PSIBLAST alignment of GI: 254780822 and protein with PDB id: 1zzy

>gi|73536038|pdb|1ZZY|A Chain A, Crystal Structure Of Thioredoxin Mutant L7v Length = 108
>gi|73536039|pdb|1ZZY|B Chain B, Crystal Structure Of Thioredoxin Mutant L7v Length = 108
 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + V   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107