BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780822|ref|YP_003065235.1| thioredoxin [Candidatus
Liberibacter asiaticus str. psy62]
         (107 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|170749779|ref|YP_001756039.1| thioredoxin [Methylobacterium radiotolerans JCM 2831]
 gi|170656301|gb|ACB25356.1| thioredoxin [Methylobacterium radiotolerans JCM 2831]
          Length = 107

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/103 (45%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF+ +VL+ + PVVVDFWA WC PC ++ P +++IA +L  KVKI K++++
Sbjct: 1   MATVKVTDASFEQDVLKSAEPVVVDFWAEWCGPCRQIGPALEEIATDLQGKVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ +I+ +Y I SIPTL+LFK+G+ +D+ + GA+ + D+  WI
Sbjct: 61  ENPQIAAQYGIRSIPTLLLFKNGERVDQKV-GAAPKGDLSRWI 102


>gi|95928472|ref|ZP_01311219.1| thioredoxin [Desulfuromonas acetoxidans DSM 684]
 gi|95135262|gb|EAT16914.1| thioredoxin [Desulfuromonas acetoxidans DSM 684]
          Length = 109

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 77/110 (70%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    ++    +FD+EVL+   PV+VDFWA+WC PC  ++P+ID++A++ + +VKI K+
Sbjct: 1   MANDNVVQFTDDNFDAEVLKADQPVLVDFWATWCAPCKAIAPVIDELANQFSGQVKIGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+     +Y +  IPTL+LFK+G+V+D+++ GA  ++ + E+I   +
Sbjct: 61  NVDENPNTPGQYGVRGIPTLVLFKNGEVVDQLV-GAIPKNQLEEFINKAL 109


>gi|240949004|ref|ZP_04753358.1| thioredoxin [Actinobacillus minor NM305]
 gi|257465348|ref|ZP_05629719.1| thioredoxin [Actinobacillus minor 202]
 gi|240296591|gb|EER47209.1| thioredoxin [Actinobacillus minor NM305]
 gi|257451008|gb|EEV25051.1| thioredoxin [Actinobacillus minor 202]
          Length = 105

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L+V   +F+ EVL+   PV++DFWA WC PC  ++PI+D++++E A + KI K++++E+
Sbjct: 2   TLQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVAPILDELSEEFAGRAKIAKVNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I  ++ I SIPTLILFK+G+V+   + GA  +S +  ++   +
Sbjct: 62  QQIPAQFGIRSIPTLILFKNGQVVATQV-GALPKSQLAAFVEQAL 105


>gi|25067747|gb|AAN65341.1| thioredoxin/transketolase fusion protein [synthetic construct]
          Length = 804

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|575449|gb|AAA67270.1| Derived from E. coli thioredoxin gene; normal translation
           termination codon following nucleotide 3050 has been
           removed [Cloning vector pTRXFUS]
          Length = 134

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|188532352|ref|YP_001906149.1| Thioredoxin 1 [Erwinia tasmaniensis Et1/99]
 gi|188027394|emb|CAO95241.1| Thioredoxin 1 [Erwinia tasmaniensis Et1/99]
          Length = 109

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+     +VDFWA WC PC  ++PI+D++A E   K+ I KL+
Sbjct: 1   MSDKIVHLTDDSFENDVLKADGLTLVDFWAEWCGPCKMIAPILDEVAAEYEGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 108


>gi|253991617|ref|YP_003042973.1| thioredoxin 1 [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253783067|emb|CAQ86232.1| thioredoxin 1 (trx1) (trx) [Photorhabdus asymbiotica]
          Length = 108

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+ + PV+VDFWA+WC PC  ++PI+D+IA E + K+ I KL+
Sbjct: 1   MSDKIIHLSDDSFDADVLKAAGPVLVDFWAAWCGPCKMIAPILDEIAPEYSGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFKDG+V    + GA S++ + E++ + +
Sbjct: 61  IDDNPATAPKYGIRGIPTLLLFKDGQVAATKV-GALSKTQLKEFLDANL 108


>gi|32035159|ref|ZP_00135199.1| COG0526: Thiol-disulfide isomerase and thioredoxins [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208550|ref|YP_001053775.1| thioredoxin [Actinobacillus pleuropneumoniae L20]
 gi|165976501|ref|YP_001652094.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|190150405|ref|YP_001968930.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|303250174|ref|ZP_07336376.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|303253346|ref|ZP_07339495.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307245996|ref|ZP_07528078.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307249153|ref|ZP_07531158.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|307250332|ref|ZP_07532281.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307252714|ref|ZP_07534605.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307254975|ref|ZP_07536794.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307259413|ref|ZP_07541138.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|307261559|ref|ZP_07543227.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|307263748|ref|ZP_07545354.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|322513964|ref|ZP_08067039.1| thioredoxin [Actinobacillus ureae ATCC 25976]
 gi|126097342|gb|ABN74170.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|165876602|gb|ABY69650.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|189915536|gb|ACE61788.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|302648028|gb|EFL78235.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302651237|gb|EFL81391.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306852931|gb|EFM85154.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306854323|gb|EFM86521.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|306857607|gb|EFM89714.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306859746|gb|EFM91768.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306862093|gb|EFM94068.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306866349|gb|EFM98212.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306868682|gb|EFN00491.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306870869|gb|EFN02607.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|322120190|gb|EFX92148.1| thioredoxin [Actinobacillus ureae ATCC 25976]
          Length = 105

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L+V   +F+ EVL+   PV++DFWA WC PC  ++PI+D++++E A + KI K++++E+
Sbjct: 2   TLQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVAPILDELSEEFAGRAKIAKVNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I  ++ I SIPTLILFK+G+V+   + GA  +S +  ++   +
Sbjct: 62  QQIPAQFGIRSIPTLILFKNGEVVATQV-GALPKSQLSAFVEQAL 105


>gi|238789357|ref|ZP_04633143.1| Thioredoxin 1 [Yersinia frederiksenii ATCC 33641]
 gi|238722500|gb|EEQ14154.1| Thioredoxin 1 [Yersinia frederiksenii ATCC 33641]
          Length = 108

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+
Sbjct: 1   MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LF+DG+V+   + GA S+  +  ++ + +
Sbjct: 61  IDENQGTAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKAFLDANL 108


>gi|37528481|ref|NP_931826.1| thioredoxin 1 (TRX1) (TRX) [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787919|emb|CAE17036.1| thioredoxin 1 (TRX1) (TRX) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 108

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL  + PV+VDFWA+WC PC  ++PI+D+IA E + K+ ITKL+
Sbjct: 1   MSDKIIHLSDASFDTDVLNAAGPVLVDFWAAWCGPCKMIAPILDEIAPEYSGKLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFKDG+V    + GA S++ + E++ + +
Sbjct: 61  IDDNPATAPKYGIRGIPTLLLFKDGQVAATKV-GALSKTQLKEFLDANL 108


>gi|313902375|ref|ZP_07835778.1| thioredoxin [Thermaerobacter subterraneus DSM 13965]
 gi|313467306|gb|EFR62817.1| thioredoxin [Thermaerobacter subterraneus DSM 13965]
          Length = 109

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   L +  + FD+EVL+   PV+VDFWA WC PC  ++PI+++IA E A ++K+ KL+
Sbjct: 1   MAAGILDLTAEQFDAEVLQSDQPVLVDFWAPWCGPCRMIAPIVEEIAQEYAGRLKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++   I+ RY + SIPTL++FK G+ + R++ G   + ++ + IL  +
Sbjct: 61  VDDHGVIAGRYGVMSIPTLLVFKGGQPVARIV-GFRPKEELEQEILKAI 108


>gi|292486657|ref|YP_003529527.1| thioredoxin M-type protein [Erwinia amylovora CFBP1430]
 gi|292897894|ref|YP_003537263.1| thioredoxin [Erwinia amylovora ATCC 49946]
 gi|291197742|emb|CBJ44837.1| thioredoxin [Erwinia amylovora ATCC 49946]
 gi|291552074|emb|CBA19111.1| Thioredoxin M-type, chloroplast precursor (Trx-M) [Erwinia
           amylovora CFBP1430]
 gi|312170723|emb|CBX78985.1| Thioredoxin M-type, chloroplast precursor (Trx-M) [Erwinia
           amylovora ATCC BAA-2158]
          Length = 109

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+     +VDFWA WC PC  ++PI+D++A E   K+ I KL+
Sbjct: 1   MSDKIVHLTDDSFETDVLKADGLTLVDFWAEWCGPCKMIAPILDEVAAEYEGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 108


>gi|268592935|ref|ZP_06127156.1| thioredoxin [Providencia rettgeri DSM 1131]
 gi|291311727|gb|EFE52180.1| thioredoxin [Providencia rettgeri DSM 1131]
          Length = 108

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF +EVL  S+PV+VDFWA+WC PC  ++PI+D++A+E   K+ I KL+
Sbjct: 1   MSDKIIHITDASFATEVLNASSPVLVDFWAAWCGPCKMIAPILDEVAEEYTGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S++ + E++   +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKTQLKEFLDENL 108


>gi|123440564|ref|YP_001004558.1| thioredoxin 1 [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|332159794|ref|YP_004296371.1| thioredoxin 1 [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|122087525|emb|CAL10306.1| thioredoxin 1 [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|318607667|emb|CBY29165.1| thioredoxin [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325664024|gb|ADZ40668.1| thioredoxin 1 [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 108

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+
Sbjct: 1   MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LF+DG+V+   + GA S+  + E++ + +
Sbjct: 61  IDDNQGTAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKEFLDANL 108


>gi|259906864|ref|YP_002647220.1| Thioredoxin 1 [Erwinia pyrifoliae Ep1/96]
 gi|224962486|emb|CAX53941.1| Thioredoxin 1 [Erwinia pyrifoliae Ep1/96]
 gi|283476656|emb|CAY72484.1| Thioredoxin M-type, chloroplast precursor (Trx-M) [Erwinia
           pyrifoliae DSM 12163]
 gi|310766112|gb|ADP11062.1| Thioredoxin 1 [Erwinia sp. Ejp617]
          Length = 109

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+     +VDFWA WC PC  ++PI+D++A E   K+ + KL+
Sbjct: 1   MSDKIVHLTDDSFETDVLKADGLTLVDFWAEWCGPCKMIAPILDEVAAEYEGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 108


>gi|238784756|ref|ZP_04628759.1| Thioredoxin 1 [Yersinia bercovieri ATCC 43970]
 gi|238798894|ref|ZP_04642360.1| Thioredoxin 1 [Yersinia mollaretii ATCC 43969]
 gi|238714352|gb|EEQ06361.1| Thioredoxin 1 [Yersinia bercovieri ATCC 43970]
 gi|238717248|gb|EEQ09098.1| Thioredoxin 1 [Yersinia mollaretii ATCC 43969]
          Length = 108

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +  +SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+
Sbjct: 1   MSDKIIHLSDESFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LF+DG+V+   + GA S+  +  ++ + +
Sbjct: 61  IDDNQGTAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKAFLDANL 108


>gi|242279289|ref|YP_002991418.1| thioredoxin [Desulfovibrio salexigens DSM 2638]
 gi|242122183|gb|ACS79879.1| thioredoxin [Desulfovibrio salexigens DSM 2638]
          Length = 106

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 73/106 (68%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L+V   +F  EVL    PV+VDFWA WC PC  + P+ID++A+E + ++KI K++++
Sbjct: 1   MA-LQVTDSNFQEEVLNSDKPVLVDFWAPWCGPCRAMGPVIDELAEEFSGQIKICKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++     +Y I +IPTLILFKDG+V+D+   GA S+S I E I S+
Sbjct: 60  DNPASPGKYGIRAIPTLILFKDGEVVDQ-TTGAVSKSSIKEMISSK 104


>gi|76812139|ref|YP_333769.1| thioredoxin 1 [Burkholderia pseudomallei 1710b]
 gi|76581592|gb|ABA51067.1| thioredoxin 1 [Burkholderia pseudomallei 1710b]
          Length = 146

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV++DFWA WC PC  ++PI+D++A +  DK++I K++
Sbjct: 39  MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 98

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+     ++ +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 99  VDENQATPAKFGVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 146


>gi|300714782|ref|YP_003739585.1| Thioredoxin 1 [Erwinia billingiae Eb661]
 gi|299060618|emb|CAX57725.1| Thioredoxin 1 [Erwinia billingiae Eb661]
          Length = 110

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    + +   SFDS+VL+     +VDFWA WC PC  ++PI+D++A+E   K+ I KL
Sbjct: 1   MSSDKIVHLTDDSFDSDVLKAEGLTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  NIDDNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|241761924|ref|ZP_04760009.1| thioredoxin [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373604|gb|EER63176.1| thioredoxin [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 106

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   SF+++VL+   PVVVDFWA WC PC +++P + +IA EL  K+ + K++++
Sbjct: 1   MSVINVTDASFEADVLKSPVPVVVDFWAEWCGPCRQIAPALGEIASELEGKMTLAKVEVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E ++R+ I +IPTL+LFK+G+++     GA  +S +  WI S +
Sbjct: 61  NNIETASRFGIRNIPTLLLFKNGEIVATRTGGA-PKSQLKSWIESSL 106


>gi|238759815|ref|ZP_04620972.1| Thioredoxin 1 [Yersinia aldovae ATCC 35236]
 gi|238701958|gb|EEP94518.1| Thioredoxin 1 [Yersinia aldovae ATCC 35236]
          Length = 108

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IADE   ++ ITKL+
Sbjct: 1   MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIADEYEGRLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LF+DG+V+   + GA S+  +  ++ + +
Sbjct: 61  IDDNQGTAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKAFLDANL 108


>gi|56551993|ref|YP_162832.1| thioredoxin [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260752464|ref|YP_003225357.1| thioredoxin [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|56543567|gb|AAV89721.1| thioredoxin [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258551827|gb|ACV74773.1| thioredoxin [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 106

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   SF+++VL+   PVVVDFWA WC PC +++P + +IA EL  K+ + K++++
Sbjct: 1   MSVINVTDASFEADVLKSPVPVVVDFWAEWCGPCRQIAPALGEIASELEGKMTLAKVEVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E ++R+ I +IPTL+LFK+G+V+     GA  +S +  WI S +
Sbjct: 61  NNIETASRFGIRNIPTLLLFKNGEVVATRTGGA-PKSQLKSWIESSL 106


>gi|238750654|ref|ZP_04612153.1| Thioredoxin 1 [Yersinia rohdei ATCC 43380]
 gi|238794286|ref|ZP_04637899.1| Thioredoxin 1 [Yersinia intermedia ATCC 29909]
 gi|238711044|gb|EEQ03263.1| Thioredoxin 1 [Yersinia rohdei ATCC 43380]
 gi|238726370|gb|EEQ17911.1| Thioredoxin 1 [Yersinia intermedia ATCC 29909]
          Length = 108

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+
Sbjct: 1   MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LF+DG+V+   + GA S+  +  ++ + +
Sbjct: 61  IDDNQGTAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKAFLDANL 108


>gi|307257131|ref|ZP_07538903.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306864293|gb|EFM96204.1| Thioredoxin [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 105

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L+V   +F+ EVL+   PV++DFWA WC PC  ++PI+D++++E A + KI K++++E+
Sbjct: 2   TLQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVTPILDELSEEFAGRAKIAKVNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I  ++ I SIPTLILFK+G+V+   + GA  +S +  ++   +
Sbjct: 62  QQIPAQFGIRSIPTLILFKNGEVVATQV-GALPKSQLSAFVEQAL 105


