWCGPCKMLSPIIGEIAAE-AQGFKVYAVNAD 61

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E  ++  RY + +IPTLI+FKDG+V  +
Sbjct: 62 EEQDLMARYGVRAIPTLIVFKDGQVYKQ 89


>gi|10120659|pdb|1F6M|C Chain C, Crystal Structure Of A Complex Between Thioredoxin
           Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+
 gi|10120661|pdb|1F6M|D Chain D, Crystal Structure Of A Complex Between Thioredoxin
           Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+
 gi|10120662|pdb|1F6M|G Chain G, Crystal Structure Of A Complex Between Thioredoxin
           Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+
 gi|10120663|pdb|1F6M|H Chain H, Crystal Structure Of A Complex Between Thioredoxin
           Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+
          Length = 108

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC P   ++PI+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPSKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|330862874|emb|CBX73012.1| thioredoxin-2 [Yersinia enterocolitica W22703]
          Length = 138

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 57/83 (68%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVV+DFWASWC PC   +PI  ++A E   KV+  K++ E    +STR++I SIPT++L+
Sbjct: 46  PVVIDFWASWCGPCRSFAPIFTEVAAERTGKVRFVKVNTEAEPALSTRFRIRSIPTIMLY 105

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           ++GK++D M+ GA  ++    W+
Sbjct: 106 RNGKMVD-MLSGALPKAAFDNWL 127


>gi|297193305|ref|ZP_06910703.1| thioredoxin [Streptomyces pristinaespiralis ATCC 25486]
 gi|297151730|gb|EDY62286.2| thioredoxin [Streptomyces pristinaespiralis ATCC 25486]
          Length = 175

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 69/100 (69%), Gaps = 2/100 (2%)

Query: 2   SALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
            ALK V   SF+ EVL+   PV+VDFWA+WC PC +++P ++ IA E  DK+++ KL+I+
Sbjct: 68  GALKNVTDDSFEEEVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHGDKIQVVKLNID 127

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           E+   + +Y + SIPTL ++++G+V   ++ GA  ++ I+
Sbjct: 128 ENPATAAKYGVMSIPTLNVYQNGEVAKTIV-GAKPKAAIV 166


>gi|254384784|ref|ZP_05000121.1| thioredoxin [Streptomyces sp. Mg1]
 gi|194343666|gb|EDX24632.1| thioredoxin [Streptomyces sp. Mg1]
          Length = 113

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 63/90 (70%), Gaps = 1/90 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           FD+EVL    PV+VDFWA+WC PC +++P ++ IA E  D+++I KL+I+E+   + RY 
Sbjct: 13  FDTEVLASDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDQIEIVKLNIDENPATAARYG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           + SIPTL +++ G+V   ++ GA  ++ I+
Sbjct: 73  VMSIPTLNVYQGGEVAKTIV-GAKPKAAIL 101


>gi|1388088|gb|AAC49358.1| thioredoxin m [Pisum sativum]
          Length = 172

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 64/96 (66%), Gaps = 1/96 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  S+D  V+    PV+VDFWA WC PC  ++PIID++A E A K+K  KL+ +ES   
Sbjct: 72  VNDSSWDELVIGSETPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNTDESPNT 131

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +T+Y I SIPT++ FK+G+  D ++ GA  ++ + E
Sbjct: 132 ATKYGIRSIPTVLFFKNGERKDSVI-GAVPKATLSE 166


>gi|182419213|ref|ZP_02950466.1| thioredoxin [Clostridium butyricum 5521]
 gi|237667308|ref|ZP_04527292.1| thioredoxin [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182376853|gb|EDT74424.1| thioredoxin [Clostridium butyricum 5521]
 gi|237655656|gb|EEP53212.1| thioredoxin [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 102

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 62/85 (72%), Gaps = 2/85 (2%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          V++  F +E+ E    V+VDF+A+WC PC  L P+++D+  EL  K KI K+DI++S ++
Sbjct: 4  VNSNEFRNEISE--GVVLVDFFATWCGPCKMLGPVLEDLGKELEGKAKIIKVDIDQSGDL 61

Query: 66 STRYQISSIPTLILFKDGKVIDRMM 90
          +  ++ISS+PT+ILFKD K++D M+
Sbjct: 62 ADEFRISSVPTMILFKDNKIVDTMV 86


>gi|145630610|ref|ZP_01786389.1| thioredoxin [Haemophilus influenzae R3021]
 gi|144983736|gb|EDJ91186.1| thioredoxin [Haemophilus influenzae R3021]
          Length = 107

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L ++   F+S V+  + PV++DFWA WC PC  ++P++D++A E A KVKI K++++++ 
Sbjct: 5   LHINDADFESVVVNSNIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNVDDNQ 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               ++ + SIPTL+L K+G+V+   + GA +++ +  +I   +
Sbjct: 65  ATPAQFGVRSIPTLLLIKNGQVVATQV-GALAKTQLANFINQHI 107


>gi|116749143|ref|YP_845830.1| thioredoxin [Syntrophobacter fumaroxidans MPOB]
 gi|116698207|gb|ABK17395.1| thioredoxin [Syntrophobacter fumaroxidans MPOB]
          Length = 110

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++V   SFD EVL+   PV+VDFWA WC PC  ++P+I++++ +   ++K+ K +++++ 
Sbjct: 7   IEVTDGSFDQEVLQSDVPVLVDFWAPWCGPCRAIAPVIEELSGDYEARLKVAKCNVDDNP 66

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +RY I +IPTLI+FK G V +++  GA ++S I   I
Sbjct: 67  KTPSRYGIRAIPTLIIFKGGNVSEQIT-GAVAKSQITAAI 105


>gi|115375480|ref|ZP_01462740.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|310821368|ref|YP_003953726.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|115367523|gb|EAU66498.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|309394440|gb|ADO71899.1| Thioredoxin [Stigmatella aurantiaca DW4/3-1]
          Length = 108

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++V    F  EVLE   PV++DF A+WC PC  L+PI++ +A E   ++K+T LD++   
Sbjct: 6   IEVGDAEFQREVLESQQPVLMDFTAAWCPPCRFLTPIMEALATEHHGRLKVTTLDVDAHQ 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E +  Y I S+PTL+LFK+GKV+ + + GA  ++ + E
Sbjct: 66  ETARMYGIRSLPTLLLFKEGKVV-KQITGAVQKAKLDE 102


>gi|312796074|ref|YP_004028996.1| Thioredoxin [Burkholderia rhizoxinica HKI 454]
 gi|312167849|emb|CBW74852.1| Thioredoxin [Burkholderia rhizoxinica HKI 454]
          Length = 108

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +VL+   PV++DFWA WC PC  ++P++D++A +  D++++ K+D++++     ++
Sbjct: 12  SFEQDVLKADKPVLLDFWAEWCGPCKMIAPLLDEVARDYGDRLQVAKIDVDQNPSTPAKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTLILFK+G V+ +   GA S++ I   I S +
Sbjct: 72  SVRGIPTLILFKNG-VVAQTKVGALSKAQITALIDSHI 108


>gi|172037304|ref|YP_001803805.1| thioredoxin M [Cyanothece sp. ATCC 51142]
 gi|171698758|gb|ACB51739.1| thioredoxin M [Cyanothece sp. ATCC 51142]
          Length = 105

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           ALK    SF+  +   + PV+VDF+A+WC PC  +SPI++ +  ++ +++++ K+D ++ 
Sbjct: 2   ALKKQFSSFEEMLSTSTVPVLVDFYATWCGPCQMMSPILEQVGTQMRNRLQVVKIDTDKY 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             I+++Y I S+PTL+LFK G+ ++R + GA   S +I+ +
Sbjct: 62  PGIASKYGIQSLPTLVLFKKGEPVER-LEGAMQASQLIQHL 101


>gi|123443446|ref|YP_001007419.1| thioredoxin 2 [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122090407|emb|CAL13275.1| thioredoxin 2 [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 146

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 57/83 (68%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           PVV+DFWA WC PC   +PI  ++A E A KV+  K++ E    +STR++I SIPT++L+
Sbjct: 54  PVVIDFWAPWCGPCRSFAPIFTEVAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLY 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           ++GK++D M+ GA  ++    W+
Sbjct: 114 RNGKMVD-MLSGALPKAAFDNWL 135


>gi|160891289|ref|ZP_02072292.1| hypothetical protein BACUNI_03738 [Bacteroides uniformis ATCC 8492]
 gi|270294535|ref|ZP_06200737.1| thioredoxin [Bacteroides sp. D20]
 gi|317481160|ref|ZP_07940235.1| thioredoxin [Bacteroides sp. 4_1_36]
 gi|156859510|gb|EDO52941.1| hypothetical protein BACUNI_03738 [Bacteroides uniformis ATCC 8492]
 gi|270276002|gb|EFA21862.1| thioredoxin [Bacteroides sp. D20]
 gi|316902656|gb|EFV24535.1| thioredoxin [Bacteroides sp. 4_1_36]
          Length = 104

