PSIBLAST alignment of GI: 254780822 and protein with PDB id: 2o8v

>gi|145579981|pdb|2O8V|B Chain B, Paps Reductase In A Covalent Complex With Thioredoxin C35a Length = 128
 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC P   ++PI+D+IADE   K+ + KL+I+++
Sbjct: 24  IIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQN 83

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 84  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 127