>gi|22124275|ref|NP_667698.1| thioredoxin 1 [Yersinia pestis KIM 10]
 gi|45442929|ref|NP_994468.1| thioredoxin 1 [Yersinia pestis biovar Microtus str. 91001]
 gi|51594522|ref|YP_068713.1| thioredoxin 1 [Yersinia pseudotuberculosis IP 32953]
 gi|108806148|ref|YP_650064.1| thioredoxin 1 [Yersinia pestis Antiqua]
 gi|108810261|ref|YP_646028.1| thioredoxin 1 [Yersinia pestis Nepal516]
 gi|153950031|ref|YP_001399176.1| thioredoxin [Yersinia pseudotuberculosis IP 31758]
 gi|153997076|ref|ZP_02022209.1| thioredoxin 1 [Yersinia pestis CA88-4125]
 gi|162421208|ref|YP_001605107.1| thioredoxin 1 [Yersinia pestis Angola]
 gi|165926289|ref|ZP_02222121.1| thioredoxin [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165939713|ref|ZP_02228256.1| thioredoxin [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009693|ref|ZP_02230591.1| thioredoxin [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213563|ref|ZP_02239598.1| thioredoxin [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167402076|ref|ZP_02307555.1| thioredoxin [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420843|ref|ZP_02312596.1| thioredoxin [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167425907|ref|ZP_02317660.1| thioredoxin [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170026245|ref|YP_001722750.1| thioredoxin [Yersinia pseudotuberculosis YPIII]
 gi|186893520|ref|YP_001870632.1| thioredoxin [Yersinia pseudotuberculosis PB1/+]
 gi|218930871|ref|YP_002348746.1| thioredoxin 1 [Yersinia pestis CO92]
 gi|229837201|ref|ZP_04457366.1| thioredoxin 1 [Yersinia pestis Pestoides A]
 gi|229839561|ref|ZP_04459720.1| thioredoxin 1 [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229900124|ref|ZP_04515261.1| thioredoxin 1 [Yersinia pestis biovar Orientalis str. India 195]
 gi|229900429|ref|ZP_04515558.1| thioredoxin 1 [Yersinia pestis Nepal516]
 gi|270488785|ref|ZP_06205859.1| thioredoxin [Yersinia pestis KIM D27]
 gi|294505531|ref|YP_003569593.1| thioredoxin 1 [Yersinia pestis Z176003]
 gi|21957044|gb|AAM83949.1|AE013636_7 thioredoxin 1 [Yersinia pestis KIM 10]
 gi|45437796|gb|AAS63345.1| thioredoxin 1 [Yersinia pestis biovar Microtus str. 91001]
 gi|51587804|emb|CAH19406.1| thioredoxin 1 [Yersinia pseudotuberculosis IP 32953]
 gi|108773909|gb|ABG16428.1| thioredoxin 1 [Yersinia pestis Nepal516]
 gi|108778061|gb|ABG12119.1| thioredoxin 1 [Yersinia pestis Antiqua]
 gi|115349482|emb|CAL22455.1| thioredoxin 1 [Yersinia pestis CO92]
 gi|149289382|gb|EDM39460.1| thioredoxin 1 [Yersinia pestis CA88-4125]
 gi|152961526|gb|ABS48987.1| thioredoxin [Yersinia pseudotuberculosis IP 31758]
 gi|162354023|gb|ABX87971.1| thioredoxin [Yersinia pestis Angola]
 gi|165912403|gb|EDR31037.1| thioredoxin [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921813|gb|EDR39010.1| thioredoxin [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991615|gb|EDR43916.1| thioredoxin [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205236|gb|EDR49716.1| thioredoxin [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960972|gb|EDR56993.1| thioredoxin [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167048550|gb|EDR59958.1| thioredoxin [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167055055|gb|EDR64854.1| thioredoxin [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169752779|gb|ACA70297.1| thioredoxin [Yersinia pseudotuberculosis YPIII]
 gi|186696546|gb|ACC87175.1| thioredoxin [Yersinia pseudotuberculosis PB1/+]
 gi|229682448|gb|EEO78535.1| thioredoxin 1 [Yersinia pestis Nepal516]
 gi|229686904|gb|EEO78983.1| thioredoxin 1 [Yersinia pestis biovar Orientalis str. India 195]
 gi|229695927|gb|EEO85974.1| thioredoxin 1 [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706144|gb|EEO92153.1| thioredoxin 1 [Yersinia pestis Pestoides A]
 gi|262363597|gb|ACY60318.1| thioredoxin 1 [Yersinia pestis D106004]
 gi|262367525|gb|ACY64082.1| thioredoxin 1 [Yersinia pestis D182038]
 gi|270337289|gb|EFA48066.1| thioredoxin [Yersinia pestis KIM D27]
 gi|294355990|gb|ADE66331.1| thioredoxin 1 [Yersinia pestis Z176003]
 gi|320013531|gb|ADV97102.1| thioredoxin 1 [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 108

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+ S  V+VDFWA WC PC  ++PI+D+IA+E   ++ I KL+
Sbjct: 1   MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LF+DG+V+   + GA S+  +  ++ + +
Sbjct: 61  IDDNQGTAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKAFLDANL 108


>gi|308051268|ref|YP_003914834.1| thioredoxin [Ferrimonas balearica DSM 9799]
 gi|307633458|gb|ADN77760.1| thioredoxin [Ferrimonas balearica DSM 9799]
          Length = 108

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++VL+   PV+VDFWA WC PC  ++P++D++A+E  D++ I KL+
Sbjct: 1   MSDKIVQLSDDSFETDVLKADKPVLVDFWAEWCGPCKMIAPVLDELAEEYGDQLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++SE   +Y I  IPTL+LFKDG++    + GA+S++ + E+I + +
Sbjct: 61  VDQNSETPPKYGIRGIPTLLLFKDGQLAGTKV-GAASKTQLKEFIDAHL 108


>gi|15606934|ref|NP_214315.1| thioredoxin [Aquifex aeolicus VF5]
 gi|2984180|gb|AAC07712.1| thioredoxin [Aquifex aeolicus VF5]
          Length = 139

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 77/107 (71%), Gaps = 3/107 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   ++++ ++++ EVL+   PV+VDFWA WC PC  ++PII++IA+EL DKVK+ KL+
Sbjct: 1   MAGRVIELNEQNWEQEVLQSDKPVLVDFWAPWCGPCRIIAPIIEEIAEELGDKVKVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            +E+  I+ RY I +IPT+ILFK+G+V+D  + G   +  + +W LS
Sbjct: 61  TDENPNIAMRYGIRAIPTIILFKNGEVVDTRI-GVQPKERLNKWFLS 106


>gi|255020936|ref|ZP_05292992.1| Thioredoxin [Acidithiobacillus caldus ATCC 51756]
 gi|254969727|gb|EET27233.1| Thioredoxin [Acidithiobacillus caldus ATCC 51756]
          Length = 108

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + L V   SF+++VL+ S PV+VDFWA WC PC  ++PI++++A E AD+V + K +I+E
Sbjct: 4   AILYVSDDSFENDVLKSSKPVLVDFWAEWCGPCKMIAPILEEVAKEYADRVTVAKFNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     +Y I  IPTL+LFK+GK+    + GA S++ +  ++ S++
Sbjct: 64  NPATPPQYGIRGIPTLLLFKNGKLEATKV-GALSKAQLQAFLDSQL 108


>gi|293393865|ref|ZP_06638172.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Serratia odorifera
           DSM 4582]
 gi|291423692|gb|EFE96914.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Serratia odorifera
           DSM 4582]
          Length = 108

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF +EVL+   P++VDFWA WC PC  ++PI+++IADE   K+ I+KL+
Sbjct: 1   MSDKIIHLTDDSFATEVLQADGPILVDFWAEWCGPCKMIAPILNEIADEFDGKLTISKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + +++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKDFLNANL 108


>gi|83721362|ref|YP_442739.1| thioredoxin [Burkholderia thailandensis E264]
 gi|83655187|gb|ABC39250.1| thioredoxin [Burkholderia thailandensis E264]
          Length = 146

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV++DFWA WC PC  ++PI+D++A +  DK++I K++
Sbjct: 39  MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 98

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++     ++ +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 99  VDDNQATPAKFGVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 146


>gi|220921617|ref|YP_002496918.1| thioredoxin [Methylobacterium nodulans ORS 2060]
 gi|219946223|gb|ACL56615.1| thioredoxin [Methylobacterium nodulans ORS 2060]
          Length = 107

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/105 (45%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF  +VLE S PVVVDFWA WC PC  + P +++I+ E+  +VKI K++++
Sbjct: 1   MATVKVTDASFKQDVLEASEPVVVDFWAEWCGPCRAIGPALEEISSEMQGRVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI S
Sbjct: 61  ENPGIASEYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWIQS 104


>gi|154247229|ref|YP_001418187.1| thioredoxin [Xanthobacter autotrophicus Py2]
 gi|154161314|gb|ABS68530.1| thioredoxin [Xanthobacter autotrophicus Py2]
          Length = 106

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 79/107 (73%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  KV  ++F+ +VL+ S PV+VDFWA WC PC  ++PI+++++ E+ +K++I KL+++
Sbjct: 1   MSVEKVSDQNFEQDVLQSSAPVIVDFWAEWCGPCRMVAPILEEVSGEMGEKIRIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   +++Y I SIPTL+LFKDGK+  R + GA+ ++ +++WI   +
Sbjct: 61  ENPATASKYGIMSIPTLLLFKDGKIASRQV-GAAPKAKLVQWINGAI 106


>gi|260893513|ref|YP_003239610.1| thioredoxin [Ammonifex degensii KC4]
 gi|260865654|gb|ACX52760.1| thioredoxin [Ammonifex degensii KC4]
          Length = 110

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L+V+ ++F++EVL+ + PV+VDFWA WC PC  ++P+++++A E A ++K+ KL+++E+
Sbjct: 2   VLEVNERNFEAEVLQSNIPVLVDFWAPWCGPCRSMAPVVEEVAREFAGRLKVAKLNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ RY I  IPTL+ F++GKVI + + G + +  ++ W+   +
Sbjct: 62  MSLAQRYGIRGIPTLLFFREGKVIAQEV-GYTPKETLVAWLDRLL 105


>gi|156935888|ref|YP_001439804.1| thioredoxin [Cronobacter sakazakii ATCC BAA-894]
 gi|260596010|ref|YP_003208581.1| thioredoxin [Cronobacter turicensis z3032]
 gi|296105328|ref|YP_003615474.1| thioredoxin [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|156534142|gb|ABU78968.1| hypothetical protein ESA_03776 [Cronobacter sakazakii ATCC BAA-894]
 gi|260215187|emb|CBA27019.1| Thioredoxin-1 [Cronobacter turicensis z3032]
 gi|295059787|gb|ADF64525.1| thioredoxin [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 109

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+     +VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|152972775|ref|YP_001337921.1| thioredoxin [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206577583|ref|YP_002241151.1| thioredoxin [Klebsiella pneumoniae 342]
 gi|262040903|ref|ZP_06014129.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|288937790|ref|YP_003441849.1| thioredoxin [Klebsiella variicola At-22]
 gi|330012118|ref|ZP_08307280.1| thioredoxin [Klebsiella sp. MS 92-3]
 gi|150957624|gb|ABR79654.1| thioredoxin [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206566641|gb|ACI08417.1| thioredoxin [Klebsiella pneumoniae 342]
 gi|259041792|gb|EEW42837.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|288892499|gb|ADC60817.1| thioredoxin [Klebsiella variicola At-22]
 gi|328533933|gb|EGF60592.1| thioredoxin [Klebsiella sp. MS 92-3]
          Length = 109

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|146313636|ref|YP_001178710.1| thioredoxin [Enterobacter sp. 638]
 gi|261343046|ref|ZP_05970904.1| thioredoxin [Enterobacter cancerogenus ATCC 35316]
 gi|145320512|gb|ABP62659.1| thioredoxin [Enterobacter sp. 638]
 gi|288314611|gb|EFC53549.1| thioredoxin [Enterobacter cancerogenus ATCC 35316]
          Length = 109

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGLILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|170738816|ref|YP_001767471.1| thioredoxin [Methylobacterium sp. 4-46]
 gi|168193090|gb|ACA15037.1| thioredoxin [Methylobacterium sp. 4-46]
          Length = 107

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF  +VLE S PVVVDFWA WC PC  + P +++I+ E+  +VKI K++++
Sbjct: 1   MATVKVTDASFRQDVLEASEPVVVDFWAEWCGPCRAIGPALEEISSEMQGRVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI S 
Sbjct: 61  ENPGIASEYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWIQSA 105


>gi|332981517|ref|YP_004462958.1| thioredoxin [Mahella australiensis 50-1 BON]
 gi|332699195|gb|AEE96136.1| thioredoxin [Mahella australiensis 50-1 BON]
          Length = 109

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   +FD EVL+   PV+VDFWA+WC PC  +SPIID++A + A K+K+ K++++E 
Sbjct: 6   VITLTADNFDDEVLKSDKPVLVDFWAAWCGPCRMVSPIIDELAADYAGKIKVGKVNVDEQ 65

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+ RY+I SIPT+ LFKDG+ +D+++ GA  ++D   +I   +
Sbjct: 66  RSIAERYRIMSIPTIYLFKDGQPVDKII-GARPKADFERFIQQAL 109


>gi|317122076|ref|YP_004102079.1| thioredoxin [Thermaerobacter marianensis DSM 12885]
 gi|315592056|gb|ADU51352.1| thioredoxin [Thermaerobacter marianensis DSM 12885]
          Length = 109

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   L +    FD+EVL+   PV+VDFWA WC PC  ++PI+++IA E AD++K+TKL+
Sbjct: 1   MAAGILDLTADRFDTEVLQSDKPVLVDFWAPWCGPCRMIAPIVEEIAQEYADRLKVTKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++   I+ RY + SIPTLI+FK G+ + R++ G   + ++ + IL  +
Sbjct: 61  VDDHGAIAGRYGVMSIPTLIVFKGGQPVTRIV-GFRPKEELEQEILKAI 108


>gi|332282711|ref|ZP_08395124.1| thioredoxin 1 [Shigella sp. D9]
 gi|332105063|gb|EGJ08409.1| thioredoxin 1 [Shigella sp. D9]
          Length = 127

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 19  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 78

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 79  IDQNPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 126


>gi|145579981|pdb|2O8V|B Chain B, Paps Reductase In A Covalent Complex With Thioredoxin C35a
          Length = 128

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC P   ++PI+D+IADE   K+ + KL+I+++
Sbjct: 24  IIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQN 83

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 84  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 127


>gi|328680675|gb|AEB32456.1| tagged TSC2-39 [Synthetic construct]
          Length = 204

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|77920658|ref|YP_358473.1| thioredoxin [Pelobacter carbinolicus DSM 2380]
 gi|77546741|gb|ABA90303.1| thioredoxin [Pelobacter carbinolicus DSM 2380]
          Length = 109

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + +   SFD++VL+ S PV+VDFWASWC PC  ++P ID++A++   +VKI K+
Sbjct: 1   MASDKIVHLSDNSFDADVLKSSEPVLVDFWASWCGPCKAIAPAIDELAEQFDGQVKIGKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+    + Y +  IPTLILFKDG+V+D+++ GA  +  +   I   +
Sbjct: 61  NVDENPATPSNYGVRGIPTLILFKDGQVVDQVV-GAVPKGQLEALIKKAL 109


>gi|149241898|pdb|2H76|A Chain A, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal
           (P61) Space Group
 gi|149241899|pdb|2H76|B Chain B, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +  +SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDESFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|256021477|ref|ZP_05435342.1| thioredoxin [Shigella sp. D9]
 gi|307313642|ref|ZP_07593262.1| thioredoxin [Escherichia coli W]
 gi|306906623|gb|EFN37135.1| thioredoxin [Escherichia coli W]
 gi|315063077|gb|ADT77404.1| thioredoxin 1 [Escherichia coli W]
 gi|323380860|gb|ADX53128.1| thioredoxin [Escherichia coli KO11]
          Length = 109

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|322834950|ref|YP_004214977.1| thioredoxin [Rahnella sp. Y9602]
 gi|321170151|gb|ADW75850.1| thioredoxin [Rahnella sp. Y9602]
          Length = 108

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    V+VDFWA WC PC  ++PI+D+IA E   K+ I KL+
Sbjct: 1   MSDKIIHLTDDSFDNDVLKAEGLVLVDFWAEWCGPCKMIAPILDEIATEFEGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPGTAPKYGIRGIPTLLLFKGGEVAATKV-GALSKGQLKEFLTANL 108


>gi|301021428|ref|ZP_07185452.1| thioredoxin [Escherichia coli MS 69-1]
 gi|300398064|gb|EFJ81602.1| thioredoxin [Escherichia coli MS 69-1]
          Length = 127

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 19  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 78

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 79  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 126


>gi|148071|gb|AAA24696.1| thioredoxin [Escherichia coli]
          Length = 110

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 70/109 (64%), Gaps = 2/109 (1%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V      GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKGQLKEFLDANL 109