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F  E+L    PVV+DFWA WC PC  + PIID++A E   KV I K D++E+
Sbjct: 2   ALEITDSNF-QEILAEGKPVVMDFWAPWCGPCKMVGPIIDELATEYEGKVIIGKCDVDEN 60

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI--IEWIL 104
            +++  Y I +IPT++ FK+G+++D+ +  A   + +  IE IL
Sbjct: 61  GDVAAEYGIRNIPTVLFFKNGELVDKQVGSAPKSAYVAKIEAIL 104


>gi|319790444|ref|YP_004152077.1| thioredoxin [Thermovibrio ammonificans HB-1]
 gi|317114946|gb|ADU97436.1| thioredoxin [Thermovibrio ammonificans HB-1]
          Length = 108

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 55/80 (68%)

Query: 8  TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           + F+ EVL+   PV+VDFWA WC PC  L+P ID++A E A KVK+ K++ +E   ++ 
Sbjct: 8  VEEFEREVLQSDIPVLVDFWAPWCGPCRMLAPTIDELAQEYAGKVKVVKVNTDELPMVAM 67

Query: 68 RYQISSIPTLILFKDGKVID 87
          +Y I  IPT+ILF +G+V D
Sbjct: 68 QYGIRGIPTVILFVNGEVAD 87


>gi|186475715|ref|YP_001857185.1| thioredoxin [Burkholderia phymatum STM815]
 gi|184192174|gb|ACC70139.1| thioredoxin [Burkholderia phymatum STM815]
          Length = 108

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +V++   PV++DFWA WC PC  ++PI+D++A + AD+++I K++++E      ++
Sbjct: 12  SFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQIAKINVDEHQSTPVKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTLILFK+G V  + + GA S+S +  ++
Sbjct: 72  GVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFL 104


>gi|32477354|ref|NP_870348.1| thioredoxin 1 [Rhodopirellula baltica SH 1]
 gi|32447905|emb|CAD77425.1| thioredoxin 1 [Rhodopirellula baltica SH 1]
 gi|327537346|gb|EGF24079.1| Thioredoxin [Rhodopirellula baltica WH47]
          Length = 108

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 62/81 (76%), Gaps = 1/81 (1%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +FDSEVL+  +PV+VDFWA WC PC +++P+ID++A E    VKI K++I+++   + ++
Sbjct: 13 NFDSEVLKSDSPVLVDFWAPWCGPCRQIAPMIDELASE-NPGVKIGKVNIDDNPGAAQKF 71

Query: 70 QISSIPTLILFKDGKVIDRMM 90
           I+SIPTL+LFK+G++ D  +
Sbjct: 72 GINSIPTLLLFKNGEIADTFV 92


>gi|37676567|ref|NP_936963.1| thioredoxin 2 [Vibrio vulnificus YJ016]
 gi|37201109|dbj|BAC96933.1| thiol-disulfide isomerase and thioredoxins [Vibrio vulnificus
           YJ016]
          Length = 144

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 13  SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           + +L+   PVVVDFWA WC PCV  +P+  D+A E   KV+  K++ E   +++ ++QI 
Sbjct: 49  AHLLQSDQPVVVDFWAPWCNPCVGFAPVFQDVAAERKGKVRFIKINTEIEQQLAAQFQIR 108

Query: 73  SIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           SIPT+++FK+G+ +D ++ GA  +S   +W+
Sbjct: 109 SIPTVMVFKNGQRVD-VINGALPKSQFDQWL 138


>gi|268678813|ref|YP_003303244.1| thioredoxin [Sulfurospirillum deleyianum DSM 6946]
 gi|268616844|gb|ACZ11209.1| thioredoxin [Sulfurospirillum deleyianum DSM 6946]
          Length = 105

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 65/93 (69%), Gaps = 2/93 (2%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L+++  +FDS V E     +VDFWA WC PC  ++P+I+++A++   K KI K++ +E  
Sbjct: 5  LELNASNFDSTVAE--GVALVDFWAPWCGPCRMIAPVIEELANDFDGKAKICKVNTDEEQ 62

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96
          +++ +Y I SIPT++ FK+G+++D+M+  +S Q
Sbjct: 63 DVAIKYGIRSIPTILFFKNGELVDQMIGASSKQ 95


>gi|91783454|ref|YP_558660.1| thioredoxin [Burkholderia xenovorans LB400]
 gi|170692332|ref|ZP_02883495.1| thioredoxin [Burkholderia graminis C4D1M]
 gi|187923815|ref|YP_001895457.1| thioredoxin [Burkholderia phytofirmans PsJN]
 gi|209519557|ref|ZP_03268350.1| thioredoxin [Burkholderia sp. H160]
 gi|296157764|ref|ZP_06840598.1| thioredoxin [Burkholderia sp. Ch1-1]
 gi|307729575|ref|YP_003906799.1| thioredoxin [Burkholderia sp. CCGE1003]
 gi|323526150|ref|YP_004228303.1| thioredoxin [Burkholderia sp. CCGE1001]
 gi|91687408|gb|ABE30608.1| Thioredoxin [Burkholderia xenovorans LB400]
 gi|170142762|gb|EDT10927.1| thioredoxin [Burkholderia graminis C4D1M]
 gi|187715009|gb|ACD16233.1| thioredoxin [Burkholderia phytofirmans PsJN]
 gi|209500036|gb|EEA00099.1| thioredoxin [Burkholderia sp. H160]
 gi|295892010|gb|EFG71794.1| thioredoxin [Burkholderia sp. Ch1-1]
 gi|307584110|gb|ADN57508.1| thioredoxin [Burkholderia sp. CCGE1003]
 gi|323383152|gb|ADX55243.1| thioredoxin [Burkholderia sp. CCGE1001]
          Length = 108

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +V++   PV++DFWA WC PC  ++PI+D++A + AD+++I K++++E      ++
Sbjct: 12  SFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQIAKINVDEHQSTPVKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTLILFK+G V  + + GA S+S +  ++
Sbjct: 72  GVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFL 104


>gi|56752309|ref|YP_173010.1| thioredoxin [Synechococcus elongatus PCC 6301]
 gi|56687268|dbj|BAD80490.1| thioredoxin [Synechococcus elongatus PCC 6301]
          Length = 115

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 62/88 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A +++ + F+S VL+    V+VDFWA WC PC  ++P++D  A   AD++ + KL+++ 
Sbjct: 11 AATELNDQQFESAVLKAPGLVLVDFWAPWCGPCRLIAPLMDWAAQTYADQLTVYKLEVDP 70

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRM 89
          + E   RYQ+  IPTL+LF++G++++R+
Sbjct: 71 NPETVARYQVQGIPTLLLFQNGELVERV 98


>gi|186682663|ref|YP_001865859.1| thioredoxin [Nostoc punctiforme PCC 73102]
 gi|186465115|gb|ACC80916.1| thioredoxin [Nostoc punctiforme PCC 73102]
          Length = 105

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 72/102 (70%), Gaps = 4/102 (3%)

Query: 9   KSFDS--EVLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           K F+S  E+L  S+ PV+VDF+A WC PC  + PI++ +  +L D+++I K+D E+ +++
Sbjct: 5   KQFNSFEEMLSASDVPVLVDFYADWCGPCQMMVPILEQVNLQLKDRLRIVKIDTEKYTDL 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y+I+S+PTL+LFK G+ +DR + G      +++++ +++
Sbjct: 65  ATEYKIASLPTLVLFKQGQPVDR-IEGVMQAPQLVQYLQTKI 105


>gi|302340190|ref|YP_003805396.1| thioredoxin [Spirochaeta smaragdinae DSM 11293]
 gi|301637375|gb|ADK82802.1| thioredoxin [Spirochaeta smaragdinae DSM 11293]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 69/98 (70%), Gaps = 2/98 (2%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           + +F+ EV   + PV+VDFWA WC PC  +SPI+++IA+    K+K+ K+++++   ++ 
Sbjct: 9   SANFEDEVQNSAIPVLVDFWAEWCVPCKMISPILEEIAEAFDGKIKVGKINVDQEEALAG 68

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           R+ I SIPTL++FK G+V+++ + GA S+ D IE + +
Sbjct: 69  RFNIISIPTLMVFKGGEVVNQQV-GAGSR-DAIEKLFA 104


>gi|330951205|gb|EGH51465.1| thioredoxin [Pseudomonas syringae Cit 7]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +F++EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL+I+E+ +
Sbjct: 8   HVTDATFEAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDEIASTYEGKLTVAKLNIDENQD 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 68  TPAKHGVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFL 105


