PSIBLAST alignment of GI: 254780822 and protein with PDB id: 2h72

>gi|149241886|pdb|2H72|A Chain A, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal (P61) Space Group Length = 108
>gi|149241887|pdb|2H72|B Chain B, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal (P61) Space Group Length = 108
 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGDVAATKV-GALSKGQLKEFLDANL 107