>gi|15804371|ref|NP_290411.1| thioredoxin [Escherichia coli O157:H7 EDL933]
 gi|15833968|ref|NP_312741.1| thioredoxin [Escherichia coli O157:H7 str. Sakai]
 gi|30064924|ref|NP_839095.1| thioredoxin [Shigella flexneri 2a str. 2457T]
 gi|56480434|ref|NP_709584.2| thioredoxin [Shigella flexneri 2a str. 301]
 gi|74314295|ref|YP_312714.1| thioredoxin [Shigella sonnei Ss046]
 gi|82546135|ref|YP_410082.1| thioredoxin [Shigella boydii Sb227]
 gi|82779038|ref|YP_405387.1| thioredoxin [Shigella dysenteriae Sd197]
 gi|227888636|ref|ZP_04006441.1| thioredoxin [Escherichia coli 83972]
 gi|237702791|ref|ZP_04533272.1| thioredoxin 1 [Escherichia sp. 3_2_53FAA]
 gi|254038993|ref|ZP_04873044.1| thioredoxin 1 [Escherichia sp. 1_1_43]
 gi|291285196|ref|YP_003502014.1| thioredoxin TrxA [Escherichia coli O55:H7 str. CB9615]
 gi|293417247|ref|ZP_06659872.1| thioredoxin-1 [Escherichia coli B185]
 gi|293468099|ref|ZP_06664511.1| thioredoxin 1 [Escherichia coli B088]
 gi|300818750|ref|ZP_07098957.1| thioredoxin [Escherichia coli MS 107-1]
 gi|300823312|ref|ZP_07103443.1| thioredoxin [Escherichia coli MS 119-7]
 gi|300904032|ref|ZP_07121914.1| thioredoxin [Escherichia coli MS 84-1]
 gi|300921513|ref|ZP_07137857.1| thioredoxin [Escherichia coli MS 115-1]
 gi|300923280|ref|ZP_07139329.1| thioredoxin [Escherichia coli MS 182-1]
 gi|300930056|ref|ZP_07145486.1| thioredoxin [Escherichia coli MS 187-1]
 gi|300947362|ref|ZP_07161558.1| thioredoxin [Escherichia coli MS 116-1]
 gi|300955217|ref|ZP_07167612.1| thioredoxin [Escherichia coli MS 175-1]
 gi|300979309|ref|ZP_07174493.1| thioredoxin [Escherichia coli MS 200-1]
 gi|300985807|ref|ZP_07177599.1| thioredoxin [Escherichia coli MS 45-1]
 gi|301047339|ref|ZP_07194424.1| thioredoxin [Escherichia coli MS 185-1]
 gi|301303675|ref|ZP_07209796.1| thioredoxin [Escherichia coli MS 124-1]
 gi|301325470|ref|ZP_07218953.1| thioredoxin [Escherichia coli MS 78-1]
 gi|301646154|ref|ZP_07246053.1| thioredoxin [Escherichia coli MS 146-1]
 gi|309796279|ref|ZP_07690689.1| thioredoxin [Escherichia coli MS 145-7]
 gi|331644515|ref|ZP_08345635.1| thioredoxin [Escherichia coli H736]
 gi|331649606|ref|ZP_08350688.1| thioredoxin [Escherichia coli M605]
 gi|331655465|ref|ZP_08356458.1| thioredoxin [Escherichia coli M718]
 gi|331675251|ref|ZP_08376002.1| thioredoxin [Escherichia coli TA280]
 gi|331679890|ref|ZP_08380553.1| thioredoxin [Escherichia coli H591]
 gi|25282744|pir||B91218 thioredoxin 1 [imported] - Escherichia coli (strain O157:H7,
           substrain RIMD 0509952)
 gi|25282746|pir||C86064 thioredoxin 1 [imported] - Escherichia coli (strain O157:H7,
           substrain EDL933)
 gi|12518641|gb|AAG58975.1|AE005609_7 thioredoxin 1 [Escherichia coli O157:H7 str. EDL933]
 gi|147611|gb|AAA24534.1| thioredoxin [Escherichia coli]
 gi|148185|gb|AAA67582.1| thioredoxin [Escherichia coli str. K-12 substr. MG1655]
 gi|13364189|dbj|BAB38137.1| thioredoxin 1 [Escherichia coli O157:H7 str. Sakai]
 gi|30043185|gb|AAP18906.1| thioredoxin 1 [Shigella flexneri 2a str. 2457T]
 gi|56383985|gb|AAN45291.2| thioredoxin 1 [Shigella flexneri 2a str. 301]
 gi|73857772|gb|AAZ90479.1| thioredoxin 1 [Shigella sonnei Ss046]
 gi|81243186|gb|ABB63896.1| thioredoxin 1 [Shigella dysenteriae Sd197]
 gi|81247546|gb|ABB68254.1| thioredoxin 1 [Shigella boydii Sb227]
 gi|209753508|gb|ACI75061.1| rho operon leader peptide [Escherichia coli]
 gi|209753510|gb|ACI75062.1| rho operon leader peptide [Escherichia coli]
 gi|209753512|gb|ACI75063.1| rho operon leader peptide [Escherichia coli]
 gi|209753514|gb|ACI75064.1| rho operon leader peptide [Escherichia coli]
 gi|209753516|gb|ACI75065.1| rho operon leader peptide [Escherichia coli]
 gi|226838684|gb|EEH70712.1| thioredoxin 1 [Escherichia sp. 1_1_43]
 gi|226902962|gb|EEH89221.1| thioredoxin 1 [Escherichia sp. 3_2_53FAA]
 gi|227834475|gb|EEJ44941.1| thioredoxin [Escherichia coli 83972]
 gi|290765069|gb|ADD59030.1| thioredoxin TrxA [Escherichia coli O55:H7 str. CB9615]
 gi|291321477|gb|EFE60915.1| thioredoxin 1 [Escherichia coli B088]
 gi|291431015|gb|EFF04010.1| thioredoxin-1 [Escherichia coli B185]
 gi|300300756|gb|EFJ57141.1| thioredoxin [Escherichia coli MS 185-1]
 gi|300308062|gb|EFJ62582.1| thioredoxin [Escherichia coli MS 200-1]
 gi|300317871|gb|EFJ67655.1| thioredoxin [Escherichia coli MS 175-1]
 gi|300403984|gb|EFJ87522.1| thioredoxin [Escherichia coli MS 84-1]
 gi|300407958|gb|EFJ91496.1| thioredoxin [Escherichia coli MS 45-1]
 gi|300411581|gb|EFJ94891.1| thioredoxin [Escherichia coli MS 115-1]
 gi|300420425|gb|EFK03736.1| thioredoxin [Escherichia coli MS 182-1]
 gi|300453024|gb|EFK16644.1| thioredoxin [Escherichia coli MS 116-1]
 gi|300462044|gb|EFK25537.1| thioredoxin [Escherichia coli MS 187-1]
 gi|300524098|gb|EFK45167.1| thioredoxin [Escherichia coli MS 119-7]
 gi|300528716|gb|EFK49778.1| thioredoxin [Escherichia coli MS 107-1]
 gi|300840975|gb|EFK68735.1| thioredoxin [Escherichia coli MS 124-1]
 gi|300847697|gb|EFK75457.1| thioredoxin [Escherichia coli MS 78-1]
 gi|301075623|gb|EFK90429.1| thioredoxin [Escherichia coli MS 146-1]
 gi|308120161|gb|EFO57423.1| thioredoxin [Escherichia coli MS 145-7]
 gi|315254145|gb|EFU34113.1| thioredoxin [Escherichia coli MS 85-1]
 gi|315284669|gb|EFU44114.1| thioredoxin [Escherichia coli MS 110-3]
 gi|315293135|gb|EFU52487.1| thioredoxin [Escherichia coli MS 153-1]
 gi|315296844|gb|EFU56133.1| thioredoxin [Escherichia coli MS 16-3]
 gi|324007444|gb|EGB76663.1| thioredoxin [Escherichia coli MS 57-2]
 gi|324014726|gb|EGB83945.1| thioredoxin [Escherichia coli MS 60-1]
 gi|324016170|gb|EGB85389.1| thioredoxin [Escherichia coli MS 117-3]
 gi|331036187|gb|EGI08422.1| thioredoxin [Escherichia coli H736]
 gi|331041476|gb|EGI13624.1| thioredoxin [Escherichia coli M605]
 gi|331046786|gb|EGI18870.1| thioredoxin [Escherichia coli M718]
 gi|331067537|gb|EGI38941.1| thioredoxin [Escherichia coli TA280]
 gi|331072437|gb|EGI43769.1| thioredoxin [Escherichia coli H591]
          Length = 127

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 19  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 78

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 79  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 126


>gi|157144414|ref|YP_001451733.1| hypothetical protein CKO_00123 [Citrobacter koseri ATCC BAA-895]
 gi|157081619|gb|ABV11297.1| hypothetical protein CKO_00123 [Citrobacter koseri ATCC BAA-895]
          Length = 124

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 16  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 75

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 76  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 123


>gi|289549127|ref|YP_003474115.1| thioredoxin [Thermocrinis albus DSM 14484]
 gi|289182744|gb|ADC89988.1| thioredoxin [Thermocrinis albus DSM 14484]
          Length = 108

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + +   ++ SEV+  S PVVVDFWA WC PC  ++PII+++A EL  KVK  KL+
Sbjct: 1   MAGHVITLTESNWHSEVINSSIPVVVDFWAPWCGPCRIIAPIIEELAAELEGKVKFGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +E+  I+ +Y I +IPT++LFK+G+V+D  + G   +  + + ILS +
Sbjct: 61  TDENPNIAMQYGIRAIPTIMLFKNGEVVDTRI-GVQPKEALKQMILSHL 108


>gi|329297880|ref|ZP_08255216.1| thioredoxin [Plautia stali symbiont]
          Length = 110

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    + +   SFD++VL+     +VDFWA WC PC  ++PI+D++A+E   K+ I KL
Sbjct: 1   MSNDKIVHLTDDSFDTDVLKADGVTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  NIDENPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|300900675|ref|ZP_07118828.1| thioredoxin [Escherichia coli MS 198-1]
 gi|300355824|gb|EFJ71694.1| thioredoxin [Escherichia coli MS 198-1]
          Length = 127

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 19  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 78

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 79  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 126


>gi|163853838|ref|YP_001641881.1| thioredoxin [Methylobacterium extorquens PA1]
 gi|163665443|gb|ABY32810.1| thioredoxin [Methylobacterium extorquens PA1]
          Length = 119

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF+ +VL+ + PVVVDFWA WC PC ++ P +++I+ +L  KVKI K++++
Sbjct: 14  MATVKVTDASFEQDVLQSAEPVVVDFWAEWCGPCRQIGPALEEISADLQGKVKIVKVNVD 73

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI +
Sbjct: 74  ENPGIASTYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWIQA 117


>gi|27065184|pdb|1KEB|A Chain A, Crystal Structure Of Double Mutant M37l,P40s E.Coli
           Thioredoxin
 gi|27065185|pdb|1KEB|B Chain B, Crystal Structure Of Double Mutant M37l,P40s E.Coli
           Thioredoxin
          Length = 108

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++ I+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|149241892|pdb|2H74|A Chain A, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal
           (P61) Space Group
 gi|149241893|pdb|2H74|B Chain B, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|230777|pdb|2TRX|A Chain A, Crystal Structure Of Thioredoxin From Escherichia Coli At
           1.68 Angstroms Resolution
 gi|230778|pdb|2TRX|B Chain B, Crystal Structure Of Thioredoxin From Escherichia Coli At
           1.68 Angstroms Resolution
 gi|2982126|pdb|1T7P|B Chain B, T7 Dna Polymerase Complexed To Dna PrimerTEMPLATE,A
           Nucleoside Triphosphate, And Its Processivity Factor
           Thioredoxin
 gi|50513552|pdb|1SKR|B Chain B, T7 Dna Polymerase Complexed To Dna PrimerTEMPLATE AND
           DDATP
 gi|50513556|pdb|1SKS|B Chain B, Binary 3' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A CIS-Syn Thymine Dimer On The
           Template
 gi|50513560|pdb|1SKW|B Chain B, Binary 3' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A DISORDERED CIS-Syn Thymine
           Dimer On The Template
 gi|50513564|pdb|1SL0|B Chain B, Ternary 3' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A DISORDERED CIS-Syn Thymine
           Dimer On The Template And An Incoming Nucleotide
 gi|50513566|pdb|1SL0|D Chain D, Ternary 3' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A DISORDERED CIS-Syn Thymine
           Dimer On The Template And An Incoming Nucleotide
 gi|50513572|pdb|1SL1|B Chain B, Binary 5' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A CIS-Syn Thymine Dimer On The
           Template
 gi|50513576|pdb|1SL2|B Chain B, Ternary 5' Complex Of T7 Dna Polymerase With A Dna
           PrimerTEMPLATE CONTAINING A CIS-Syn Thymine Dimer On The
           Template And An Incoming Nucleotide
 gi|52695799|pdb|1TK0|B Chain B, T7 Dna Polymerase Ternary Complex With 8 Oxo Guanosine And
           Ddctp At The Insertion Site
 gi|52695803|pdb|1TK5|B Chain B, T7 Dna Polymerase Binary Complex With 8 Oxo Guanosine In
           The Templating Strand
 gi|52695807|pdb|1TK8|B Chain B, T7 Dna Polymerase Ternary Complex With 8 Oxo Guanosine And
           Damp At The Elongation Site
 gi|52695811|pdb|1TKD|B Chain B, T7 Dna Polymerase Ternary Complex With 8 Oxo Guanosine And
           Dcmp At The Elongation Site
 gi|56553843|pdb|1T8E|B Chain B, T7 Dna Polymerase Ternary Complex With Dctp At The
           Insertion Site.
 gi|56554411|pdb|1X9M|B Chain B, T7 Dna Polymerase In Complex With An N-2-
           Acetylaminofluorene-Adducted Dna
 gi|56554415|pdb|1X9S|B Chain B, T7 Dna Polymerase In Complex With A PrimerTEMPLATE DNA
           Containing A Disordered N-2 Aminofluorene On The
           Template, Crystallized With Dideoxy-Ctp As The Incoming
           Nucleotide.
 gi|56554419|pdb|1X9W|B Chain B, T7 Dna Polymerase In Complex With A PrimerTEMPLATE DNA
           Containing A Disordered N-2 Aminofluorene On The
           Template, Crystallized With Dideoxy-Atp As The Incoming
           Nucleotide.
 gi|71042775|pdb|2BTO|T Chain T, Structure Of Btuba From Prosthecobacter Dejongeii
 gi|83753887|pdb|1ZYQ|B Chain B, T7 Dna Polymerase In Complex With 8og And Incoming Ddatp
 gi|116666723|pdb|2AJQ|B Chain B, Structure Of Replicative Dna Polymerase Provides Insigts
           Into The Mechanisms For Processivity, Frameshifting And
           Editing
 gi|116666727|pdb|2AJQ|I Chain I, Structure Of Replicative Dna Polymerase Provides Insigts
           Into The Mechanisms For Processivity, Frameshifting And
           Editing
 gi|149241870|pdb|2H6X|A Chain A, Crystal Structure Of Thioredoxin Wild Type In Hexagonal
           (P61) Space Group
 gi|149241871|pdb|2H6X|B Chain B, Crystal Structure Of Thioredoxin Wild Type In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|238892386|ref|YP_002917120.1| thioredoxin [Klebsiella pneumoniae NTUH-K2044]
 gi|290513186|ref|ZP_06552548.1| thioredoxin [Klebsiella sp. 1_1_55]
 gi|238544702|dbj|BAH61053.1| thioredoxin [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|289774397|gb|EFD82403.1| thioredoxin [Klebsiella sp. 1_1_55]
          Length = 113

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ + KL+
Sbjct: 5   MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLN 64

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 65  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 112


>gi|198282942|ref|YP_002219263.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218668089|ref|YP_002425145.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247463|gb|ACH83056.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218520302|gb|ACK80888.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 108

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + L V   SF+++VL+ S PV+VDFWA WC PC  ++PI+++IADE AD++++ K +I+E
Sbjct: 4   AILYVSDDSFETDVLKSSKPVLVDFWAEWCGPCKMIAPILEEIADEYADRLRVAKFNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     +Y I  IPTL+LFK GK+    + GA S++ +  ++ S++
Sbjct: 64  NPNTPPQYGIRGIPTLLLFKAGKLEATKV-GALSKAQLTAFLDSQL 108