>gi|297564886|ref|YP_003683858.1| thioredoxin [Meiothermus silvanus DSM 9946]
 gi|296849335|gb|ADH62350.1| thioredoxin [Meiothermus silvanus DSM 9946]
          Length = 141

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 65/92 (70%), Gaps = 1/92 (1%)

Query: 16  LECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIP 75
           L+   PV+VDFWA WC PC  ++P++++IA E A ++K+ KLD++     ++ +Q+ SIP
Sbjct: 48  LQAGVPVLVDFWAKWCGPCRMVAPVLEEIAREQAGRLKVVKLDVDRHPLPASAFQVQSIP 107

Query: 76  TLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           TLILFK+G+  +R++ GA  ++ ++E ++  +
Sbjct: 108 TLILFKNGQPAERIV-GALPKAALLERLMPHL 138


>gi|27065184|pdb|1KEB|A Chain A, Crystal Structure Of Double Mutant M37l,P40s E.Coli
           Thioredoxin
 gi|27065185|pdb|1KEB|B Chain B, Crystal Structure Of Double Mutant M37l,P40s E.Coli
           Thioredoxin
          Length = 108

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+    ++VDFWA WC PC  ++ I+D+IADE   K+ + KL+I+++   + +Y
Sbjct: 11  SFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKY 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LFK+G+V    + GA S+  + E++
Sbjct: 71  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFL 103


>gi|255530779|ref|YP_003091151.1| thioredoxin [Pedobacter heparinus DSM 2366]
 gi|255343763|gb|ACU03089.1| thioredoxin [Pedobacter heparinus DSM 2366]
          Length = 105

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 65/95 (68%), Gaps = 1/95 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F+  VL+   PV+VDFWA WC PC  + P++D+I+ E   K  + K++++ +
Sbjct: 2  ALEITDANFEEVVLKSDKPVLVDFWAEWCGPCRMVGPVVDEISKEYEGKALVGKVNVDNN 61

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
           +IST++ I +IP L+ FK+G+V+D+ + GA  +S
Sbjct: 62 PQISTQFGIRNIPALLYFKNGEVVDKQV-GAVPKS 95


>gi|262199086|ref|YP_003270295.1| thioredoxin [Haliangium ochraceum DSM 14365]
 gi|262082433|gb|ACY18402.1| thioredoxin [Haliangium ochraceum DSM 14365]
          Length = 110

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++++  SFD+EV     P +VDFWA WC PC +++PI+ ++A +   K+K+ K+DI+ 
Sbjct: 5   NVIELNDGSFDAEVTNSDTPTLVDFWAVWCGPCRQVAPIVSELAKDYEGKLKVAKMDIDH 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           +     ++ I SIPTL+LFK G+V++ ++ GA  +S I
Sbjct: 65  NQITPQKFGIRSIPTLLLFKGGEVVETII-GAMPKSKI 101


>gi|17229358|ref|NP_485906.1| thioredoxin [Nostoc sp. PCC 7120]
 gi|75910957|ref|YP_325253.1| thioredoxin [Anabaena variabilis ATCC 29413]
 gi|17130956|dbj|BAB73565.1| thioredoxin [Nostoc sp. PCC 7120]
 gi|75704682|gb|ABA24358.1| thioredoxin [Anabaena variabilis ATCC 29413]
          Length = 110

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 61/93 (65%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          S   V   +F  EVL+ + PV+VDFWA WC PC  ++P++D++A E    VK+ KL+ ++
Sbjct: 3  SITNVTEATFKQEVLDSNVPVLVDFWAPWCGPCRMVAPVVDEVASEYEGLVKVVKLNTDQ 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMMPGAS 94
          +  +++ Y I SIPTL++FK G+ ++ ++   S
Sbjct: 63 NPTVASHYGIRSIPTLMVFKGGRQVNTVVGAVS 95


>gi|294501465|ref|YP_003565165.1| thioredoxin [Bacillus megaterium QM B1551]
 gi|295706813|ref|YP_003599888.1| thioredoxin [Bacillus megaterium DSM 319]
 gi|294351402|gb|ADE71731.1| thioredoxin [Bacillus megaterium QM B1551]
 gi|294804472|gb|ADF41538.1| thioredoxin [Bacillus megaterium DSM 319]
          Length = 104

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 63/90 (70%), Gaps = 2/90 (2%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+      K+F  E+   S  V+VDFWA WC PC  ++P++++I  EL DKVKI K+D++
Sbjct: 1  MAIAHATDKNFTDEIK--SGLVLVDFWAPWCGPCKMIAPVLEEIDGELNDKVKIVKVDVD 58

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ E + ++ + SIPTL+LFKDG+ +D+++
Sbjct: 59 ENQETAGKFGVMSIPTLVLFKDGEKVDQVV 88


>gi|298492062|ref|YP_003722239.1| thioredoxin ['Nostoc azollae' 0708]
 gi|298233980|gb|ADI65116.1| thioredoxin ['Nostoc azollae' 0708]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 64/89 (71%), Gaps = 1/89 (1%)

Query: 11 FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
          F+ EV+E   PV+VDFWA WC PC  ++P++++IA +   ++K+ K++ +E+ +++ +Y 
Sbjct: 12 FEQEVIESPLPVLVDFWAPWCGPCRMVAPVVEEIAAQYEGQLKVVKVNTDENPQVAGKYG 71

Query: 71 ISSIPTLILFKDGKVIDRMMPGASSQSDI 99
          I SIPTL++FK G+ +D M+ GA  +S +
Sbjct: 72 IRSIPTLMIFKGGQKVD-MVVGAVPKSTL 99


>gi|118444071|ref|YP_877241.1| thioredoxin [Clostridium novyi NT]
 gi|118134527|gb|ABK61571.1| thioredoxin [Clostridium novyi NT]
          Length = 105

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 59/86 (68%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
          ++   +F  EV+     VVVDFWA WC PC  L P++++++ ++  K K  K++++E+ E
Sbjct: 4  EIGGSNFIQEVMNSEETVVVDFWAPWCGPCKMLGPVMEELSHDMEGKAKFFKINVDENPE 63

Query: 65 ISTRYQISSIPTLILFKDGKVIDRMM 90
          I+ R+QI SIP +++FK GKV++ ++
Sbjct: 64 IAQRFQIGSIPNVMVFKGGKVVENLI 89


>gi|81300602|ref|YP_400810.1| thioredoxin [Synechococcus elongatus PCC 7942]
 gi|81169483|gb|ABB57823.1| thioredoxin [Synechococcus elongatus PCC 7942]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 62/88 (70%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +A +++ + F+S VL+    V+VDFWA WC PC  ++P++D  A   AD++ + KL+++ 
Sbjct: 3  AATELNDQQFESAVLKAPGLVLVDFWAPWCGPCRLIAPLMDWAAQTYADQLTVYKLEVDP 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRM 89
          + E   RYQ+  IPTL+LF++G++++R+
Sbjct: 63 NPETVARYQVQGIPTLLLFQNGELVERV 90


>gi|332705255|ref|ZP_08425336.1| thioredoxin [Lyngbya majuscula 3L]
 gi|332355998|gb|EGJ35457.1| thioredoxin [Lyngbya majuscula 3L]
          Length = 105

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 71/102 (69%), Gaps = 3/102 (2%)

Query: 3   ALKVDTKSFDSEVLECSN-PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           A+K   K+F  E+L  S+ PV+VDF+A+WC PC  ++PI++ +  EL D++K+ K+D E+
Sbjct: 2   AVKKQFKTF-QELLSGSDVPVLVDFYATWCGPCQMMAPILEQVNAELKDRLKVVKIDTEK 60

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             +++++YQI ++PTL+LFK+G+   R + G     D+I+ +
Sbjct: 61  YPQLASQYQIEALPTLVLFKNGQPQQR-IEGLRPAEDLIQQL 101


>gi|28872355|ref|NP_794974.1| thioredoxin [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213971838|ref|ZP_03399940.1| thioredoxin [Pseudomonas syringae pv. tomato T1]
 gi|301383375|ref|ZP_07231793.1| thioredoxin [Pseudomonas syringae pv. tomato Max13]
 gi|302064068|ref|ZP_07255609.1| thioredoxin [Pseudomonas syringae pv. tomato K40]
 gi|302134964|ref|ZP_07260954.1| thioredoxin [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28855610|gb|AAO58669.1| thioredoxin [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213923384|gb|EEB56977.1| thioredoxin [Pseudomonas syringae pv. tomato T1]
 gi|330874079|gb|EGH08228.1| thioredoxin [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330965549|gb|EGH65809.1| thioredoxin [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331017857|gb|EGH97913.1| thioredoxin [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF+++VL+    V+VD+WA WC PC  ++P++D+IA   A K+ I KL+I+E+ E
Sbjct: 8   HVTDASFEADVLKADGAVLVDYWAEWCGPCKMIAPVLDEIATTYAGKLTIAKLNIDENQE 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFK+G V +    GA S+S +  ++
Sbjct: 68  TPAKHGVRGIPTLMLFKNGNV-EATKVGALSKSQLAAFL 105


