PSIBLAST alignment of GI: 254780822 and protein with PDB id: 2h71

>gi|149241884|pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal (P61) Space Group Length = 108
>gi|149241885|pdb|2H71|B Chain B, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal (P61) Space Group Length = 108
 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IA+E   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107