>gi|149241874|pdb|2H6Y|A Chain A, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal
           (P61) Space Group
 gi|149241875|pdb|2H6Y|B Chain B, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IAD+   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADDYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|16762214|ref|NP_457831.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|16767191|ref|NP_462806.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29143703|ref|NP_807045.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56415775|ref|YP_152850.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|67005950|ref|NP_418228.2| thioredoxin 1 [Escherichia coli str. K-12 substr. MG1655]
 gi|89110236|ref|AP_004016.1| thioredoxin 1 [Escherichia coli str. K-12 substr. W3110]
 gi|157158635|ref|YP_001465262.1| thioredoxin [Escherichia coli E24377A]
 gi|157163254|ref|YP_001460572.1| thioredoxin [Escherichia coli HS]
 gi|161617033|ref|YP_001590998.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           B str. SPB7]
 gi|167553315|ref|ZP_02347065.1| thioredoxin [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167994611|ref|ZP_02575702.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168234236|ref|ZP_02659294.1| thioredoxin [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168238372|ref|ZP_02663430.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168244967|ref|ZP_02669899.1| thioredoxin [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168263193|ref|ZP_02685166.1| thioredoxin [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168467668|ref|ZP_02701505.1| thioredoxin [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168822970|ref|ZP_02834970.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|170022192|ref|YP_001727146.1| thioredoxin [Escherichia coli ATCC 8739]
 gi|170083268|ref|YP_001732588.1| thioredoxin 1 [Escherichia coli str. K-12 substr. DH10B]
 gi|170680473|ref|YP_001746100.1| thioredoxin [Escherichia coli SMS-3-5]
 gi|170769809|ref|ZP_02904262.1| thioredoxin [Escherichia albertii TW07627]
 gi|187732135|ref|YP_001882394.1| thioredoxin [Shigella boydii CDC 3083-94]
 gi|187776114|ref|ZP_02800679.2| thioredoxin [Escherichia coli O157:H7 str. EC4196]
 gi|188025205|ref|ZP_02776760.2| thioredoxin [Escherichia coli O157:H7 str. EC4113]
 gi|188493841|ref|ZP_03001111.1| thioredoxin [Escherichia coli 53638]
 gi|189010248|ref|ZP_02805683.2| thioredoxin [Escherichia coli O157:H7 str. EC4076]
 gi|189401853|ref|ZP_02778681.2| thioredoxin [Escherichia coli O157:H7 str. EC4401]
 gi|189403076|ref|ZP_02793065.2| thioredoxin [Escherichia coli O157:H7 str. EC4486]
 gi|189404400|ref|ZP_02789149.2| thioredoxin [Escherichia coli O157:H7 str. EC4501]
 gi|189404879|ref|ZP_02811622.2| thioredoxin [Escherichia coli O157:H7 str. EC869]
 gi|189406048|ref|ZP_02826004.2| thioredoxin [Escherichia coli O157:H7 str. EC508]
 gi|191166127|ref|ZP_03027962.1| thioredoxin [Escherichia coli B7A]
 gi|191174370|ref|ZP_03035875.1| thioredoxin [Escherichia coli F11]
 gi|191174436|ref|ZP_03035938.1| thioredoxin [Escherichia coli F11]
 gi|193066143|ref|ZP_03047198.1| thioredoxin [Escherichia coli E22]
 gi|193071060|ref|ZP_03051987.1| thioredoxin [Escherichia coli E110019]
 gi|194429787|ref|ZP_03062302.1| thioredoxin [Escherichia coli B171]
 gi|194434620|ref|ZP_03066876.1| thioredoxin [Shigella dysenteriae 1012]
 gi|194438595|ref|ZP_03070683.1| thioredoxin [Escherichia coli 101-1]
 gi|194444873|ref|YP_002043153.1| thioredoxin [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194450695|ref|YP_002047936.1| thioredoxin [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194468829|ref|ZP_03074813.1| thioredoxin [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194735451|ref|YP_002116851.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195938069|ref|ZP_03083451.1| thioredoxin [Escherichia coli O157:H7 str. EC4024]
 gi|197249250|ref|YP_002148845.1| thioredoxin [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197264711|ref|ZP_03164785.1| thioredoxin [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197364705|ref|YP_002144342.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|198242687|ref|YP_002217853.1| thioredoxin [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|200387433|ref|ZP_03214045.1| thioredoxin [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204930358|ref|ZP_03221335.1| thioredoxin [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205354514|ref|YP_002228315.1| thioredoxin [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|207859127|ref|YP_002245778.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|208809464|ref|ZP_03251801.1| thioredoxin [Escherichia coli O157:H7 str. EC4206]
 gi|208814416|ref|ZP_03255745.1| thioredoxin [Escherichia coli O157:H7 str. EC4045]
 gi|208819175|ref|ZP_03259495.1| thioredoxin [Escherichia coli O157:H7 str. EC4042]
 gi|209396946|ref|YP_002273299.1| thioredoxin [Escherichia coli O157:H7 str. EC4115]
 gi|209921254|ref|YP_002295338.1| thioredoxin [Escherichia coli SE11]
 gi|213021586|ref|ZP_03336033.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           404ty]
 gi|213051686|ref|ZP_03344564.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E00-7866]
 gi|213423864|ref|ZP_03356844.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E01-6750]
 gi|213583146|ref|ZP_03364972.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|213612593|ref|ZP_03370419.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-2068]
 gi|213648368|ref|ZP_03378421.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           J185]
 gi|213856933|ref|ZP_03384173.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           M223]
 gi|215489109|ref|YP_002331540.1| thioredoxin [Escherichia coli O127:H6 str. E2348/69]
 gi|217324914|ref|ZP_03440998.1| thioredoxin [Escherichia coli O157:H7 str. TW14588]
 gi|218550994|ref|YP_002384785.1| thioredoxin [Escherichia fergusonii ATCC 35469]
 gi|218556343|ref|YP_002389257.1| thioredoxin [Escherichia coli IAI1]
 gi|218560847|ref|YP_002393760.1| thioredoxin [Escherichia coli S88]
 gi|218692060|ref|YP_002400272.1| thioredoxin [Escherichia coli ED1a]
 gi|218697498|ref|YP_002405165.1| thioredoxin [Escherichia coli 55989]
 gi|218701306|ref|YP_002408935.1| thioredoxin [Escherichia coli IAI39]
 gi|218707417|ref|YP_002414936.1| thioredoxin [Escherichia coli UMN026]
 gi|224585738|ref|YP_002639537.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|238902862|ref|YP_002928658.1| thioredoxin 1 [Escherichia coli BW2952]
 gi|238912925|ref|ZP_04656762.1| thioredoxin [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|253775594|ref|YP_003038425.1| thioredoxin [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163725|ref|YP_003046833.1| thioredoxin [Escherichia coli B str. REL606]
 gi|254795779|ref|YP_003080616.1| thioredoxin [Escherichia coli O157:H7 str. TW14359]
 gi|256026129|ref|ZP_05439994.1| thioredoxin [Escherichia sp. 4_1_40B]
 gi|260846443|ref|YP_003224221.1| thioredoxin 1 [Escherichia coli O103:H2 str. 12009]
 gi|260857813|ref|YP_003231704.1| thioredoxin 1 [Escherichia coli O26:H11 str. 11368]
 gi|260870506|ref|YP_003236908.1| thioredoxin 1 [Escherichia coli O111:H- str. 11128]
 gi|261225555|ref|ZP_05939836.1| thioredoxin [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255601|ref|ZP_05948134.1| thioredoxin [Escherichia coli O157:H7 str. FRIK966]
 gi|283834552|ref|ZP_06354293.1| thioredoxin [Citrobacter youngae ATCC 29220]
 gi|289825739|ref|ZP_06544907.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-3139]
 gi|293407411|ref|ZP_06651331.1| thioredoxin-1 [Escherichia coli FVEC1412]
 gi|297519964|ref|ZP_06938350.1| thioredoxin [Escherichia coli OP50]
 gi|298383151|ref|ZP_06992745.1| thioredoxin-1 [Escherichia coli FVEC1302]
 gi|301028993|ref|ZP_07192150.1| thioredoxin [Escherichia coli MS 196-1]
 gi|306815181|ref|ZP_07449334.1| thioredoxin [Escherichia coli NC101]
 gi|307140481|ref|ZP_07499837.1| thioredoxin [Escherichia coli H736]
 gi|309784493|ref|ZP_07679131.1| thioredoxin [Shigella dysenteriae 1617]
 gi|312969490|ref|ZP_07783692.1| thioredoxin [Escherichia coli 2362-75]
 gi|312971936|ref|ZP_07786110.1| thioredoxin [Escherichia coli 1827-70]
 gi|331660126|ref|ZP_08361062.1| thioredoxin [Escherichia coli TA206]
 gi|331665427|ref|ZP_08366326.1| thioredoxin [Escherichia coli TA143]
 gi|331670626|ref|ZP_08371463.1| thioredoxin [Escherichia coli TA271]
 gi|331685500|ref|ZP_08386084.1| thioredoxin [Escherichia coli H299]
 gi|76363560|sp|P0AA25|THIO_ECOLI RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|76363561|sp|P0AA28|THIO_SALTY RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|88942917|sp|P0AA27|THIO_ECO57 RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|88942918|sp|P0AA26|THIO_ECOL6 RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|88942919|sp|P0AA29|THIO_SALTI RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|88942920|sp|P0AA30|THIO_SHIFL RecName: Full=Thioredoxin-1; Short=Trx-1
 gi|25282754|pir||AF0922 thioredoxin [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|49362|emb|CAA79851.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|147609|gb|AAA24533.1| thioredoxin (trxA) [Escherichia coli]
 gi|148066|gb|AAA24693.1| thioredoxin [Escherichia coli]
 gi|148068|gb|AAA24694.1| thioredoxin (trxA) [Escherichia coli]
 gi|217085|dbj|BAA00903.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|2852397|gb|AAC40210.1| Eschericia coli thioredoxin [Cloning vector pBIOTRX-BirA]
 gi|6960281|gb|AAF33471.1| 100% idendity with E. coli thioredoxin 1 (TRXA) (SP:P00274);
           contains similarity to Pfam family PF00085
           (Thioredoxin), score=185.9, E=9.3e-55, N=1 [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16422483|gb|AAL22765.1| thioredoxin 1 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16504518|emb|CAD09400.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29139338|gb|AAO70905.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56130032|gb|AAV79538.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|85676267|dbj|BAE77517.1| thioredoxin 1 [Escherichia coli str. K12 substr. W3110]
 gi|87082331|gb|AAC76786.2| thioredoxin 1 [Escherichia coli str. K-12 substr. MG1655]
 gi|157068934|gb|ABV08189.1| thioredoxin [Escherichia coli HS]
 gi|157080665|gb|ABV20373.1| thioredoxin [Escherichia coli E24377A]
 gi|161366397|gb|ABX70165.1| hypothetical protein SPAB_04861 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|169757120|gb|ACA79819.1| thioredoxin [Escherichia coli ATCC 8739]
 gi|169891103|gb|ACB04810.1| thioredoxin 1 [Escherichia coli str. K-12 substr. DH10B]
 gi|170121247|gb|EDS90178.1| thioredoxin [Escherichia albertii TW07627]
 gi|170518191|gb|ACB16369.1| thioredoxin [Escherichia coli SMS-3-5]
 gi|187429127|gb|ACD08401.1| thioredoxin [Shigella boydii CDC 3083-94]
 gi|187768816|gb|EDU32660.1| thioredoxin [Escherichia coli O157:H7 str. EC4196]
 gi|188014288|gb|EDU52410.1| thioredoxin [Escherichia coli O157:H7 str. EC4113]
 gi|188489040|gb|EDU64143.1| thioredoxin [Escherichia coli 53638]
 gi|189001583|gb|EDU70569.1| thioredoxin [Escherichia coli O157:H7 str. EC4076]
 gi|189359144|gb|EDU77563.1| thioredoxin [Escherichia coli O157:H7 str. EC4401]
 gi|189362599|gb|EDU81018.1| thioredoxin [Escherichia coli O157:H7 str. EC4486]
 gi|189365821|gb|EDU84237.1| thioredoxin [Escherichia coli O157:H7 str. EC4501]
 gi|189373365|gb|EDU91781.1| thioredoxin [Escherichia coli O157:H7 str. EC869]
 gi|189376807|gb|EDU95223.1| thioredoxin [Escherichia coli O157:H7 str. EC508]
 gi|190903903|gb|EDV63617.1| thioredoxin [Escherichia coli B7A]
 gi|190905291|gb|EDV64928.1| thioredoxin [Escherichia coli F11]
 gi|190905347|gb|EDV64981.1| thioredoxin [Escherichia coli F11]
 gi|192926240|gb|EDV80879.1| thioredoxin [Escherichia coli E22]
 gi|192955647|gb|EDV86123.1| thioredoxin [Escherichia coli E110019]
 gi|194403536|gb|ACF63758.1| thioredoxin [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194408999|gb|ACF69218.1| thioredoxin [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194412199|gb|EDX28506.1| thioredoxin [Escherichia coli B171]
 gi|194417139|gb|EDX33252.1| thioredoxin [Shigella dysenteriae 1012]
 gi|194422399|gb|EDX38398.1| thioredoxin [Escherichia coli 101-1]
 gi|194455193|gb|EDX44032.1| thioredoxin [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194710953|gb|ACF90174.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195629942|gb|EDX48602.1| thioredoxin [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197096182|emb|CAR61778.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|197212953|gb|ACH50350.1| thioredoxin [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197242966|gb|EDY25586.1| thioredoxin [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197288776|gb|EDY28151.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937203|gb|ACH74536.1| thioredoxin [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|199604531|gb|EDZ03076.1| thioredoxin [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204320762|gb|EDZ05964.1| thioredoxin [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205274295|emb|CAR39316.1| thioredoxin [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205322203|gb|EDZ10042.1| thioredoxin [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205327548|gb|EDZ14312.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205331812|gb|EDZ18576.1| thioredoxin [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205336242|gb|EDZ23006.1| thioredoxin [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205340698|gb|EDZ27462.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205348272|gb|EDZ34903.1| thioredoxin [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206710930|emb|CAR35296.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|208729265|gb|EDZ78866.1| thioredoxin [Escherichia coli O157:H7 str. EC4206]
 gi|208735693|gb|EDZ84380.1| thioredoxin [Escherichia coli O157:H7 str. EC4045]
 gi|208739298|gb|EDZ86980.1| thioredoxin [Escherichia coli O157:H7 str. EC4042]
 gi|209158346|gb|ACI35779.1| thioredoxin [Escherichia coli O157:H7 str. EC4115]
 gi|209914513|dbj|BAG79587.1| thioredoxin [Escherichia coli SE11]
 gi|215267181|emb|CAS11629.1| thioredoxin 1 [Escherichia coli O127:H6 str. E2348/69]
 gi|217321135|gb|EEC29559.1| thioredoxin [Escherichia coli O157:H7 str. TW14588]
 gi|218354230|emb|CAV00885.1| thioredoxin 1 [Escherichia coli 55989]
 gi|218358535|emb|CAQ91183.1| thioredoxin 1 [Escherichia fergusonii ATCC 35469]
 gi|218363112|emb|CAR00752.1| thioredoxin 1 [Escherichia coli IAI1]
 gi|218367616|emb|CAR05400.1| thioredoxin 1 [Escherichia coli S88]
 gi|218371292|emb|CAR19125.1| thioredoxin 1 [Escherichia coli IAI39]
 gi|218429624|emb|CAR10446.1| thioredoxin 1 [Escherichia coli ED1a]
 gi|218434514|emb|CAR15441.1| thioredoxin 1 [Escherichia coli UMN026]
 gi|224470266|gb|ACN48096.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|238863644|gb|ACR65642.1| thioredoxin 1 [Escherichia coli BW2952]
 gi|242379314|emb|CAQ34125.1| thioredoxin 1 [Escherichia coli BL21(DE3)]
 gi|253326638|gb|ACT31240.1| thioredoxin [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975626|gb|ACT41297.1| thioredoxin [Escherichia coli B str. REL606]
 gi|253979782|gb|ACT45452.1| thioredoxin [Escherichia coli BL21(DE3)]
 gi|254595179|gb|ACT74540.1| thioredoxin 1 [Escherichia coli O157:H7 str. TW14359]
 gi|257756462|dbj|BAI27964.1| thioredoxin 1 [Escherichia coli O26:H11 str. 11368]
 gi|257761590|dbj|BAI33087.1| thioredoxin 1 [Escherichia coli O103:H2 str. 12009]
 gi|257766862|dbj|BAI38357.1| thioredoxin 1 [Escherichia coli O111:H- str. 11128]
 gi|260451374|gb|ACX41796.1| thioredoxin [Escherichia coli DH1]
 gi|261249044|emb|CBG26904.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996197|gb|ACY91082.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|281180830|dbj|BAI57160.1| thioredoxin [Escherichia coli SE15]
 gi|284923886|emb|CBG36985.1| thioredoxin 1 [Escherichia coli 042]
 gi|291069682|gb|EFE07791.1| thioredoxin [Citrobacter youngae ATCC 29220]
 gi|291425522|gb|EFE98560.1| thioredoxin-1 [Escherichia coli FVEC1412]
 gi|294490421|gb|ADE89177.1| thioredoxin [Escherichia coli IHE3034]
 gi|298276387|gb|EFI17906.1| thioredoxin-1 [Escherichia coli FVEC1302]
 gi|299878036|gb|EFI86247.1| thioredoxin [Escherichia coli MS 196-1]
 gi|301160436|emb|CBW19965.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|305851550|gb|EFM52004.1| thioredoxin [Escherichia coli NC101]
 gi|307555909|gb|ADN48684.1| thioredoxin 1 [Escherichia coli ABU 83972]
 gi|307628844|gb|ADN73148.1| thioredoxin [Escherichia coli UM146]
 gi|308927599|gb|EFP73068.1| thioredoxin [Shigella dysenteriae 1617]
 gi|309704220|emb|CBJ03567.1| thioredoxin 1 [Escherichia coli ETEC H10407]
 gi|310334313|gb|EFQ00518.1| thioredoxin [Escherichia coli 1827-70]
 gi|312286037|gb|EFR13955.1| thioredoxin [Escherichia coli 2362-75]
 gi|312915039|dbj|BAJ39013.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|312948336|gb|ADR29163.1| thioredoxin [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647774|gb|EFS12221.1| thioredoxin [Shigella flexneri 2a str. 2457T]
 gi|315138359|dbj|BAJ45518.1| thioredoxin [Escherichia coli DH1]
 gi|315618520|gb|EFU99106.1| thioredoxin [Escherichia coli 3431]
 gi|320088332|emb|CBY98092.1| Thioredoxin Trx [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|320176024|gb|EFW51093.1| Thioredoxin [Shigella dysenteriae CDC 74-1112]
 gi|320178072|gb|EFW53052.1| Thioredoxin [Shigella boydii ATCC 9905]
 gi|320185442|gb|EFW60211.1| Thioredoxin [Shigella flexneri CDC 796-83]
 gi|320191125|gb|EFW65775.1| Thioredoxin [Escherichia coli O157:H7 str. EC1212]
 gi|320197593|gb|EFW72205.1| Thioredoxin [Escherichia coli WV_060327]
 gi|320198511|gb|EFW73112.1| Thioredoxin [Escherichia coli EC4100B]
 gi|320639265|gb|EFX08887.1| thioredoxin [Escherichia coli O157:H7 str. G5101]
 gi|320644650|gb|EFX13700.1| thioredoxin [Escherichia coli O157:H- str. 493-89]
 gi|320649975|gb|EFX18478.1| thioredoxin [Escherichia coli O157:H- str. H 2687]
 gi|320655321|gb|EFX23263.1| thioredoxin [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320660946|gb|EFX28389.1| thioredoxin [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666070|gb|EFX33084.1| thioredoxin [Escherichia coli O157:H7 str. LSU-61]
 gi|321225441|gb|EFX50498.1| Thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322612999|gb|EFY09950.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322617413|gb|EFY14313.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322625595|gb|EFY22417.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322627018|gb|EFY23811.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322631266|gb|EFY28029.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322638299|gb|EFY34998.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322642851|gb|EFY39437.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322646993|gb|EFY43495.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322650381|gb|EFY46794.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322656329|gb|EFY52623.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322657554|gb|EFY53824.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322665965|gb|EFY62146.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322666704|gb|EFY62881.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322671053|gb|EFY67183.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322679240|gb|EFY75292.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322681644|gb|EFY77671.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322686029|gb|EFY82017.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|323132268|gb|ADX19698.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323155183|gb|EFZ41367.1| thioredoxin [Escherichia coli EPECa14]
 gi|323161155|gb|EFZ47073.1| thioredoxin [Escherichia coli E128010]
 gi|323167635|gb|EFZ53340.1| thioredoxin [Shigella sonnei 53G]
 gi|323173398|gb|EFZ59027.1| thioredoxin [Escherichia coli LT-68]
 gi|323177791|gb|EFZ63375.1| thioredoxin [Escherichia coli 1180]
 gi|323182554|gb|EFZ67958.1| thioredoxin [Escherichia coli 1357]
 gi|323189496|gb|EFZ74776.1| thioredoxin [Escherichia coli RN587/1]
 gi|323192655|gb|EFZ77883.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323197838|gb|EFZ82969.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323203727|gb|EFZ88748.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323205398|gb|EFZ90372.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323210769|gb|EFZ95645.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323215935|gb|EGA00668.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323221428|gb|EGA05846.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB102109-0047]
 gi|323227328|gb|EGA11495.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323231739|gb|EGA15850.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323236154|gb|EGA20231.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323239609|gb|EGA23657.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323244295|gb|EGA28303.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323249608|gb|EGA33520.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2009159199]
 gi|323250300|gb|EGA34186.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008282]
 gi|323256507|gb|EGA40238.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008283]
 gi|323259795|gb|EGA43428.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
 gi|323265203|gb|EGA48701.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008285]
 gi|323268368|gb|EGA51840.1| thioredoxin [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008287]
 gi|323934172|gb|EGB30603.1| thioredoxin [Escherichia coli E1520]
 gi|323938920|gb|EGB35139.1| thioredoxin [Escherichia coli E482]
 gi|323943816|gb|EGB39911.1| thioredoxin [Escherichia coli H120]
 gi|323949334|gb|EGB45224.1| thioredoxin [Escherichia coli H252]
 gi|323954096|gb|EGB49893.1| thioredoxin [Escherichia coli H263]
 gi|323959038|gb|EGB54707.1| thioredoxin [Escherichia coli H489]
 gi|323964029|gb|EGB59519.1| thioredoxin [Escherichia coli M863]
 gi|323969377|gb|EGB64676.1| thioredoxin [Escherichia coli TA007]
 gi|323974365|gb|EGB69493.1| thioredoxin [Escherichia coli TW10509]
 gi|324111008|gb|EGC04995.1| thioredoxin [Escherichia fergusonii B253]
 gi|324115755|gb|EGC09690.1| thioredoxin [Escherichia coli E1167]
 gi|325499247|gb|EGC97106.1| thioredoxin/transketolase fusion protein [Escherichia fergusonii
           ECD227]
 gi|326344239|gb|EGD67999.1| Thioredoxin [Escherichia coli O157:H7 str. 1125]
 gi|326347934|gb|EGD71648.1| Thioredoxin [Escherichia coli O157:H7 str. 1044]
 gi|326629649|gb|EGE35992.1| thioredoxin [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
 gi|327250633|gb|EGE62339.1| thioredoxin [Escherichia coli STEC_7v]
 gi|330908083|gb|EGH36602.1| thioredoxin [Escherichia coli AA86]
 gi|331052694|gb|EGI24729.1| thioredoxin [Escherichia coli TA206]
 gi|331057325|gb|EGI29314.1| thioredoxin [Escherichia coli TA143]
 gi|331062099|gb|EGI34021.1| thioredoxin [Escherichia coli TA271]
 gi|331077201|gb|EGI48415.1| thioredoxin [Escherichia coli H299]
 gi|332084704|gb|EGI89892.1| thioredoxin [Shigella boydii 5216-82]
 gi|332084949|gb|EGI90131.1| thioredoxin [Shigella dysenteriae 155-74]
 gi|332089064|gb|EGI94175.1| thioredoxin [Shigella boydii 3594-74]
 gi|332345761|gb|AEE59095.1| thioredoxin [Escherichia coli UMNK88]
 gi|332750994|gb|EGJ81399.1| thioredoxin [Shigella flexneri 4343-70]
 gi|332751083|gb|EGJ81487.1| thioredoxin [Shigella flexneri K-671]
 gi|332751922|gb|EGJ82317.1| thioredoxin [Shigella flexneri 2747-71]
 gi|332764377|gb|EGJ94612.1| thioredoxin [Shigella flexneri 2930-71]
 gi|332990756|gb|AEF09739.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
 gi|332996856|gb|EGK16476.1| thioredoxin [Shigella flexneri VA-6]
 gi|332997930|gb|EGK17537.1| thioredoxin [Shigella flexneri K-218]
 gi|332998277|gb|EGK17879.1| thioredoxin [Shigella flexneri K-272]
 gi|333013584|gb|EGK32951.1| thioredoxin [Shigella flexneri K-304]
 gi|333013816|gb|EGK33179.1| thioredoxin [Shigella flexneri K-227]
          Length = 109