>gi|32265554|ref|NP_859586.1| thioredoxin [Helicobacter hepaticus ATCC 51449]
 gi|32261602|gb|AAP76652.1| thioredoxin [Helicobacter hepaticus ATCC 51449]
          Length = 105

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 57/87 (65%), Gaps = 2/87 (2%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
          +FD+E L  S   +VDFWA WC PC  LSP+ID +ADE   K KI K++++E  E+S R+
Sbjct: 11 NFDTEAL--SGVALVDFWAPWCNPCKMLSPVIDKLADEYEGKAKICKVNVDEQGELSKRF 68

Query: 70 QISSIPTLILFKDGKVIDRMMPGASSQ 96
           I +IPT++  KDG++ D++      Q
Sbjct: 69 GIRNIPTILFMKDGEIKDQVTGAMPEQ 95


>gi|85060365|ref|YP_456067.1| thioredoxin 1 [Sodalis glossinidius str. 'morsitans']
 gi|84780885|dbj|BAE75662.1| thioredoxin 1 [Sodalis glossinidius str. 'morsitans']
          Length = 108

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +VL+     +VDFWA WC PC  ++PI+ ++ADE   K+ + KL+I+E+   + +Y
Sbjct: 12  SFEKDVLQAKGLFLVDFWAEWCGPCKMIAPILAEVADEFDGKLTVAKLNIDENPATAPKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPTL+LF+DG+V+   + GA S+  + E++
Sbjct: 72  GIRGIPTLLLFRDGEVVATKV-GALSKGQLKEFL 104


>gi|330900036|gb|EGH31455.1| thioredoxin [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330977253|gb|EGH77209.1| thioredoxin [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   +F++EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL+I+++ E
Sbjct: 8   HVTDATFEAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDEIAGTYEGKLTVAKLNIDQNPE 67

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +  IPTL+LFK G V +    GA S+S +  ++
Sbjct: 68  TPAKHGVRGIPTLMLFKGGNV-EATKVGALSKSQLAAFL 105


>gi|158521524|ref|YP_001529394.1| thioredoxin [Desulfococcus oleovorans Hxd3]
 gi|158510350|gb|ABW67317.1| thioredoxin [Desulfococcus oleovorans Hxd3]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 64/99 (64%), Gaps = 3/99 (3%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +   SF++EV++   PV VDFWA WC PC  + P+++++A     K+K  K +++++ 
Sbjct: 6   LSISDGSFEAEVIQAEMPVFVDFWAPWCGPCKAIGPLVEELAAAYEGKIKFAKCNVDDNP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDR---MMPGASSQSDI 99
              T++ I +IPTLI+FK G+V++R   M+P A  ++ +
Sbjct: 66  STPTKFGIQAIPTLIIFKGGEVVERITGMVPKAKLEAAL 104


>gi|329765906|ref|ZP_08257471.1| thioredoxin [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137612|gb|EGG41883.1| thioredoxin [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 62/91 (68%)

Query: 7  DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
          D KS++  V     PV VDFWA WC PC  + P+++++A++   KVK  K++++E++E++
Sbjct: 8  DAKSWEINVSNSDIPVFVDFWAQWCGPCRMVGPVVEELANDYQGKVKFVKVNVDEANELA 67

Query: 67 TRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
          ++Y + SIPTLI+   G+V+ + +  AS +S
Sbjct: 68 SKYNVFSIPTLIILNKGEVVSQQVGAASKES 98


>gi|182679073|ref|YP_001833219.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634956|gb|ACB95730.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M +LKV   +F   V++   PV VDFWA WC PC  ++P+++D+ADEL  +V + KL+I+
Sbjct: 1   MPSLKVTDATFARAVIDAGLPVFVDFWADWCGPCHAVAPLLEDLADELQGRVIVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ + +    I S+PT  +FK+G++  + + GA ++  +  WIL  +
Sbjct: 61  ENPDTTALQDIHSVPTFKIFKNGELAAQDI-GAYTKDALRAWILETI 106


>gi|225182135|ref|ZP_03735561.1| thioredoxin [Dethiobacter alkaliphilus AHT 1]
 gi|225167178|gb|EEG76003.1| thioredoxin [Dethiobacter alkaliphilus AHT 1]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 61/84 (72%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          L+V   +F  EVL+ + PVVVDFWA+WC PC  ++P+++++A ++  KVKI K++++++ 
Sbjct: 6  LEVSDANFADEVLKANVPVVVDFWAAWCGPCRMMAPVLEEVARDMDGKVKIVKVNVDKNR 65

Query: 64 EISTRYQISSIPTLILFKDGKVID 87
            +  Y+I SIPTL+ FK G+ +D
Sbjct: 66 TTAGNYKIMSIPTLMFFKGGESVD 89


>gi|194755507|ref|XP_001960033.1| GF11737 [Drosophila ananassae]
 gi|190621331|gb|EDV36855.1| GF11737 [Drosophila ananassae]
          Length = 138

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 61/95 (64%), Gaps = 1/95 (1%)

Query: 9   KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           K F+  V+    PVVVDF ASWC PC  L+P +++I  E   KV++ ++DI+E  E++  
Sbjct: 36  KDFERRVINSDRPVVVDFHASWCCPCKALAPRLENIVSEQGGKVRLARVDIDEHGELAMD 95

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           Y + S+P+L++   GKV++RM+ G  +   I +W+
Sbjct: 96  YNVGSVPSLVVINKGKVVNRMV-GLQTSEYIRDWL 129


>gi|218458473|ref|ZP_03498564.1| thioredoxin protein [Rhizobium etli Kim 5]
          Length = 105

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 57/76 (75%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  KVK+ KL+I+
Sbjct: 1  MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISVEMEGKVKVAKLNID 60

Query: 61 ESSEISTRYQISSIPT 76
          E+ E++ ++ + SIPT
Sbjct: 61 ENPELAAQFGVRSIPT 76


>gi|114775403|ref|ZP_01450971.1| putative thioredoxin [Mariprofundus ferrooxydans PV-1]
 gi|114553514|gb|EAU55895.1| putative thioredoxin [Mariprofundus ferrooxydans PV-1]
          Length = 145

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 64/103 (62%), Gaps = 3/103 (2%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +  +   F   VL    PV+VDFWA+WC PC  L+P ++ +A   A KV++ K+DI+++ 
Sbjct: 42  MHCNESDFAETVLSSPIPVLVDFWAAWCGPCKMLAPELEKLATSFAGKVRVVKVDIDKNP 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRM---MPGASSQSDIIEWI 103
            ++ RY I S+PT+++ +DGKV+D +   MP A+    +  W+
Sbjct: 102 ALADRYAIRSVPTMLVVRDGKVVDTLNGAMPAAALAQRLQPWL 144


>gi|219850435|ref|YP_002464868.1| thioredoxin [Chloroflexus aggregans DSM 9485]
 gi|219544694|gb|ACL26432.1| thioredoxin [Chloroflexus aggregans DSM 9485]
          Length = 257

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 60/97 (61%), Gaps = 2/97 (2%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +FD  V +   PV+VDFWA WC PC  ++P I+ +A E A K  + KL+++E+   + R+
Sbjct: 160 TFDQVVGQSQQPVLVDFWAPWCGPCRAVAPSIERLAHEFAGKAVVAKLNVDENPYTAQRF 219

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
            I+ IP L +FK G+V++R++   +    ++   L+R
Sbjct: 220 GITGIPALYIFKGGRVVERLV--GAQPYQVLRQALAR 254



 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 54/102 (52%), Gaps = 2/102 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++   +S D  VL+   PV++ F    C  C +L   +D +A + A K  I ++D+++
Sbjct: 5   TPIRTGEQSID-RVLKAGLPVLLVFERRDCATCRQLDATLDRLAQQFAGKALIARIDVDD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +  +Y IS +P L+  ++G  + R   GA+  + +  W+
Sbjct: 64  NPALVQKYSISDLPGLVFIRNGATLARTA-GAAPATALQAWL 104


>gi|152985086|ref|YP_001351299.1| thioredoxin [Pseudomonas aeruginosa PA7]
 gi|150960244|gb|ABR82269.1| thioredoxin [Pseudomonas aeruginosa PA7]
          Length = 108