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|149241884|pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal
           (P61) Space Group
 gi|149241885|pdb|2H71|B Chain B, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IA+E   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|149241890|pdb|2H73|A Chain A, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal
           (P61) Space Group
 gi|149241891|pdb|2H73|B Chain B, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+++IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILEEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|330813553|ref|YP_004357792.1| thioredoxin [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486648|gb|AEA81053.1| thioredoxin [Candidatus Pelagibacter sp. IMCC9063]
          Length = 107

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   +F++EVL+   PV+VDFWA WC PC  + P++++++DE+ADK+ I K +I+
Sbjct: 1   MATKQVTDDNFENEVLKSEKPVLVDFWAEWCGPCKMVGPVLEELSDEMADKLVIAKHNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +S    T+Y +  IPT++LF  G++ID  + GA+++S+I EW+ S+V
Sbjct: 61  DSPNTPTKYGVRGIPTMLLFSGGQLIDTKV-GAANKSNIKEWLDSKV 106


>gi|304398131|ref|ZP_07380006.1| thioredoxin [Pantoea sp. aB]
 gi|308188836|ref|YP_003932967.1| Thioredoxin (Trx) [Pantoea vagans C9-1]
 gi|304354417|gb|EFM18789.1| thioredoxin [Pantoea sp. aB]
 gi|308059346|gb|ADO11518.1| Thioredoxin (Trx) [Pantoea vagans C9-1]
          Length = 110

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    + +   SFD++VL+     +VDFWA WC PC  ++PI+D++A+E   K+ I KL
Sbjct: 1   MSSDKIVHLTDDSFDTDVLKADGVTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  NIDDNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|311281533|ref|YP_003943764.1| thioredoxin [Enterobacter cloacae SCF1]
 gi|308750728|gb|ADO50480.1| thioredoxin [Enterobacter cloacae SCF1]
          Length = 109

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEFDGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK G+V+   + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKQGEVVATKV-GALSKGQLKEFLEANL 108


>gi|291615698|ref|YP_003518440.1| TrxA [Pantoea ananatis LMG 20103]
 gi|291150728|gb|ADD75312.1| TrxA [Pantoea ananatis LMG 20103]
 gi|327395963|dbj|BAK13385.1| thioredoxin 1 TrxA [Pantoea ananatis AJ13355]
          Length = 110

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    + +   SFD++VL+    ++VDFWA WC PC  ++PI+D++A+E   K+ I KL
Sbjct: 1   MSSDKIVHLTDDSFDTDVLKADGVILVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  NIDDNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|239833146|ref|ZP_04681475.1| thioredoxin [Ochrobactrum intermedium LMG 3301]
 gi|239825413|gb|EEQ96981.1| thioredoxin [Ochrobactrum intermedium LMG 3301]
          Length = 124

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/105 (46%), Positives = 79/105 (75%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 18  MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKMIAPALDEIATEMAGQVKIAKVNID 77

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI +
Sbjct: 78  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWIKA 121


>gi|317046375|ref|YP_004114023.1| thioredoxin [Pantoea sp. At-9b]
 gi|316947992|gb|ADU67467.1| thioredoxin [Pantoea sp. At-9b]
          Length = 110

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    + +   SFD++VL+     +VDFWA WC PC  ++PI+D++A+E   K+ I KL
Sbjct: 1   MSSDKIVHLTDDSFDTDVLKAEGVTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  NIDDNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 109


>gi|145600736|ref|YP_001164812.1| thioredoxin 1 [Yersinia pestis Pestoides F]
 gi|145212432|gb|ABP41839.1| thioredoxin 1 [Yersinia pestis Pestoides F]
          Length = 108

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    V+VDFWA WC PC  ++PI+D+IA+E   ++ I KL+
Sbjct: 1   MSDKIIHLSDDSFDTDVLKARGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LF+DG+V+   + GA S+  +  ++ + +
Sbjct: 61  IDDNQGTAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKAFLDANL 108


>gi|237727905|ref|ZP_04558386.1| thioredoxin 1 [Citrobacter sp. 30_2]
 gi|226910354|gb|EEH96272.1| thioredoxin 1 [Citrobacter sp. 30_2]
          Length = 119

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 11  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 70

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 71  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 118


>gi|161505567|ref|YP_001572679.1| thioredoxin [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866914|gb|ABX23537.1| hypothetical protein SARI_03737 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 123

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 15  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 74

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 75  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 122


>gi|149241896|pdb|2H75|A Chain A, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal
           (P61) Space Group
 gi|149241897|pdb|2H75|B Chain B, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SF+++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFETDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|300940004|ref|ZP_07154629.1| thioredoxin [Escherichia coli MS 21-1]
 gi|300455137|gb|EFK18630.1| thioredoxin [Escherichia coli MS 21-1]
          Length = 127

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 19  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 78

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 79  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 126


>gi|293413225|ref|ZP_06655887.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291468173|gb|EFF10670.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 127

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 19  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLIVAKLN 78

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 79  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 126


>gi|238765158|ref|ZP_04626091.1| Thioredoxin 1 [Yersinia kristensenii ATCC 33638]
 gi|238696648|gb|EEP89432.1| Thioredoxin 1 [Yersinia kristensenii ATCC 33638]
          Length = 108

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +  +SF ++VLE    V+VDFWA WC PC  ++PI+D+IA+E   ++ ITKL+
Sbjct: 1   MSDKIIHLSDESFGTKVLEADGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LF+DG+V+   + GA S+  + E++ + +
Sbjct: 61  IDDNQATAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKEFLDANL 108


>gi|1729953|sp|P52233|THIO_THIFE RecName: Full=Thioredoxin; Short=Trx
 gi|664829|gb|AAA88939.1| thioredoxin [Acidithiobacillus ferrooxidans]
          Length = 108

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + L V   SF+++VL+ S PV+VDFWA WC PC  ++PI+++IADE AD++++ K +I+E
Sbjct: 4   AILYVSDDSFETDVLKSSKPVLVDFWAEWCGPCKMIAPILEEIADEYADRLRVAKFNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     +Y I  IPTL+LFK GK+    + GA S++ +  ++ S++
Sbjct: 64  NPNTPPQYAIRGIPTLLLFKAGKLEATKV-GALSKAQLTAFLDSQL 108


>gi|270264231|ref|ZP_06192498.1| thioredoxin-1 [Serratia odorifera 4Rx13]
 gi|270041880|gb|EFA14977.1| thioredoxin-1 [Serratia odorifera 4Rx13]
          Length = 108

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+   P++VDFWA WC PC  ++PI+D+IA E   K+ ITKL+
Sbjct: 1   MSDKIIHLTDSSFETDVLKAEGPILVDFWAEWCGPCKMIAPILDEIAVEFEGKLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + +++ + +
Sbjct: 61  IDQNPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKDFLNANL 108


>gi|24987897|pdb|1XOB|A Chain A, Thioredoxin (Reduced Dithio Form), Nmr, 20 Structures
 gi|157834256|pdb|1XOA|A Chain A, Thioredoxin (Oxidized Disulfide Form), Nmr, 20 Structures
          Length = 108

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|288940347|ref|YP_003442587.1| thioredoxin [Allochromatium vinosum DSM 180]
 gi|288895719|gb|ADC61555.1| thioredoxin [Allochromatium vinosum DSM 180]
          Length = 108

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + V   SF+ EVL+  +PV+VD+WA WC PC  ++P++D+IADE A +VKI KL+I+E
Sbjct: 4   SIVHVTDDSFEEEVLKSPDPVLVDYWADWCGPCKMIAPVLDEIADEYAGRVKIAKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     RY I  IPTL+LF+ G+V    + GA S+S +  +I S +
Sbjct: 64  NPNTPPRYGIRGIPTLMLFRGGEVEATKV-GAVSKSQLTAFIDSNL 108


>gi|222143123|pdb|3DYR|A Chain A, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In
           Its Oxidized Form
 gi|222143124|pdb|3DYR|B Chain B, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In
           Its Oxidized Form
          Length = 111

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 5   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I   PTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 65  PGTAPKYGIRGTPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|85711916|ref|ZP_01042971.1| Thioredoxin [Idiomarina baltica OS145]
 gi|85694313|gb|EAQ32256.1| Thioredoxin [Idiomarina baltica OS145]
          Length = 108

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++V+    PV+VDFWA WC PC  ++PI+DDI+ +   ++ I KL+
Sbjct: 1   MSEVIVQLSDDSFEADVINSDKPVLVDFWAEWCGPCKMIAPILDDISKDYEGRLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + +   +Y I  IPTL+LFK+G+V+   + GA S++ + E++   +
Sbjct: 61  VDHNDQTPPKYGIRGIPTLLLFKNGEVVATKV-GALSRAQLTEFLDQHI 108


>gi|218778087|ref|YP_002429405.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
 gi|218759471|gb|ACL01937.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
          Length = 149

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF +EVL    PV++D WA WC PC  ++P++D+IA E A  +K+ KL+++ + 
Sbjct: 47  VDVTDASFQNEVLASPIPVLLDCWAPWCGPCKMVAPVLDEIAREYAGTIKVAKLNVDNNP 106

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ ++  SIPT+ILFK+G+ +DR++ GA+ +  II ++ +++
Sbjct: 107 ATASHFRTQSIPTMILFKNGREVDRLV-GAAPKQQIINFVQNQL 149


>gi|162146540|ref|YP_001600999.1| thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543462|ref|YP_002275691.1| thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785115|emb|CAP54659.1| putative thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531139|gb|ACI51076.1| thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
          Length = 108

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   +F+S+VL+   PV+VDFWA WC PC  ++P +D+I  E   K+ + K++
Sbjct: 1   MSENTVAVSDATFESDVLKAEGPVLVDFWAEWCGPCKMIAPALDEIGAEFKGKLTVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++     +Y +  IPTLILFK+G+     + GA  +S + EW+ S +
Sbjct: 61  IDDNPGTPNKYAVRGIPTLILFKNGQPAATKV-GALPKSQLKEWVKSSL 108


>gi|85544673|pdb|2FCH|A Chain A, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544674|pdb|2FCH|B Chain B, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544675|pdb|2FCH|C Chain C, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544676|pdb|2FCH|D Chain D, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544677|pdb|2FCH|E Chain E, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544678|pdb|2FCH|F Chain F, Crystal Structure Of Thioredoxin Mutant G74s
 gi|85544679|pdb|2FCH|G Chain G, Crystal Structure Of Thioredoxin Mutant G74s
          Length = 108

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I SIPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRSIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|49079980|gb|AAT49956.1| PA5240 [synthetic construct]
          Length = 109

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+ +VL+   PV+VD+WA WC PC  ++P++D++A +   K+K+ KL+
Sbjct: 1   MSEHIVNVTDASFEQDVLKADGPVLVDYWAEWCGPCKMIAPVLDEVARDYQGKLKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   +Y +  IPTL+LFKDG V    + GA S+S +  ++ + +
Sbjct: 61  IDENQDTPPKYGVRGIPTLMLFKDGNVEATKV-GALSKSQLAAFLDANI 108


>gi|73536038|pdb|1ZZY|A Chain A, Crystal Structure Of Thioredoxin Mutant L7v
 gi|73536039|pdb|1ZZY|B Chain B, Crystal Structure Of Thioredoxin Mutant L7v
          Length = 108

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + V   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|149241880|pdb|2H70|A Chain A, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal
           (P61) Space Group
 gi|149241881|pdb|2H70|B Chain B, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTEDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|149241876|pdb|2H6Z|A Chain A, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal
           (P61) Space Group
 gi|149241877|pdb|2H6Z|B Chain B, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+DDIADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDDIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|71282174|ref|YP_266943.1| thioredoxin [Colwellia psychrerythraea 34H]
 gi|71147914|gb|AAZ28387.1| thioredoxin [Colwellia psychrerythraea 34H]
          Length = 108