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF+ +VL+   PV+VD+WA WC PC  ++P++D++A +   K+K+ KL+I+E+ 
Sbjct: 6   VNVTDASFEQDVLKADGPVLVDYWAEWCGPCKMIAPVLDEVARDYQGKLKVCKLNIDENQ 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +   +Y +  IPTL+LFK G V +    GA S+S +  ++
Sbjct: 66  DTPPKYGVRGIPTLMLFKGGNV-EATKVGALSKSQLAAFL 104


>gi|190576090|ref|YP_001973935.1| putative thioredoxin 1 [Stenotrophomonas maltophilia K279a]
 gi|194367447|ref|YP_002030057.1| thioredoxin [Stenotrophomonas maltophilia R551-3]
 gi|254521434|ref|ZP_05133489.1| thioredoxin [Stenotrophomonas sp. SKA14]
 gi|190014012|emb|CAQ47652.1| putative thioredoxin 1 [Stenotrophomonas maltophilia K279a]
 gi|194350251|gb|ACF53374.1| thioredoxin [Stenotrophomonas maltophilia R551-3]
 gi|219719025|gb|EED37550.1| thioredoxin [Stenotrophomonas sp. SKA14]
          Length = 109

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 60/96 (62%), Gaps = 1/96 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V    FDS VL    PV+VDFWA WC PC  ++P +D++AD    + KI K++++ + 
Sbjct: 6   VHVGDADFDSAVLNSKEPVLVDFWAEWCGPCKMIAPALDELADAYQGRAKIAKVNVDHNR 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            ++ +Y + SIP L++FKDG+ +   + GA  ++ +
Sbjct: 66  ALAAKYHVRSIPYLVVFKDGEKVGEQI-GAVGKAQL 100


>gi|166030564|ref|ZP_02233393.1| hypothetical protein DORFOR_00227 [Dorea formicigenerans ATCC
           27755]
 gi|166029566|gb|EDR48323.1| hypothetical protein DORFOR_00227 [Dorea formicigenerans ATCC
           27755]
          Length = 103

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +F+ EVL+    V+VDFWA WC PC  L P+I+++A E+ D VKI K+D++
Sbjct: 1   MAVVHVTGDTFEQEVLKAEGKVLVDFWAGWCGPCQMLGPVIEEVAAEV-DDVKICKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +++ +Y++ SIP L++F++G+V  + + G  S+ +++  I
Sbjct: 60  QCMDLARQYKVVSIPMLVVFENGEVTGKQL-GLISKEEVLHLI 101


>gi|238765060|ref|ZP_04625996.1| Thioredoxin 2 [Yersinia kristensenii ATCC 33638]
 gi|238696746|gb|EEP89527.1| Thioredoxin 2 [Yersinia kristensenii ATCC 33638]
          Length = 138

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI +D+A E A KV+  K++ 
Sbjct: 25  FDGEVINATAETLDKLLQDDLPVVIDFWAPWCGPCRSFAPIFEDVAAERAGKVRFVKINT 84

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E    +S R++I SIPT++L+++G+++D M+ GA  ++    W+
Sbjct: 85  EAEPALSARFRIRSIPTIMLYRNGQMVD-MLSGALPKAPFDNWL 127


>gi|258510853|ref|YP_003184287.1| thioredoxin [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
 gi|257477579|gb|ACV57898.1| thioredoxin [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
          Length = 106

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 64/90 (71%), Gaps = 1/90 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+ + +   +F  + ++   PV+VDFWA+WC PC  ++P++++ A+  ADKV + KL+++
Sbjct: 1  MATMTLTDANF-QQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDRMM 90
          E+ E ++++ I SIPTLILFK G+ + +++
Sbjct: 60 ENPETTSQFGIMSIPTLILFKGGRPVKQLI 89


>gi|5080763|gb|AAD39273.1|AC007203_5 Hypothetical protein [Arabidopsis thaliana]
          Length = 242

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A K    SFD  +     PV+VDF+A+WC PC  + PI++++++ L D + + K+D E+
Sbjct: 134 AAKKQTFNSFDDLLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEK 193

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ +YQI ++PT ILFKDGK+ DR   GA   + ++E I
Sbjct: 194 YPSLANKYQIEALPTFILFKDGKLWDR-FEGALPANQLVERI 234


>gi|326403649|ref|YP_004283731.1| thioredoxin [Acidiphilium multivorum AIU301]
 gi|325050511|dbj|BAJ80849.1| thioredoxin [Acidiphilium multivorum AIU301]
          Length = 108

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 59/93 (63%), Gaps = 1/93 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F + VL    PV+VDFWA WC PC  + P ++++  E A +V I K++I+E+    T+Y 
Sbjct: 13  FSTSVLNSKEPVLVDFWAEWCGPCKIIGPSLEELGSEYAGRVTIAKVNIDENPMTPTQYG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  IPTLILFKDGK   + + GA+ +S +  W+
Sbjct: 73  VRGIPTLILFKDGKPAAQHV-GAAPKSVLKAWL 104


>gi|315652809|ref|ZP_07905783.1| thioredoxin [Eubacterium saburreum DSM 3986]
 gi|315485011|gb|EFU75419.1| thioredoxin [Eubacterium saburreum DSM 3986]
          Length = 102

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 62/88 (70%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+   + + +F++EVL    PV+VD WA WC PC  LSPI+D++A+E A    + K++ +
Sbjct: 1  MAVKTITSANFEAEVLNAKEPVLVDVWAPWCGPCKMLSPIVDEVAEE-AVGFSVGKVNAD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          E+ E+  R+ I SIPTL++FK+G+++++
Sbjct: 60 ENQELVNRFHIMSIPTLLVFKNGELVNK 87


>gi|256833756|ref|YP_003162483.1| thioredoxin [Jonesia denitrificans DSM 20603]
 gi|256687287|gb|ACV10180.1| thioredoxin [Jonesia denitrificans DSM 20603]
          Length = 109

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 61/89 (68%)

Query: 4  LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
          + V   +FD+ VL+   PV+VDFWA WC PC +++PI++++A+E A ++ I KLD + + 
Sbjct: 5  VAVTDATFDTAVLQSDIPVLVDFWAEWCGPCRQVAPILEELAEEYAGRITIAKLDTDANP 64

Query: 64 EISTRYQISSIPTLILFKDGKVIDRMMPG 92
            + +Y I SIPTL ++K G+V+  ++ G
Sbjct: 65 ATTMKYGIVSIPTLNIYKGGEVVATIVGG 93


>gi|150398239|ref|YP_001328706.1| thioredoxin [Sinorhizobium medicae WSM419]
 gi|150029754|gb|ABR61871.1| thioredoxin [Sinorhizobium medicae WSM419]
          Length = 330

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 64/98 (65%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F  +VLE S   PV+VDFWA WC PC +L+P+I+ +  E A +VK+ K++I++   I
Sbjct: 47  TAAFSRDVLEASRQQPVLVDFWAPWCGPCKQLTPVIEKVVKEAAGRVKLVKMNIDDHPSI 106

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +  I SIP +I F DG+ +D  M GA  +S I E+I
Sbjct: 107 AGQLGIQSIPAVIAFVDGRPVDGFM-GAVPESQIKEFI 143


>gi|145219789|ref|YP_001130498.1| thioredoxin [Prosthecochloris vibrioformis DSM 265]
 gi|145205953|gb|ABP36996.1| thioredoxin [Chlorobium phaeovibrioides DSM 265]
          Length = 268

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 64/95 (67%), Gaps = 3/95 (3%)

Query: 11  FDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           F  +VLE S+  PV+VDFWA WC PC +L+P+++ +A +   +  + K++ EE ++I++R
Sbjct: 9   FQCDVLELSHDRPVLVDFWAEWCAPCRQLAPVLERLAGKYEGRFTLVKINTEEHADIASR 68

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +Q+ SIP ++LF  G+VID    GA  +  + EW+
Sbjct: 69  FQVRSIPMVLLFSAGEVID-SFSGAIPERQVEEWL 102


>gi|149201423|ref|ZP_01878398.1| thioredoxin [Roseovarius sp. TM1035]
 gi|149145756|gb|EDM33782.1| thioredoxin [Roseovarius sp. TM1035]
          Length = 106

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV     PVVVDFWA WC PC ++ P++++++ E++ +VKI K+D++
Sbjct: 1   MATVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPVLEELSSEMSGRVKIVKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI
Sbjct: 61  SNPNSAVAMGVRGIPALFIFKDGQVVSNRA-GAAPKAALQSWI 102


>gi|149200252|ref|ZP_01877274.1| Thioredoxin [Lentisphaera araneosa HTCC2155]
 gi|149136694|gb|EDM25125.1| Thioredoxin [Lentisphaera araneosa HTCC2155]
          Length = 108

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 67/104 (64%), Gaps = 2/104 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +D  SF+S V E     +VDFWA WC PC  L+P+ID +A  L  K K+ K++ +E++
Sbjct: 7   LNLDDSSFESTVSE--GVTLVDFWAPWCGPCRMLAPVIDKVAGRLDGKAKVAKVNTDEAN 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             + ++ ++SIPT+++FKDG++ D +M  A  + D++  + S +
Sbjct: 65  ASAVKFGVNSIPTIMIFKDGELQDTLMGAAQREDDLVSKVESYI 108


>gi|34810796|pdb|1NSW|A Chain A, The Crystal Structure Of The K18g Mutant Of The
          Thioredoxin From Alicyclobacillus Acidocaldarius
 gi|34810797|pdb|1NSW|B Chain B, The Crystal Structure Of The K18g Mutant Of The
          Thioredoxin From Alicyclobacillus Acidocaldarius
 gi|34810798|pdb|1NSW|C Chain C, The Crystal Structure Of The K18g Mutant Of The
          Thioredoxin From Alicyclobacillus Acidocaldarius
 gi|34810799|pdb|1NSW|D Chain D, The Crystal Structure Of The K18g Mutant Of The
          Thioredoxin From Alicyclobacillus Acidocaldarius
          Length = 105

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 58/78 (74%)

Query: 13 SEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQIS 72
           + ++   PV+VDFWA+WC PC  ++P++++ A+  ADKV + KL+++E+ E ++++ I 
Sbjct: 11 QQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIM 70

Query: 73 SIPTLILFKDGKVIDRMM 90
          SIPTLILFK G+ + +++
Sbjct: 71 SIPTLILFKGGRPVKQLI 88


>gi|284047275|ref|YP_003397615.1| thioredoxin [Conexibacter woesei DSM 14684]
 gi|283951496|gb|ADB54240.1| thioredoxin [Conexibacter woesei DSM 14684]
          Length = 109

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 62/86 (72%)

Query: 5  KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
          +V   +F +EV+E   PV+VDFWA WC PC  ++P++++IA E  + +KI KL+++++ +
Sbjct: 7  EVTDNNFQAEVIESDVPVLVDFWAPWCGPCRMVAPVLEEIASEKGEALKIVKLNVDDNQQ 66

Query: 65 ISTRYQISSIPTLILFKDGKVIDRMM 90
           +  +++ SIPTLILFK+G V  +++
Sbjct: 67 TAMNFEVLSIPTLILFKNGAVAKKVV 92


>gi|148260456|ref|YP_001234583.1| thioredoxin [Acidiphilium cryptum JF-5]
 gi|146402137|gb|ABQ30664.1| thioredoxin [Acidiphilium cryptum JF-5]
          Length = 108

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 60/93 (64%), Gaps = 1/93 (1%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F + VL+   PV+VDFWA WC PC  + P ++++  E A +V I K++I+E+    T+Y 
Sbjct: 13  FSTSVLDSKEPVLVDFWAEWCGPCKIIGPSLEELGSEYAGRVTIAKVNIDENPMTPTQYG 72

Query: 71  ISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  IPTLILFKDGK   + + GA+ +S +  W+
Sbjct: 73  VRGIPTLILFKDGKPAAQHV-GAAPKSVLKAWL 104


>gi|238795640|ref|ZP_04639155.1| Thioredoxin 2 [Yersinia mollaretii ATCC 43969]
 gi|238720759|gb|EEQ12560.1| Thioredoxin 2 [Yersinia mollaretii ATCC 43969]
          Length = 138

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 63/104 (60%), Gaps = 12/104 (11%)

Query: 11  FDSEVLECSN-----------PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           FD EV+  +            PVV+DFWA WC PC   +PI + +A E A K++  K++ 
Sbjct: 25  FDGEVINATADTLDKLLQDDLPVVIDFWAPWCGPCRSFAPIFEAVAAERAGKIRFVKVNT 84

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E    +STR++I SIPT++L+++GK++D M+ GA  ++    W+
Sbjct: 85  EAEPALSTRFRIRSIPTIMLYRNGKMLD-MLSGAVPKAPFEHWL 127


>gi|282861187|ref|ZP_06270252.1| thioredoxin [Streptomyces sp. ACTE]
 gi|282563845|gb|EFB69382.1| thioredoxin [Streptomyces sp. ACTE]
          Length = 116

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 66/97 (68%), Gaps = 1/97 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   +FD EV     PV+V+F A WC PC +L+P++  IA E AD+VK+ +LD++ +  
Sbjct: 9   EVTDATFDEEVRGAGLPVLVEFTADWCGPCRQLAPVLGAIAAEEADRVKVVQLDVDTNPG 68

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           I++RY + S+PTL++F+DG+ + R M GA  +  +++
Sbjct: 69  ITSRYAVLSMPTLMVFQDGEPV-RSMVGARPKRRLLQ 104


>gi|261822728|ref|YP_003260834.1| thioredoxin [Pectobacterium wasabiae WPP163]
 gi|261606741|gb|ACX89227.1| thioredoxin [Pectobacterium wasabiae WPP163]
          Length = 139

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 21  PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILF 80
           P+VVDFWA WC PCV  +P+ +++A E + K++  K++ E    +S R++I SIPTL++F
Sbjct: 54  PIVVDFWAPWCGPCVNFAPVFENVAQERSGKIRFIKVNTEAEPALSARFRIRSIPTLMIF 113

Query: 81  KDGKVIDRMMPGASSQSDIIEWI 103
           K G+++D ++ GA  ++   EW+
Sbjct: 114 KQGQMVD-ILNGALPKAQFEEWL 135


>gi|148244588|ref|YP_001219282.1| thioredoxin 1 [Candidatus Vesicomyosocius okutanii HA]
 gi|146326415|dbj|BAF61558.1| thioredoxin 1 [Candidatus Vesicomyosocius okutanii HA]
          Length = 108

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF++EV+  S  V+VDFWA WC PC  L P++D IADE   +V I K++I+E+ +I ++Y
Sbjct: 12  SFEAEVVNSSQVVLVDFWAQWCGPCKTLMPVLDKIADEYDGRVLIAKINIDENQKIPSKY 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            I  IPT++LF +G V+     GA S++++  +I
Sbjct: 72  GIRGIPTMLLFFEG-VVQATKMGALSKAELSAFI 104


>gi|218129194|ref|ZP_03457998.1| hypothetical protein BACEGG_00769 [Bacteroides eggerthii DSM
          20697]
 gi|217988572|gb|EEC54892.1| hypothetical protein BACEGG_00769 [Bacteroides eggerthii DSM
          20697]
          Length = 104

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 62/95 (65%), Gaps = 1/95 (1%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          AL++   +F  E+L    PVV+DFWA WC PC  + PII+++A E   KV I K D++E+
Sbjct: 2  ALEITDNNF-KEILAEGKPVVIDFWAPWCGPCKMVGPIIEELAGEYEGKVLIGKCDVDEN 60

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS 97
           +++  Y I +IPT++ FK+G+++D+ +  A   +
Sbjct: 61 GDVAAEYGIRNIPTVLFFKNGELVDKQVGSAPKPT 95


>gi|332978171|gb|EGK14905.1| thioredoxin [Desmospora sp. 8437]
          Length = 105

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 72/107 (67%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V  ++F+ +V   S  V+VDFWA WC PC  ++P ++ +  E+ DK+ I KL+++
Sbjct: 2   MAIKQVTDQTFNDDV--ASGTVLVDFWAPWCGPCKMIAPELEGLDQEIGDKLTIAKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ + + ++ + SIPTL++FKDG+++D++  G   ++ ++EW+   +
Sbjct: 60  ENPDTAGKFGVMSIPTLMVFKDGQMVDKLT-GFQPKAQLLEWVTPHL 105


>gi|254497010|ref|ZP_05109842.1| thioredoxin [Legionella drancourtii LLAP12]
 gi|254353764|gb|EET12467.1| thioredoxin [Legionella drancourtii LLAP12]
          Length = 127

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 56/98 (57%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           +DT  FD  + +   P++VDFWA WC PC  ++P  +  A  L  KV+  K++ E    +
Sbjct: 27  LDTAQFDLHLKKNDIPLLVDFWAEWCGPCKMMAPYFEAAAKLLEPKVRFVKINTESQQTL 86

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + RYQI SIPTL+LF  GK   R   G  S  DI+ W+
Sbjct: 87  AARYQIQSIPTLMLFSHGKEHAR-HSGVISTQDIVHWV 123