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++VL+ S  V+VDFWA WC PC  ++P++DDIA E   KV + KL+
Sbjct: 1   MSDKIVQLTDDSFEADVLKASGLVLVDFWAEWCGPCKMIAPVLDDIATEYDGKVTVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++S    +Y +  IPTL+LFKDG++ D  + GA S++ + E++   +
Sbjct: 61  IDQNSATPPKYGVRGIPTLLLFKDGEIADTKV-GALSKTQLKEFLDKNL 108


>gi|332534396|ref|ZP_08410236.1| thioredoxin 1, redox factor [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036130|gb|EGI72605.1| thioredoxin 1, redox factor [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 108

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++VL+   PV+VDFWA WC PC  ++PI+ ++ADE   +V + KL+
Sbjct: 1   MSEKIIQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILHEVADEYDSRVTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG+V    + GA S++ +IE++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLIEFLENNI 108


>gi|291084661|ref|ZP_06540721.2| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str.
           AG3]
          Length = 113

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 5   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 64

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 65  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 112


>gi|209524681|ref|ZP_03273228.1| thioredoxin [Arthrospira maxima CS-328]
 gi|209494825|gb|EDZ95133.1| thioredoxin [Arthrospira maxima CS-328]
          Length = 107

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 74/108 (68%), Gaps = 2/108 (1%)

Query: 1   MSA-LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  ++V   +F+ +VLE   PV+VDFWA WC PC  ++P++++IA++   ++K+ KL+ 
Sbjct: 1   MSTAVEVTDSTFEQDVLESELPVLVDFWAPWCGPCRMVAPVVEEIAEQYDGQIKVVKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ +++++Y I SIPTL++FK G+ +D M+ GA  +S +   +   +
Sbjct: 61  DENPQVASQYGIRSIPTLMIFKGGQKVD-MVVGAVPKSTLANTLEKYL 107


>gi|10120659|pdb|1F6M|C Chain C, Crystal Structure Of A Complex Between Thioredoxin
           Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+
 gi|10120661|pdb|1F6M|D Chain D, Crystal Structure Of A Complex Between Thioredoxin
           Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+
 gi|10120662|pdb|1F6M|G Chain G, Crystal Structure Of A Complex Between Thioredoxin
           Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+
 gi|10120663|pdb|1F6M|H Chain H, Crystal Structure Of A Complex Between Thioredoxin
           Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+
          Length = 108

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC P   ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPSKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|26250519|ref|NP_756559.1| thioredoxin [Escherichia coli CFT073]
 gi|91213301|ref|YP_543287.1| thioredoxin [Escherichia coli UTI89]
 gi|110644108|ref|YP_671838.1| thioredoxin [Escherichia coli 536]
 gi|110807529|ref|YP_691049.1| thioredoxin [Shigella flexneri 5 str. 8401]
 gi|26110949|gb|AAN83133.1|AE016769_248 Thioredoxin 1 [Escherichia coli CFT073]
 gi|68304124|gb|AAY89720.1| TrxA [Escherichia coli LW1655F+]
 gi|91074875|gb|ABE09756.1| thioredoxin 1 [Escherichia coli UTI89]
 gi|110345700|gb|ABG71937.1| thioredoxin 1 [Escherichia coli 536]
 gi|110617077|gb|ABF05744.1| thioredoxin 1 [Shigella flexneri 5 str. 8401]
 gi|222035483|emb|CAP78228.1| Thioredoxin 1 [Escherichia coli LF82]
 gi|281603171|gb|ADA76155.1| Thioredoxin 1 [Shigella flexneri 2002017]
          Length = 144

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 36  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 95

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 96  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 143


>gi|271502411|ref|YP_003335437.1| thioredoxin [Dickeya dadantii Ech586]
 gi|270345966|gb|ACZ78731.1| thioredoxin [Dickeya dadantii Ech586]
          Length = 108

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+  +  +VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKIIHLTDDSFETDVLQSEHVTLVDFWADWCGPCKMIAPILDEIADEYEGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDDNPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 108


>gi|33152818|ref|NP_874171.1| thioredoxin [Haemophilus ducreyi 35000HP]
 gi|33149043|gb|AAP96560.1| thioredoxin [Haemophilus ducreyi 35000HP]
          Length = 105

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   +F+ EVL+   PV++DFWA WC PC  ++P +D++A E A + K+ K++++E+ +
Sbjct: 4   QVTDATFEQEVLKSDLPVLLDFWAPWCGPCRTIAPWLDELAQEFAGRAKVAKVNVDENQQ 63

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++ I SIPTL+LFK+G+V+  +  G   +S ++ +I   +
Sbjct: 64  IAAQFGIRSIPTLLLFKNGEVVA-IQVGVLPKSQLVTFIEQAL 105


>gi|332526133|ref|ZP_08402271.1| thioredoxin [Rubrivivax benzoatilyticus JA2]
 gi|332109976|gb|EGJ10604.1| thioredoxin [Rubrivivax benzoatilyticus JA2]
          Length = 109

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   SF S+VL+   PV+VD+WA WC PC  ++P++D++A     +++I K+
Sbjct: 1   MSSELIKHVTDASFSSDVLQSDKPVLVDYWAEWCGPCKMIAPVLDELAPAYDGRLQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ E+  ++ I  IPTL++FK G++    + GA S++ +  +I S +
Sbjct: 61  NVDENREVPAKFGIRGIPTLMIFKGGQLAATKV-GALSKAQLSAFIDSHL 109


>gi|157273326|gb|ABV27225.1| thioredoxin [Candidatus Chloracidobacterium thermophilum]
          Length = 110

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++   +F+ EVL+   PV+VDFWA+WC PC  L+P ++ +A++ A +V++ KL+++E+
Sbjct: 5   VIEITDSNFEREVLQSDRPVLVDFWAAWCAPCRMLAPTVESLANDYAGRVRVGKLNVDEN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + R+ I  IPTLI+FK+G+  +R+  GA  +  I   +   +
Sbjct: 65  NQTAARFGIRGIPTLIVFKNGREQERL-TGAHPKDTIARMLDKYL 108


>gi|83859060|ref|ZP_00952581.1| thioredoxin [Oceanicaulis alexandrii HTCC2633]
 gi|83852507|gb|EAP90360.1| thioredoxin [Oceanicaulis alexandrii HTCC2633]
          Length = 106

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   +F+++VL+   PV+VDFWA WC PC ++ P +++IA E A K+ I K++I+
Sbjct: 1   MATQAVTDDTFENDVLKADGPVLVDFWAEWCGPCKQIGPALEEIASEKAGKLTIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+    ++Y +  IPTL++FK+G+ + R + GA ++S I EWI   V
Sbjct: 61  ENPMAPSKYGVRGIPTLLIFKNGEEVSRKV-GAMAKSKIEEWINEAV 106


>gi|283787537|ref|YP_003367402.1| thioredoxin 1 [Citrobacter rodentium ICC168]
 gi|282950991|emb|CBG90668.1| thioredoxin 1 [Citrobacter rodentium ICC168]
          Length = 109

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LF++G+V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFRNGEVAATKV-GALSKGQLKEFLDANI 108


>gi|85544680|pdb|2FD3|A Chain A, Crystal Structure Of Thioredoxin Mutant P34h
 gi|85544681|pdb|2FD3|B Chain B, Crystal Structure Of Thioredoxin Mutant P34h
          Length = 108

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC  C  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGHCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|157368408|ref|YP_001476397.1| thioredoxin [Serratia proteamaculans 568]
 gi|157320172|gb|ABV39269.1| thioredoxin [Serratia proteamaculans 568]
          Length = 108

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+   P++VDFWA WC PC  ++PI+D+IA+E   K+ ITKL+
Sbjct: 1   MSDKIIHLTDGSFDTDVLKAEGPILVDFWAEWCGPCKMIAPILDEIAEEFEGKLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + +++ + +
Sbjct: 61  IDQNPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKDFLNANL 108


>gi|296113952|ref|YP_003627890.1| thioredoxin [Moraxella catarrhalis RH4]
 gi|295921646|gb|ADG61997.1| thioredoxin [Moraxella catarrhalis RH4]
 gi|326559331|gb|EGE09758.1| thioredoxin [Moraxella catarrhalis 7169]
 gi|326562456|gb|EGE12774.1| thioredoxin [Moraxella catarrhalis 46P47B1]
 gi|326564293|gb|EGE14523.1| thioredoxin [Moraxella catarrhalis 103P14B1]
 gi|326567227|gb|EGE17347.1| thioredoxin [Moraxella catarrhalis 12P80B1]
 gi|326568268|gb|EGE18350.1| thioredoxin [Moraxella catarrhalis BC8]
 gi|326569968|gb|EGE20015.1| thioredoxin [Moraxella catarrhalis BC1]
 gi|326570050|gb|EGE20096.1| thioredoxin [Moraxella catarrhalis BC7]
 gi|326572904|gb|EGE22889.1| thioredoxin [Moraxella catarrhalis CO72]
 gi|326573849|gb|EGE23802.1| thioredoxin [Moraxella catarrhalis O35E]
 gi|326574730|gb|EGE24666.1| thioredoxin [Moraxella catarrhalis 101P30B1]
          Length = 106

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS +     SFD++V+     V+VDFWA+WC PC  ++P+++++A++   +VKI K+D++
Sbjct: 1   MSIINATDASFDTDVVNSDGLVLVDFWAAWCGPCKAIAPVLEELAEDYQGRVKIVKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + + + R+ I SIPTL +FK+G+ ++ ++ G   +S+    +   +
Sbjct: 61  ANPQSAARFGIRSIPTLFVFKNGERVETVVGG-RPKSEFAALLDKHL 106


>gi|297170420|gb|ADI21452.1| thiol-disulfide isomerase and thioredoxins [uncultured gamma
           proteobacterium HF0070_10G19]
          Length = 108

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS    ++  ++FD EV     PV++DFWA WC PC +++PI+D++A +  + +K+ K+D
Sbjct: 1   MSELVKEITDENFDDEVTNSDKPVLIDFWAEWCGPCKQIAPIVDEVAKDYVENLKVCKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ + +I+ ++ I SIPTL++FK+G+ +   + GA S+  ++E+I S +
Sbjct: 61  IDSNRDIAVQFGIRSIPTLMIFKNGQPVGTQI-GAISKQQLLEFIQSEI 108


>gi|58039095|ref|YP_191059.1| thioredoxin [Gluconobacter oxydans 621H]
 gi|58001509|gb|AAW60403.1| Thioredoxin [Gluconobacter oxydans 621H]
          Length = 108

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+++VL+   PV+VDFWA WC PC  ++P +++I  E   ++K+ K++
Sbjct: 1   MSANTVAVSDSSFEADVLKSEGPVLVDFWAEWCGPCKMIAPALEEIGAEYQGRLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ + E  T+Y + SIPTLI+FKDGK + + M GA  +S +  WI   +
Sbjct: 61  IDSNPEAPTKYGVRSIPTLIVFKDGKPVAQQM-GALPKSQLKAWIDQSL 108


>gi|238755776|ref|ZP_04617108.1| Thioredoxin-1 [Yersinia ruckeri ATCC 29473]
 gi|238706003|gb|EEP98388.1| Thioredoxin-1 [Yersinia ruckeri ATCC 29473]
          Length = 108

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+     +VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKIIHLSDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFKDG V    + GA S+S +  ++   +
Sbjct: 61  IDENPGTAPKYGIRGIPTLLLFKDGAVAATKV-GALSKSQLKAFLDENL 108


>gi|304392404|ref|ZP_07374345.1| thioredoxin [Ahrensia sp. R2A130]
 gi|303295508|gb|EFL89867.1| thioredoxin [Ahrensia sp. R2A130]
          Length = 106

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D  +F+S+VL    PVVVDFWA WC PC  ++P +++I++E+ DKVKI K++++
Sbjct: 1   MATVKIDNSNFESDVLNSDTPVVVDFWAEWCGPCKMIAPSLEEISNEMGDKVKIAKVNMD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++++Y + SIPTL++FK G+ +  +  GA+ +  +  WI S V
Sbjct: 61  ENPELASKYGVRSIPTLLMFKGGEPVA-IQVGAAPKEKLSSWISSEV 106


>gi|295095195|emb|CBK84285.1| thioredoxin [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 109

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGLILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G V    + GA S+  + E++ + +
Sbjct: 61  IDQNPGTAPKYGIRGIPTLLLFKNGDVAATKV-GALSKGQLKEFLDANL 108