>gi|313205976|ref|YP_004045153.1| thioredoxin [Riemerella anatipestifer DSM 15868]
 gi|312445292|gb|ADQ81647.1| thioredoxin [Riemerella anatipestifer DSM 15868]
 gi|325336584|gb|ADZ12858.1| thioredoxin [Riemerella anatipestifer RA-GD]
          Length = 105

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL++   +F   V+    PV+VDFWA WC PC  L PI++++A++   K  + K+D++ +
Sbjct: 2   ALEITDSNFKEVVINSDKPVLVDFWAVWCGPCRMLGPIVEELANDFEGKAVVGKVDVDNN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            +++  Y I +IPT+++FK+G+V+D+++ G S +  I E
Sbjct: 62  QQVAMEYGIRNIPTVLIFKNGEVVDKLV-GVSPKEVIAE 99


>gi|317046375|ref|YP_004114023.1| thioredoxin [Pantoea sp. At-9b]
 gi|316947992|gb|ADU67467.1| thioredoxin [Pantoea sp. At-9b]
          Length = 110

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SFD++VL+     +VDFWA WC PC  ++PI+D++A+E   K+ I KL+I+++   + +Y
Sbjct: 13  SFDTDVLKAEGVTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKLNIDDNPGTAPKY 72

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 73  GIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|311694555|gb|ADP97428.1| thioredoxin [marine bacterium HP15]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           +F+  V++   PV+VDFWA WC PC  ++P+++ IADE  D++ I K+++++S +++ + 
Sbjct: 11  NFEQAVVQSDRPVLVDFWAPWCGPCKTVAPMLEAIADEFGDELTIAKVNVDDSPDVTAKM 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I  IPTL LF+DG VI +   GA S S++  ++
Sbjct: 71  RIRGIPTLALFQDGGVIAQKT-GAGSLSELRTFV 103


>gi|254523371|ref|ZP_05135426.1| thioredoxin [Stenotrophomonas sp. SKA14]
 gi|219720962|gb|EED39487.1| thioredoxin [Stenotrophomonas sp. SKA14]
          Length = 285

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 65/98 (66%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L P+++ +A E     ++ K+D+++  +I
Sbjct: 12  TATFEAEVLQKSLQTPVLVDFWATWCGPCKTLGPMLEKLAAEYNGAFELAKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGQLVD-GFPGAIPEGQLREFL 108


>gi|114762245|ref|ZP_01441713.1| thioredoxin [Pelagibaca bermudensis HTCC2601]
 gi|114545269|gb|EAU48272.1| thioredoxin [Roseovarius sp. HTCC2601]
          Length = 106

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD EV     PVVVDFWA WC PC ++ P +++++++   KVK+ K++++
Sbjct: 1   MATVPVTDATFDEEVKNSDIPVVVDFWAEWCGPCKQIGPALEELSEQYEGKVKVAKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
               ++ +  +  IP L LFKDG+VI     GA+ ++ +  WI
Sbjct: 61  HDQAVAAQLGVRGIPALFLFKDGEVISNRT-GAAPKASLESWI 102


>gi|312129864|ref|YP_003997204.1| thioredoxin [Leadbetterella byssophila DSM 17132]
 gi|311906410|gb|ADQ16851.1| thioredoxin [Leadbetterella byssophila DSM 17132]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 62/89 (69%), Gaps = 1/89 (1%)

Query: 2  SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
          +AL++   +F  E++    PV+VDFWA WC PC  + P++++IA E  DK  + K+D++ 
Sbjct: 4  NALEITDNNF-QEIISSDKPVLVDFWAEWCGPCKMIGPVVEEIAGEYQDKAVVGKMDVDA 62

Query: 62 SSEISTRYQISSIPTLILFKDGKVIDRMM 90
          +S I  ++ I SIPTL++FK G+++D+++
Sbjct: 63 NSAIPAQFGIRSIPTLMIFKGGELVDKIV 91


>gi|291530321|emb|CBK95906.1| thioredoxin [Eubacterium siraeum 70/3]
          Length = 102

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 1/88 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          MS + V +++F  EVL+   PV+VDFWASWC PC  L P+++++ +E  + +KI K++ +
Sbjct: 1  MSHIDVTSENFKQEVLQSDKPVLVDFWASWCGPCRMLGPVLEELGEEHPE-IKICKVNTD 59

Query: 61 ESSEISTRYQISSIPTLILFKDGKVIDR 88
          +  E++ R+ I SIP +I FKDGK ID+
Sbjct: 60 DERELAIRFGIDSIPCVISFKDGKQIDK 87


>gi|260888534|ref|ZP_05899797.1| thioredoxin [Selenomonas sputigena ATCC 35185]
 gi|330838163|ref|YP_004412743.1| thioredoxin [Selenomonas sputigena ATCC 35185]
 gi|260861731|gb|EEX76231.1| thioredoxin [Selenomonas sputigena ATCC 35185]
 gi|329745927|gb|AEB99283.1| thioredoxin [Selenomonas sputigena ATCC 35185]
          Length = 102

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 61/84 (72%), Gaps = 1/84 (1%)

Query: 1  MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
          M+A+++  ++F+SEV      V++DFWA WC PC  L+P+ID++A    D +K+ K++I+
Sbjct: 1  MNAIEITKENFESEVTAAKGAVLLDFWAPWCGPCRMLTPVIDEVAAGHPD-LKVGKVNID 59

Query: 61 ESSEISTRYQISSIPTLILFKDGK 84
          E  +++ R+ + SIPTLI+FKDGK
Sbjct: 60 EQPDLAVRFGVQSIPTLIVFKDGK 83


>gi|262374862|ref|ZP_06068096.1| thioredoxin [Acinetobacter lwoffii SH145]
 gi|262309875|gb|EEY91004.1| thioredoxin [Acinetobacter lwoffii SH145]
          Length = 108

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 1   MSALKVDT--KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V+T   +F+++VL+   PV+VDFWA WC PC  ++P+++ +ADE   KVKI K+D
Sbjct: 1   MSGNIVNTTDANFEADVLQSDVPVLVDFWAGWCAPCKAIAPVLEVLADEYQGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +    + +  + I +IP L++FK+G+V+   + GA+ +S +  +I
Sbjct: 61  VTSCEQTAVNFNIRNIPALLMFKNGEVVATQV-GAAPKSKLTAFI 104


>gi|149374854|ref|ZP_01892627.1| thioredoxin [Marinobacter algicola DG893]
 gi|149360743|gb|EDM49194.1| thioredoxin [Marinobacter algicola DG893]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 68/104 (65%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F+  V++    V+VDFWA WC PC  ++P+++DIADE ++++ + K+++++S 
Sbjct: 5   IHVTDANFEEAVVQSDRTVLVDFWAPWCGPCKTVAPLLEDIADEFSEQLTVAKVNVDDSP 64

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           EI+ + +I  IPTL LF+DG VI +   GA S S +  ++   +
Sbjct: 65  EITAKMRIRGIPTLALFQDGDVIAQHA-GAGSLSQLRTFVKGHL 107


>gi|325261236|ref|ZP_08127974.1| thioredoxin [Clostridium sp. D5]
 gi|324032690|gb|EGB93967.1| thioredoxin [Clostridium sp. D5]
          Length = 105

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + +   +F     +   P++V+FWA WC  C +L P+ID + +EL   +KI K++++
Sbjct: 1   MSYITLTNNNFQEHAQQAGTPLIVEFWAPWCGYCRRLGPVIDQLEEELQGTIKIGKINLD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  E++ R+++ +IP+L++FKDG     ++    S+++I +WI
Sbjct: 61  DEPELAERFEVDTIPSLLMFKDGHH-GELLVNPGSKAEIQKWI 102


>gi|310830108|ref|YP_003962465.1| hypothetical protein ELI_4568 [Eubacterium limosum KIST612]
 gi|308741842|gb|ADO39502.1| hypothetical protein ELI_4568 [Eubacterium limosum KIST612]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 4   LKVDTKSFDSEVLECS-NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           + VD  +F++EVL  +  PV+VDFWA WC PC  L PII++IA E+    KI KL+++E+
Sbjct: 5   ISVDMTNFEAEVLNYTEGPVMVDFWAEWCGPCKALLPIIEEIAGEVPATAKICKLNVDEN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           ++++ ++ + SIPT +  KDG  ++R +     Q  I
Sbjct: 65  TDLARQFHVMSIPTCVFLKDGSEVERFVGSRDRQEYI 101


>gi|83721362|ref|YP_442739.1| thioredoxin [Burkholderia thailandensis E264]
 gi|83655187|gb|ABC39250.1| thioredoxin [Burkholderia thailandensis E264]
          Length = 146

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +V++   PV++DFWA WC PC  ++PI+D++A +  DK++I K++++++     ++
Sbjct: 50  SFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDDNQATPAKF 109

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 110 GVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 146


>gi|295676457|ref|YP_003604981.1| thioredoxin [Burkholderia sp. CCGE1002]
 gi|295436300|gb|ADG15470.1| thioredoxin [Burkholderia sp. CCGE1002]
          Length = 108

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +V++   PV++DFWA WC PC  ++PI+D++A + AD++++ K++++E      ++
Sbjct: 12  SFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQVAKINVDEHQSTPVKF 71

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  IPTLILFK+G V  + + GA S+S +  ++
Sbjct: 72  GVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFL 104


>gi|219872296|ref|YP_002476671.1| thioredoxin [Haemophilus parasuis SH0165]
 gi|219692500|gb|ACL33723.1| thioredoxin [Haemophilus parasuis SH0165]
          Length = 104

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +VL+   PV++DFWA WC PC  + P++DD+A  L +K +I K++++E+ +I   +
Sbjct: 11  SFEQDVLKSDVPVLLDFWAPWCGPCRAIGPVLDDLAINLGNKARIVKMNVDENQQIPAEF 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + SIP L++FK+G+V+ + + GA +    +E +
Sbjct: 71  GVRSIPFLLIFKNGEVVAQQV-GAQNLPAFLEHL 103


>gi|254975326|ref|ZP_05271798.1| thioredoxin [Clostridium difficile QCD-66c26]
 gi|255092717|ref|ZP_05322195.1| thioredoxin [Clostridium difficile CIP 107932]
 gi|255100821|ref|ZP_05329798.1| thioredoxin [Clostridium difficile QCD-63q42]
 gi|255306710|ref|ZP_05350881.1| thioredoxin [Clostridium difficile ATCC 43255]
 gi|255314455|ref|ZP_05356038.1| thioredoxin [Clostridium difficile QCD-76w55]
 gi|255517132|ref|ZP_05384808.1| thioredoxin [Clostridium difficile QCD-97b34]
 gi|255650237|ref|ZP_05397139.1| thioredoxin [Clostridium difficile QCD-37x79]
 gi|255655708|ref|ZP_05401117.1| thioredoxin [Clostridium difficile QCD-23m63]
 gi|260683355|ref|YP_003214640.1| thioredoxin [Clostridium difficile CD196]
 gi|260686950|ref|YP_003218083.1| thioredoxin [Clostridium difficile R20291]
 gi|296451714|ref|ZP_06893446.1| thioredoxin [Clostridium difficile NAP08]
 gi|296878958|ref|ZP_06902957.1| thioredoxin [Clostridium difficile NAP07]
 gi|306520216|ref|ZP_07406563.1| thioredoxin [Clostridium difficile QCD-32g58]
 gi|260209518|emb|CBA63091.1| thioredoxin [Clostridium difficile CD196]
 gi|260212966|emb|CBE04259.1| thioredoxin [Clostridium difficile R20291]
 gi|296259477|gb|EFH06340.1| thioredoxin [Clostridium difficile NAP08]
 gi|296430071|gb|EFH15919.1| thioredoxin [Clostridium difficile NAP07]
          Length = 105

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 59/85 (69%)

Query: 6  VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
          ++T  F S V      VVVDF+A+WC PC  L P+  ++ +E+ DK +  K+DI+ES EI
Sbjct: 5  INTSEFRSSVEGSKGVVVVDFFATWCGPCNMLGPVFAELGEEMKDKARFVKVDIDESLEI 64

Query: 66 STRYQISSIPTLILFKDGKVIDRMM 90
          + ++ +S++PT+I+FKDGK ++ ++
Sbjct: 65 AQQFNVSTVPTMIIFKDGKPVETLI 89


>gi|255693698|ref|ZP_05417373.1| thioredoxin [Bacteroides finegoldii DSM 17565]
 gi|260620515|gb|EEX43386.1| thioredoxin [Bacteroides finegoldii DSM 17565]
          Length = 104

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T S   E+L    PVVVDFWA WC PC  ++PII+++A E   +V I K D++E+S++  
Sbjct: 6   TDSNYKEILAEGKPVVVDFWAPWCGPCKMVAPIIEELAAEFEGQVIIGKCDVDENSDLPA 65

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            Y I +IPT++ FK+G+++D+ + GA S+   +E
Sbjct: 66  EYGIRNIPTVLFFKNGEIVDKQV-GAVSKPVFVE 98


>gi|28212132|ref|NP_783076.1| thioredoxin [Clostridium tetani E88]
 gi|28204576|gb|AAO37013.1| thioredoxin [Clostridium tetani E88]
          Length = 105

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 64/92 (69%), Gaps = 3/92 (3%)

Query: 11  FDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQ 70
           F+SEVL      VVDFWA WC PC  L P+I++++ E++++VK  K++++E+   +T Y+
Sbjct: 10  FNSEVLNSDKVTVVDFWAPWCGPCRMLGPVIEELSQEMSEQVKFVKVNVDENPMSATEYK 69

Query: 71  ISSIPTLILFKDGKVIDRMM---PGASSQSDI 99
           ++SIPT+ +FKDGK+ + ++   P  + QS I
Sbjct: 70  VASIPTVAVFKDGKIQETLVGFRPKQAMQSSI 101


>gi|332678706|gb|AEE87835.1| thioredoxin [Francisella cf. novicida Fx1]
          Length = 107

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 55/75 (73%)

Query: 10 SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           F+SEV+    PV++DFWA WC PC  L+PI+D +AD   DK+K+ K++I+++ E + ++
Sbjct: 11 QFESEVVNSDIPVLLDFWAPWCGPCKMLAPILDQVADHYGDKIKVCKINIDDNEETAMKF 70

Query: 70 QISSIPTLILFKDGK 84
           +  +PTL++FKDG+
Sbjct: 71 GVRGVPTLMVFKDGE 85


>gi|260174202|ref|ZP_05760614.1| thioredoxin (thioredoxin M) [Bacteroides sp. D2]
 gi|315922469|ref|ZP_07918709.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313696344|gb|EFS33179.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 104

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 8   TKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIST 67
           T S   EVL    PVVVDFWA WC PC  ++PII+++A E   +V I K D++E+ +++ 
Sbjct: 6   TDSNYKEVLAEGKPVVVDFWAPWCGPCKMVAPIIEELAAEFEGQVIIGKCDVDENGDMAA 65

Query: 68  RYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            Y I +IPT++ FK+G+++D+ + GA ++S   E
Sbjct: 66  EYGIRNIPTVLFFKNGEIVDKQV-GAVAKSVFAE 98


>gi|190575354|ref|YP_001973199.1| putative thioredoxin protein [Stenotrophomonas maltophilia K279a]
 gi|190013276|emb|CAQ46910.1| putative thioredoxin protein [Stenotrophomonas maltophilia K279a]
          Length = 285

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 65/98 (66%), Gaps = 3/98 (3%)

Query: 8   TKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           T +F++EVL+ S   PV+VDFWA+WC PC  L P+++ +A E     ++ K+D+++  +I
Sbjct: 12  TATFEAEVLQKSLQTPVLVDFWATWCGPCKTLGPMLEKLAAEYNGAFELAKVDVDKEQQI 71

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  +QI S+PT+ L K G+++D   PGA  +  + E++
Sbjct: 72  AAAFQIRSVPTVFLVKGGQLVD-GFPGAIPEGQLREFL 108


>gi|167855578|ref|ZP_02478338.1| thioredoxin [Haemophilus parasuis 29755]
 gi|167853269|gb|EDS24523.1| thioredoxin [Haemophilus parasuis 29755]
          Length = 104

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 10  SFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRY 69
           SF+ +VL+   PV++DFWA WC PC  + P++DD+A  L +K +I K++++E+ +I   +
Sbjct: 11  SFEQDVLKSDVPVLLDFWAPWCGPCRAIGPVLDDLAINLGNKARIVKMNVDENQQIPAEF 70

Query: 70  QISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            + SIP L++FK+G+V+ + + GA +    +E +
Sbjct: 71  GVRSIPFLLIFKNGEVVAQQV-GAQNLPAFLEHL 103


>gi|295107988|emb|CBL21941.1| thioredoxin [Ruminococcus obeum A2-162]
          Length = 100

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 3  ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
          A  + +++F+ EVL+   P+++DFWA+WC PC++  PI++++A+E      + K+D+++ 
Sbjct: 2  AKTITSRNFEEEVLKSEKPILIDFWATWCGPCMRQGPIVEELAEE---GYNVGKIDVDQE 58

Query: 63 SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
            ++ ++++ SIPTL++FKDGK   R++ G +++ DI
Sbjct: 59 MGLAQQFRVVSIPTLLIFKDGKEAHRLV-GLTAKEDI 94


>gi|225166007|ref|ZP_03727758.1| thioredoxi