>gi|17988305|ref|NP_540939.1| thioredoxin C-1 [Brucella melitensis bv. 1 str. 16M]
 gi|23502953|ref|NP_699080.1| thioredoxin [Brucella suis 1330]
 gi|62290947|ref|YP_222740.1| thioredoxin [Brucella abortus bv. 1 str. 9-941]
 gi|82700858|ref|YP_415432.1| thioredoxin domain-containing protein [Brucella melitensis biovar
           Abortus 2308]
 gi|148560068|ref|YP_001259905.1| thioredoxin [Brucella ovis ATCC 25840]
 gi|161620016|ref|YP_001593903.1| thioredoxin [Brucella canis ATCC 23365]
 gi|163844121|ref|YP_001628525.1| thioredoxin [Brucella suis ATCC 23445]
 gi|189025158|ref|YP_001935926.1| Thioredoxin [Brucella abortus S19]
 gi|225626479|ref|ZP_03784518.1| thioredoxin [Brucella ceti str. Cudo]
 gi|225853532|ref|YP_002733765.1| thioredoxin [Brucella melitensis ATCC 23457]
 gi|237816451|ref|ZP_04595444.1| thioredoxin [Brucella abortus str. 2308 A]
 gi|254690237|ref|ZP_05153491.1| thioredoxin [Brucella abortus bv. 6 str. 870]
 gi|254694725|ref|ZP_05156553.1| thioredoxin [Brucella abortus bv. 3 str. Tulya]
 gi|254696354|ref|ZP_05158182.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700734|ref|ZP_05162562.1| thioredoxin [Brucella suis bv. 5 str. 513]
 gi|254707378|ref|ZP_05169206.1| thioredoxin [Brucella pinnipedialis M163/99/10]
 gi|254709080|ref|ZP_05170891.1| thioredoxin [Brucella pinnipedialis B2/94]
 gi|254713493|ref|ZP_05175304.1| thioredoxin [Brucella ceti M644/93/1]
 gi|254716151|ref|ZP_05177962.1| thioredoxin [Brucella ceti M13/05/1]
 gi|254718136|ref|ZP_05179947.1| thioredoxin [Brucella sp. 83/13]
 gi|254731268|ref|ZP_05189846.1| thioredoxin [Brucella abortus bv. 4 str. 292]
 gi|256030605|ref|ZP_05444219.1| thioredoxin [Brucella pinnipedialis M292/94/1]
 gi|256045707|ref|ZP_05448585.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060067|ref|ZP_05450249.1| thioredoxin [Brucella neotomae 5K33]
 gi|256112428|ref|ZP_05453349.1| thioredoxin [Brucella melitensis bv. 3 str. Ether]
 gi|256158604|ref|ZP_05456491.1| thioredoxin [Brucella ceti M490/95/1]
 gi|256254012|ref|ZP_05459548.1| thioredoxin [Brucella ceti B1/94]
 gi|256258490|ref|ZP_05464026.1| thioredoxin [Brucella abortus bv. 9 str. C68]
 gi|256262984|ref|ZP_05465516.1| thioredoxin [Brucella melitensis bv. 2 str. 63/9]
 gi|256370503|ref|YP_003108014.1| thioredoxin [Brucella microti CCM 4915]
 gi|260169511|ref|ZP_05756322.1| thioredoxin [Brucella sp. F5/99]
 gi|260546209|ref|ZP_05821949.1| thioredoxin [Brucella abortus NCTC 8038]
 gi|260563009|ref|ZP_05833495.1| thioredoxin [Brucella melitensis bv. 1 str. 16M]
 gi|260567424|ref|ZP_05837894.1| thioredoxin [Brucella suis bv. 4 str. 40]
 gi|260755778|ref|ZP_05868126.1| thioredoxin [Brucella abortus bv. 6 str. 870]
 gi|260759001|ref|ZP_05871349.1| thioredoxin [Brucella abortus bv. 4 str. 292]
 gi|260760726|ref|ZP_05873069.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884802|ref|ZP_05896416.1| thioredoxin [Brucella abortus bv. 9 str. C68]
 gi|261215054|ref|ZP_05929335.1| thioredoxin [Brucella abortus bv. 3 str. Tulya]
 gi|261217924|ref|ZP_05932205.1| thioredoxin [Brucella ceti M13/05/1]
 gi|261221153|ref|ZP_05935434.1| thioredoxin [Brucella ceti B1/94]
 gi|261314861|ref|ZP_05954058.1| thioredoxin [Brucella pinnipedialis M163/99/10]
 gi|261316581|ref|ZP_05955778.1| thioredoxin [Brucella pinnipedialis B2/94]
 gi|261321226|ref|ZP_05960423.1| thioredoxin [Brucella ceti M644/93/1]
 gi|261324044|ref|ZP_05963241.1| thioredoxin [Brucella neotomae 5K33]
 gi|261751246|ref|ZP_05994955.1| thioredoxin [Brucella suis bv. 5 str. 513]
 gi|261759039|ref|ZP_06002748.1| thioredoxin [Brucella sp. F5/99]
 gi|265983089|ref|ZP_06095824.1| thioredoxin [Brucella sp. 83/13]
 gi|265987653|ref|ZP_06100210.1| thioredoxin [Brucella pinnipedialis M292/94/1]
 gi|265992128|ref|ZP_06104685.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993866|ref|ZP_06106423.1| thioredoxin [Brucella melitensis bv. 3 str. Ether]
 gi|265997113|ref|ZP_06109670.1| thioredoxin [Brucella ceti M490/95/1]
 gi|294851331|ref|ZP_06792004.1| thioredoxin [Brucella sp. NVSL 07-0026]
 gi|297247331|ref|ZP_06931049.1| thioredoxin [Brucella abortus bv. 5 str. B3196]
 gi|306837650|ref|ZP_07470519.1| thioredoxin [Brucella sp. NF 2653]
 gi|306842784|ref|ZP_07475425.1| thioredoxin [Brucella sp. BO2]
 gi|306843522|ref|ZP_07476123.1| thioredoxin [Brucella sp. BO1]
 gi|17984078|gb|AAL53203.1| thioredoxin c-1 [Brucella melitensis bv. 1 str. 16M]
 gi|23348988|gb|AAN30995.1| thioredoxin [Brucella suis 1330]
 gi|62197079|gb|AAX75379.1| Trx-1, thioredoxin [Brucella abortus bv. 1 str. 9-941]
 gi|82616959|emb|CAJ12063.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2 [Brucella
           melitensis biovar Abortus 2308]
 gi|148371325|gb|ABQ61304.1| thioredoxin [Brucella ovis ATCC 25840]
 gi|161336827|gb|ABX63132.1| thioredoxin [Brucella canis ATCC 23365]
 gi|163674844|gb|ABY38955.1| thioredoxin [Brucella suis ATCC 23445]
 gi|189020730|gb|ACD73452.1| Thioredoxin [Brucella abortus S19]
 gi|225618136|gb|EEH15179.1| thioredoxin [Brucella ceti str. Cudo]
 gi|225641897|gb|ACO01811.1| thioredoxin [Brucella melitensis ATCC 23457]
 gi|237788518|gb|EEP62733.1| thioredoxin [Brucella abortus str. 2308 A]
 gi|256000666|gb|ACU49065.1| thioredoxin [Brucella microti CCM 4915]
 gi|260096316|gb|EEW80192.1| thioredoxin [Brucella abortus NCTC 8038]
 gi|260153025|gb|EEW88117.1| thioredoxin [Brucella melitensis bv. 1 str. 16M]
 gi|260156942|gb|EEW92022.1| thioredoxin [Brucella suis bv. 4 str. 40]
 gi|260669319|gb|EEX56259.1| thioredoxin [Brucella abortus bv. 4 str. 292]
 gi|260671158|gb|EEX57979.1| thioredoxin [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675886|gb|EEX62707.1| thioredoxin [Brucella abortus bv. 6 str. 870]
 gi|260874330|gb|EEX81399.1| thioredoxin [Brucella abortus bv. 9 str. C68]
 gi|260916661|gb|EEX83522.1| thioredoxin [Brucella abortus bv. 3 str. Tulya]
 gi|260919737|gb|EEX86390.1| thioredoxin [Brucella ceti B1/94]
 gi|260923013|gb|EEX89581.1| thioredoxin [Brucella ceti M13/05/1]
 gi|261293916|gb|EEX97412.1| thioredoxin [Brucella ceti M644/93/1]
 gi|261295804|gb|EEX99300.1| thioredoxin [Brucella pinnipedialis B2/94]
 gi|261300024|gb|EEY03521.1| thioredoxin [Brucella neotomae 5K33]
 gi|261303887|gb|EEY07384.1| thioredoxin [Brucella pinnipedialis M163/99/10]
 gi|261739023|gb|EEY27019.1| thioredoxin [Brucella sp. F5/99]
 gi|261740999|gb|EEY28925.1| thioredoxin [Brucella suis bv. 5 str. 513]
 gi|262551581|gb|EEZ07571.1| thioredoxin [Brucella ceti M490/95/1]
 gi|262764847|gb|EEZ10768.1| thioredoxin [Brucella melitensis bv. 3 str. Ether]
 gi|263003194|gb|EEZ15487.1| thioredoxin [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092857|gb|EEZ17032.1| thioredoxin [Brucella melitensis bv. 2 str. 63/9]
 gi|264659850|gb|EEZ30111.1| thioredoxin [Brucella pinnipedialis M292/94/1]
 gi|264661681|gb|EEZ31942.1| thioredoxin [Brucella sp. 83/13]
 gi|294819920|gb|EFG36919.1| thioredoxin [Brucella sp. NVSL 07-0026]
 gi|297174500|gb|EFH33847.1| thioredoxin [Brucella abortus bv. 5 str. B3196]
 gi|306276213|gb|EFM57913.1| thioredoxin [Brucella sp. BO1]
 gi|306287057|gb|EFM58565.1| thioredoxin [Brucella sp. BO2]
 gi|306407208|gb|EFM63418.1| thioredoxin [Brucella sp. NF 2653]
 gi|326410101|gb|ADZ67166.1| Thioredoxin [Brucella melitensis M28]
 gi|326539818|gb|ADZ88033.1| thioredoxin [Brucella melitensis M5-90]
          Length = 107

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/105 (46%), Positives = 79/105 (75%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 1   MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI +
Sbjct: 61  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWIKA 104


>gi|15600433|ref|NP_253927.1| thioredoxin [Pseudomonas aeruginosa PAO1]
 gi|107104342|ref|ZP_01368260.1| hypothetical protein PaerPA_01005417 [Pseudomonas aeruginosa PACS2]
 gi|116053387|ref|YP_793712.1| thioredoxin [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894342|ref|YP_002443212.1| thioredoxin [Pseudomonas aeruginosa LESB58]
 gi|254238063|ref|ZP_04931386.1| thioredoxin [Pseudomonas aeruginosa C3719]
 gi|254243878|ref|ZP_04937200.1| thioredoxin [Pseudomonas aeruginosa 2192]
 gi|296392098|ref|ZP_06881573.1| thioredoxin [Pseudomonas aeruginosa PAb1]
 gi|313110310|ref|ZP_07796202.1| thioredoxin [Pseudomonas aeruginosa 39016]
 gi|13878813|sp|Q9X2T1|THIO_PSEAE RecName: Full=Thioredoxin; Short=Trx
 gi|4773898|gb|AAD29108.2|AF053463_2 thioredoxin [Pseudomonas aeruginosa]
 gi|9951549|gb|AAG08625.1|AE004936_8 thioredoxin [Pseudomonas aeruginosa PAO1]
 gi|115588608|gb|ABJ14623.1| thioredoxin [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169994|gb|EAZ55505.1| thioredoxin [Pseudomonas aeruginosa C3719]
 gi|126197256|gb|EAZ61319.1| thioredoxin [Pseudomonas aeruginosa 2192]
 gi|218774571|emb|CAW30388.1| thioredoxin [Pseudomonas aeruginosa LESB58]
 gi|310882704|gb|EFQ41298.1| thioredoxin [Pseudomonas aeruginosa 39016]
          Length = 108

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+ +VL+   PV+VD+WA WC PC  ++P++D++A +   K+K+ KL+
Sbjct: 1   MSEHIVNVTDASFEQDVLKADGPVLVDYWAEWCGPCKMIAPVLDEVARDYQGKLKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   +Y +  IPTL+LFKDG V    + GA S+S +  ++ + +
Sbjct: 61  IDENQDTPPKYGVRGIPTLMLFKDGNVEATKV-GALSKSQLAAFLDANI 108


>gi|307133002|ref|YP_003885018.1| thioredoxin 1 [Dickeya dadantii 3937]
 gi|306530531|gb|ADN00462.1| thioredoxin 1 [Dickeya dadantii 3937]
          Length = 108

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+  +  +VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDDSFETDVLQSEHVTLVDFWADWCGPCKMIAPILDEIADEFDGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 108


>gi|77359090|ref|YP_338665.1| thioredoxin [Pseudoalteromonas haloplanktis TAC125]
 gi|76555868|emb|CAH57475.1| thioredoxin [Pseudoalteromonas haloplanktis TAC125]
 gi|76874001|emb|CAI85222.1| thioredoxin 1, redox factor [Pseudoalteromonas haloplanktis TAC125]
          Length = 108

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++VL+   PV+VDFWA WC PC  ++PI+ ++A+E   +V I KL+
Sbjct: 1   MSEKIIQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILSEVAEEFDGRVTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG+V    + GA S++ +IE++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLIEFLENNL 108


>gi|325578848|ref|ZP_08148895.1| thioredoxin [Haemophilus parainfluenzae ATCC 33392]
 gi|325159672|gb|EGC71804.1| thioredoxin [Haemophilus parainfluenzae ATCC 33392]
          Length = 107

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 72/108 (66%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F++ V++   PV+VDFWA WC PC  ++PI+D+IA E A K KI K+++
Sbjct: 1   MSEVLHINDADFETTVVQSDIPVLVDFWAPWCGPCKMIAPILDEIAPEFAGKAKIVKINV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  ++ ++ + SIPTL+LFK+G+++   + GA  ++ +  +I   +
Sbjct: 61  DDNQLVAGQFGVRSIPTLLLFKNGQLVATQV-GALPKNQLAAFINQHL 107


>gi|284052125|ref|ZP_06382335.1| thioredoxin [Arthrospira platensis str. Paraca]
 gi|291568589|dbj|BAI90861.1| thioredoxin [Arthrospira platensis NIES-39]
          Length = 107

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 74/108 (68%), Gaps = 2/108 (1%)

Query: 1   MSA-LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  ++V   +F+ +VLE + PV+VDFWA WC PC  ++P++++IA +   ++K+ KL+ 
Sbjct: 1   MSTAVEVTDSTFEQDVLESALPVLVDFWAPWCGPCRMVAPVVEEIAQQYDGQIKVVKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ +++++Y I SIPTL++FK G+ +D M+ GA  +S +   +   +
Sbjct: 61  DENPQVASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKSTLANTLEKYL 107


>gi|85060365|ref|YP_456067.1| thioredoxin 1 [Sodalis glossinidius str. 'morsitans']
 gi|84780885|dbj|BAE75662.1| thioredoxin 1 [Sodalis glossinidius str. 'morsitans']
          Length = 108

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+ +VL+     +VDFWA WC PC  ++PI+ ++ADE   K+ + KL+
Sbjct: 1   MSDKIIHLSDDSFEKDVLQAKGLFLVDFWAEWCGPCKMIAPILAEVADEFDGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LF+DG+V+   + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFRDGEVVATKV-GALSKGQLKEFLNANL 108


>gi|261823429|ref|YP_003261535.1| thioredoxin [Pectobacterium wasabiae WPP163]
 gi|261607442|gb|ACX89928.1| thioredoxin [Pectobacterium wasabiae WPP163]
          Length = 108

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ +TKL+
Sbjct: 1   MSDKIIHLTDDSFDTKVLQADGATLVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLTANL 108


>gi|301155858|emb|CBW15326.1| thioredoxin 1 [Haemophilus parainfluenzae T3T1]
          Length = 107

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 72/108 (66%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F++ V++   PV+VDFWA WC PC  ++PI+D+IA E A K KI K+++
Sbjct: 1   MSEVLHINDADFETAVVQSDIPVLVDFWAPWCGPCKMIAPILDEIAPEFAGKAKIVKINV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  ++ ++ + SIPTL+LFK+G+++   + GA  ++ +  +I   +
Sbjct: 61  DDNQLVAGQFGVRSIPTLLLFKNGQLVATQV-GALPKNQLAAFINQHL 107


>gi|116749143|ref|YP_845830.1| thioredoxin [Syntrophobacter fumaroxidans MPOB]
 gi|116698207|gb|ABK17395.1| thioredoxin [Syntrophobacter fumaroxidans MPOB]
          Length = 110

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    ++V   SFD EVL+   PV+VDFWA WC PC  ++P+I++++ +   ++K+ K 
Sbjct: 1   MAGKNIIEVTDGSFDQEVLQSDVPVLVDFWAPWCGPCRAIAPVIEELSGDYEARLKVAKC 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++ +  +RY I +IPTLI+FK G  +   + GA ++S I   I   V
Sbjct: 61  NVDDNPKTPSRYGIRAIPTLIIFKGGN-VSEQITGAVAKSQITAAIDKAV 109


>gi|153008152|ref|YP_001369367.1| thioredoxin [Ochrobactrum anthropi ATCC 49188]
 gi|151560040|gb|ABS13538.1| thioredoxin [Ochrobactrum anthropi ATCC 49188]
          Length = 107

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/105 (46%), Positives = 79/105 (75%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 1   MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKMIAPALDEIATEMAGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI +
Sbjct: 61  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWIKA 104


>gi|218532783|ref|YP_002423599.1| thioredoxin [Methylobacterium chloromethanicum CM4]
 gi|240141292|ref|YP_002965772.1| thioredoxin [Methylobacterium extorquens AM1]
 gi|254563801|ref|YP_003070896.1| thioredoxin [Methylobacterium extorquens DM4]
 gi|218525086|gb|ACK85671.1| thioredoxin [Methylobacterium chloromethanicum CM4]
 gi|240011269|gb|ACS42495.1| thioredoxin [Methylobacterium extorquens AM1]
 gi|254271079|emb|CAX27086.1| thioredoxin [Methylobacterium extorquens DM4]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF+ +VL+ + PVVVDFWA WC PC ++ P +++I+ +L  KVKI K++++
Sbjct: 1   MATVKVTDASFEQDVLQSAEPVVVDFWAEWCGPCRQIGPALEEISADLQGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI +
Sbjct: 61  ENPGIASTYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWIQA 104


>gi|188584142|ref|YP_001927587.1| thioredoxin [Methylobacterium populi BJ001]
 gi|179347640|gb|ACB83052.1| thioredoxin [Methylobacterium populi BJ001]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF+ +VL+ + PVVVDFWA WC PC ++ P +++I+ +L  KVKI K++++
Sbjct: 1   MATVKVTDASFEQDVLQSAEPVVVDFWAEWCGPCRQIGPALEEISVDLQGKVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  I++ Y I SIPTL++FKDGK+  + + GA+ + D+  WI +
Sbjct: 61  ENPGIASTYGIRSIPTLMIFKDGKLASQKV-GAAPKGDLSRWIQA 104


>gi|119469629|ref|ZP_01612498.1| thioredoxin 1, redox factor [Alteromonadales bacterium TW-7]
 gi|119446876|gb|EAW28147.1| thioredoxin 1, redox factor [Alteromonadales bacterium TW-7]
          Length = 108

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++VL+   PV+VDFWA WC PC  ++PI++++ADE   +V + KL+
Sbjct: 1   MSEKIIQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILNEVADEYDGRVAVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG+V    + GA S++ +IE++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLIEFLDNNI 108


>gi|163782120|ref|ZP_02177119.1| thioredoxin [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882652|gb|EDP76157.1| thioredoxin [Hydrogenivirga sp. 128-5-R1-1]
          Length = 108

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + +   +++ EV+    PV+VDFWA WC PC  ++PII+++A+E   ++K+ KL+ +E
Sbjct: 4   SVVTLTESNWNEEVVNSDKPVLVDFWAPWCGPCRIIAPIIEELAEEFEGQIKVGKLNTDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  I+ +Y I +IPT+ILFK+G+V+D  + G   +  + + +++ V
Sbjct: 64  NPNIAMQYGIRAIPTVILFKNGEVVDTRI-GVQPKEALKQMVMAHV 108


>gi|189423576|ref|YP_001950753.1| thioredoxin [Geobacter lovleyi SZ]
 gi|189419835|gb|ACD94233.1| thioredoxin [Geobacter lovleyi SZ]
          Length = 109

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + L +   +FD +VL+   PV+VDFWA+WC PC  ++P+ID +A + A KVK+ K+++++
Sbjct: 5   AVLTLSDANFDRDVLQSDLPVLVDFWATWCAPCKAIAPLIDAVAADYAGKVKVGKVNVDD 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     +Y +  IPTLILFK GKV+D+++ GA  +S +   I   +
Sbjct: 65  NPATPGKYGVRGIPTLILFKGGKVVDQVV-GAVPKSQLDALIAKAL 109


>gi|118593732|ref|ZP_01551101.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2 [Stappia
           aggregata IAM 12614]
 gi|118433642|gb|EAV40305.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2 [Stappia
           aggregata IAM 12614]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   SF++EVL+   PVVVDFWA WC PC  ++P +++I++E++ +VKITKL+I+
Sbjct: 1   MATTQVTDSSFEAEVLKSDGPVVVDFWAEWCGPCKMIAPALEEISEEMSGQVKITKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++ +Y + SIP LILFKDG+ +   + GA+ +  + +WI S +
Sbjct: 61  ENQDMAMKYGVRSIPMLILFKDGEPMATQI-GAAPKGKLSDWIKSAL 106


>gi|298290319|ref|YP_003692258.1| thioredoxin [Starkeya novella DSM 506]
 gi|296926830|gb|ADH87639.1| thioredoxin [Starkeya novella DSM 506]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 79/107 (73%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M   KV  +SF+S+V++   PV+VDFWA WC PC  ++P++D++A EL DK+KI KL+++
Sbjct: 1   MGVEKVSDQSFESDVIKSDGPVLVDFWAEWCGPCRMVAPVLDEVAGELGDKLKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   +++Y I SIPTL+LFKDG++  R + GA+ ++ +++WI S +
Sbjct: 61  ENPATASKYGIMSIPTLLLFKDGQLASRQV-GAAPKAKMLQWINSAI 106


>gi|242237661|ref|YP_002985842.1| thioredoxin [Dickeya dadantii Ech703]
 gi|242129718|gb|ACS84020.1| thioredoxin [Dickeya dadantii Ech703]
          Length = 108

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD+EVL+   P +VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 1   MSDKIIHLTDGSFDAEVLQAEGPTLVDFWAEWCGPCKMIAPILDEIADEFEGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G++    + GA S+  + E+I   +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGELAATKV-GALSKGQLKEFISHNL 108


>gi|158428381|pdb|2EIQ|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
 gi|158428382|pdb|2EIQ|B Chain B, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
          Length = 108

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAACKV-GALSKGQLKEFLDANL 107


>gi|154250595|ref|YP_001411419.1| thioredoxin [Parvibaculum lavamentivorans DS-1]
 gi|154154545|gb|ABS61762.1| thioredoxin [Parvibaculum lavamentivorans DS-1]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV   SF+++VL+ + PV+VDFWA WC PC ++ P +++IA +   K+ I K++I+
Sbjct: 1   MATNKVTDASFEADVLDAAGPVLVDFWAEWCGPCKQIGPALEEIAKDYGGKLTIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+  + T+Y +  IPTL++FKDG+V    + GA  +  I+EWI + +
Sbjct: 61  ENPNVPTKYGVRGIPTLMIFKDGQVAATKV-GALPKGKIVEWIDNSL 106


>gi|152985086|ref|YP_001351299.1| thioredoxin [Pseudomonas aeruginosa PA7]
 gi|150960244|gb|ABR82269.1| thioredoxin [Pseudomonas aeruginosa PA7]
          Length = 108

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+ +VL+   PV+VD+WA WC PC  ++P++D++A +   K+K+ KL+
Sbjct: 1   MSEHIVNVTDASFEQDVLKADGPVLVDYWAEWCGPCKMIAPVLDEVARDYQGKLKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   +Y +  IPTL+LFK G V    + GA S+S +  ++ + +
Sbjct: 61  IDENQDTPPKYGVRGIPTLMLFKGGNVEATKV-GALSKSQLAAFLDANI 108


>gi|157836387|pdb|2TIR|A Chain A, Crystal Structure Analysis Of A Mutant Escherichia Coli
           Thioredoxin In Which Lysine 36 Is Replaced By Glutamic
           Acid
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCEMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|254705106|ref|ZP_05166934.1| thioredoxin [Brucella suis bv. 3 str. 686]
 gi|261755811|ref|ZP_05999520.1| thioredoxin [Brucella suis bv. 3 str. 686]
 gi|261745564|gb|EEY33490.1| thioredoxin [Brucella suis bv. 3 str. 686]
          Length = 107

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/105 (46%), Positives = 79/105 (75%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+
Sbjct: 1   MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI +
Sbjct: 61  ENPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWIKA 104


>gi|294084827|ref|YP_003551587.1| thioredoxin [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664402|gb|ADE39503.1| thioredoxin [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 106

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  K     F ++VL+   PV+VDFWA WC PC  + P +++I+++  D + I KL+I+
Sbjct: 1   MATTKTTDSDFSTQVLQSDKPVLVDFWAEWCGPCKAIGPALEEISEDKGDSLSIVKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +Y +  IPTL++FKDG V+   + GA  +S +  WI   +
Sbjct: 61  ENPLTPQQYNVRGIPTLLIFKDGAVVAEKV-GALPKSQLENWIEQSI 106


>gi|312127343|ref|YP_003992217.1| thioredoxin [Caldicellulosiruptor hydrothermalis 108]
 gi|311777362|gb|ADQ06848.1| thioredoxin [Caldicellulosiruptor hydrothermalis 108]
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 78/109 (71%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + + +++F+ EVL+   PVVVDFWA+WC PC  ++P+++++A E A KVK  KL+
Sbjct: 1   MANNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVMEELAQEYAGKVKFAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  +I+  ++I SIPT++LFK+GK +D+++ GA  +SD + +I   +
Sbjct: 61  VDDYGDIAYAFRIMSIPTIMLFKNGKAVDKII-GARPKSDFVNFINRNL 108


>gi|238918069|ref|YP_002931583.1| thioredoxin, [Edwardsiella ictaluri 93-146]
 gi|269137457|ref|YP_003294157.1| thioredoxin domain-containing protein [Edwardsiella tarda EIB202]
 gi|238867637|gb|ACR67348.1| thioredoxin, putative [Edwardsiella ictaluri 93-146]
 gi|267983117|gb|ACY82946.1| thioredoxin domain-containing protein [Edwardsiella tarda EIB202]
 gi|304557531|gb|ADM40195.1| thioredoxin domain-containing protein [Edwardsiella tarda FL6-60]
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +    F+++VL+   P++VDFWA WC PC  ++PI+D+IA E A K+ I KL+
Sbjct: 1   MSDKIVHLSDSGFEADVLKAEGPILVDFWAEWCGPCKMIAPILDEIAAEYAGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G V    + GA S++ + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGAVAATKV-GALSKTQLKEFLDANL 108


>gi|315125229|ref|YP_004067232.1| thioredoxin [Pseudoalteromonas sp. SM9913]
 gi|315013742|gb|ADT67080.1| thioredoxin [Pseudoalteromonas sp. SM9913]
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++VL+   PV+VDFWA WC PC  ++PI+ ++A+E   +V ITKL+
Sbjct: 1   MSEKIIQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILSEVAEEFDGRVTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG+V    + GA S++ ++E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLVEFLENNI 108


>gi|149241886|pdb|2H72|A Chain A, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal
           (P61) Space Group
 gi|149241887|pdb|2H72|B Chain B, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal
           (P61) Space Group
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGDVAATKV-GALSKGQLKEFLDANL 107


>gi|319898219|ref|YP_004158312.1| thioredoxin [Bartonella clarridgeiae 73]
 gi|319402183|emb|CBI75714.1| thioredoxin [Bartonella clarridgeiae 73]
          Length = 107

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/107 (47%), Positives = 83/107 (77%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D+ +F+SEVL  S PVVVDFWA WC PC  ++PI+D+IA E+ +++K+ K++I+
Sbjct: 1   MTCIKIDSSNFESEVLTSSLPVVVDFWAEWCGPCKSIAPILDEIATEMQNQIKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++TRY I SIPTL++FK+G+V    + GASS+  ++EW+ + +
Sbjct: 61  ENPELATRYGIRSIPTLLMFKNGEVSSNKV-GASSKGHLVEWVKNNL 106


>gi|88861237|ref|ZP_01135869.1| thioredoxin 1, redox factor [Pseudoalteromonas tunicata D2]
 gi|88816718|gb|EAR26541.1| thioredoxin 1, redox factor [Pseudoalteromonas tunicata D2]
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 76/109 (69%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++VL+   PV+VDFWA WC PC  ++PI+DD+A E AD+V + KL+
Sbjct: 1   MSDKIIQLTDDSFETDVLKADKPVLVDFWAEWCGPCKMIAPILDDVASEYADRVVVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++S    ++ I  IPTL+LFKDG+V    + GA S++ +IE++ + +
Sbjct: 61  IDQNSATPPKFGIRGIPTLLLFKDGQVAATKV-GALSKTQLIEFLENNI 108


>gi|109900520|ref|YP_663775.1| thioredoxin [Pseudoalteromonas atlantica T6c]
 gi|332308442|ref|YP_004436293.1| thioredoxin [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|109702801|gb|ABG42721.1| thioredoxin [Pseudoalteromonas atlantica T6c]
 gi|332175771|gb|AEE25025.1| thioredoxin [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++V+  + PV+VDFWA WC PC  ++PI+ +IADE   K+ + KL+
Sbjct: 1   MSDKIIQLSDDSFEADVINATGPVLVDFWAEWCGPCKMIAPILHEIADEFDGKLTVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E++E   +Y I  IPTL+LFK G V    + GA S+S + E++   +
Sbjct: 61  VDENNETPPKYGIRGIPTLLLFKGGNVAATKV-GALSKSQLEEFLNENI 108


>gi|292493688|ref|YP_003529127.1| thioredoxin [Nitrosococcus halophilus Nc4]
 gi|291582283|gb|ADE16740.1| thioredoxin [Nitrosococcus halophilus Nc4]
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   +F+ EV++   P +VD+WA WC PC  ++PI+++IA E   K+KI KL+
Sbjct: 1   MSDRIISVTDATFEEEVIKSEQPALVDYWAEWCGPCKMVAPILEEIAKEYEGKLKICKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+     RY I  IPTL+LFK+G V    + GA S+S +  +I S +
Sbjct: 61  IDENPSTPPRYGIRGIPTLMLFKNGNVEATKV-GALSKSQLAAFIDSNL 108


>gi|288959563|ref|YP_003449904.1| thioredoxin 1 [Azospirillum sp. B510]
 gi|288911871|dbj|BAI73360.1| thioredoxin 1 [Azospirillum sp. B510]
          Length = 107

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 1   MSA-LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  +KV   SF+ +VL+   PV+VDFWA WC PC  ++P +D++A E   KV I KL+I
Sbjct: 1   MSTTIKVTDDSFEQDVLKADGPVLVDFWAEWCGPCKMIAPALDELAGEYDGKVTIAKLNI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ +  T+Y +  IPTL+LFK G V    + GA  +  + +W+ S +
Sbjct: 61  DENPDTPTKYGVRGIPTLMLFKGGSVAATKI-GALPKGALFQWVDSAL 107


>gi|121998835|ref|YP_001003622.1| thioredoxin [Halorhodospira halophila SL1]
 gi|121590240|gb|ABM62820.1| thioredoxin [Halorhodospira halophila SL1]
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +    ++F+ EVL+ S PV+VD+WA WC PC  + PI+++IA +  D++K+ KL+I+E
Sbjct: 4   AIVHATDQNFEQEVLQASVPVLVDYWAEWCGPCKMIGPILEEIAADYGDRLKVVKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E   +Y I  IPTL+LFK G V    + GA S+S +  +I S +
Sbjct: 64  NPETPPKYGIRGIPTLMLFKGGNVEATKV-GALSKSQLTAFIDSNL 108


>gi|294637930|ref|ZP_06716199.1| thioredoxin [Edwardsiella tarda ATCC 23685]
 gi|291088956|gb|EFE21517.1| thioredoxin [Edwardsiella tarda ATCC 23685]
          Length = 108

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +    F+++VL+   P++VDFWA WC PC  ++PI+D+IA E A K+ I KL+
Sbjct: 1   MSDKIVHLSDSGFEADVLKAEGPILVDFWAEWCGPCKMIAPILDEIAAEYAGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKDGAVAATKV-GALSKTQLKEFLDANL 108


>gi|62182391|ref|YP_218808.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62130024|gb|AAX67727.1| Thioredoxin 1 (TRX1) [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322716884|gb|EFZ08455.1| thioredoxin [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 135

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF ++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 27  MSDKIIHLTDDSFGTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 86

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 87  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 134


>gi|312135383|ref|YP_004002721.1| thioredoxin [Caldicellulosiruptor owensensis OL]
 gi|311775434|gb|ADQ04921.1| thioredoxin [Caldicellulosiruptor owensensis OL]
          Length = 108

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 78/109 (71%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + + +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL+
Sbjct: 1   MANNIVTLTSENFEKEVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  +I+  ++I SIPT++LFKDGK +D+++ GA  +SD + +I   +
Sbjct: 61  VDDYGDIAYAFRIMSIPTIMLFKDGKAVDKII-GARPKSDFVNFINRNL 108


>gi|302871611|ref|YP_003840247.1| thioredoxin [Caldicellulosiruptor obsidiansis OB47]
 gi|312793820|ref|YP_004026743.1| thioredoxin [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|302574470|gb|ADL42261.1| thioredoxin [Caldicellulosiruptor obsidiansis OB47]
 gi|312180960|gb|ADQ41130.1| thioredoxin [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 108

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 78/109 (71%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + + +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL+
Sbjct: 1   MADNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  +I+  ++I SIPT++LFK+GK +D+++ GA  +SD + +I   +
Sbjct: 61  VDDYGDIAYAFRIMSIPTIMLFKNGKAVDKII-GARPKSDFVNFINRNL 108


>gi|56461462|ref|YP_156743.1| thioredoxin [Idiomarina loihiensis L2TR]
 gi|56180472|gb|AAV83194.1| Thioredoxin [Idiomarina loihiensis L2TR]
          Length = 108

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SFD++V+    PV+VDFWA WC PC  ++PI+DDIA E ADK+ I KL+
Sbjct: 1   MSDVIVQLSDDSFDADVINSDKPVLVDFWAEWCGPCKMVAPILDDIASEYADKLVIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + +   +Y I  IPTL+LFK G+V+   + GA S++ + E++   +
Sbjct: 61  VDHNEQTPPKYNIRGIPTLLLFKGGEVVGTKV-GALSRAQLTEFLDQHI 108


>gi|220909594|ref|YP_002484905.1| thioredoxin [Cyanothece sp. PCC 7425]
 gi|219866205|gb|ACL46544.1| thioredoxin [Cyanothece sp. PCC 7425]
          Length = 107

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +ALKV   +F  EVL+   PV+VDFWA WC PC  ++P++D+I+++ A +VK+ K++ +E
Sbjct: 3   AALKVTDSTFKQEVLDSEVPVLVDFWAPWCGPCRMVAPVVDEISEQYAGQVKVVKVNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  ++++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 63  NPSVASQYGIRSIPTLMIFKGGQKVD-MVVGAVPKTTLATTLEKHL 107


>gi|197287126|ref|YP_002152998.1| thioredoxin [Proteus mirabilis HI4320]
 gi|227357183|ref|ZP_03841552.1| thioredoxin [Proteus mirabilis ATCC 29906]
 gi|194684613|emb|CAR46502.1| thioredoxin [Proteus mirabilis HI4320]
 gi|227162715|gb|EEI47682.1| thioredoxin [Proteus mirabilis ATCC 29906]
          Length = 108

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L +   +FD +VL+ + PV+VDFWA WC PC  ++PI+D++A E A K+ + KL+
Sbjct: 1   MSDKILHLSDNTFDVDVLQATGPVLVDFWAEWCGPCKMIAPILDEVATEYAGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTLILFK+G V    + GA S++ + E++   +
Sbjct: 61  IDENPATAPKYGIRGIPTLILFKNGAVAATKV-GALSKTQLKEFLDENI 108


>gi|90408658|ref|ZP_01216810.1| putative thioredoxin [Psychromonas sp. CNPT3]
 gi|90310234|gb|EAS38367.1| putative thioredoxin [Psychromonas sp. CNPT3]
          Length = 108

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++V+  + PV+VDFWA WC PC  ++P++ +IA E A KV + KL+
Sbjct: 1   MSDKIVTLTDASFDADVINAAGPVLVDFWAEWCGPCKMIAPLLSEIATEYAGKVTVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+S    ++ I  IPTL+LFKDGKV    + GA S++ ++E++ + +
Sbjct: 61  IDENSATPPKFGIRGIPTLLLFKDGKVAATKV-GALSKTQLVEFLDANI 108


>gi|195952996|ref|YP_002121286.1| thioredoxin [Hydrogenobaculum sp. Y04AAS1]
 gi|195932608|gb|ACG57308.1| thioredoxin [Hydrogenobaculum sp. Y04AAS1]
          Length = 108

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   +++   ++++EV+  S PV+VDFWA WC PC  ++P+++ +A E A ++K+ KL+
Sbjct: 1   MAQNVVELTDANWENEVINSSVPVLVDFWAPWCGPCRIIAPVVEKLAGEFAGQIKVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +++  +S RY I +IPT+++FK+G+V+D  + G   +  + + I + +
Sbjct: 61  TDDNPGVSMRYGIRAIPTIMMFKNGEVVDTRV-GVQPEDGLRKMIKNNL 108


>gi|56752273|ref|YP_172974.1| thioredoxin [Synechococcus elongatus PCC 6301]
 gi|81300639|ref|YP_400847.1| thioredoxin [Synechococcus elongatus PCC 7942]
 gi|135760|sp|P12243|THIO1_SYNE7 RecName: Full=Thioredoxin-1; Short=Trx-1; AltName:
           Full=Thioredoxin-M
 gi|79689|pir||A32956 thioredoxin m - Synechococcus sp
 gi|142154|gb|AAA22057.1| thioredoxin [Synechococcus elongatus PCC 6301]
 gi|24251253|gb|AAN46173.1| unknown protein [Synechococcus elongatus PCC 7942]
 gi|56687232|dbj|BAD80454.1| thioredoxin [Synechococcus elongatus PCC 6301]
 gi|81169520|gb|ABB57860.1| thioredoxin [Synechococcus elongatus PCC 7942]
          Length = 107

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 73/108 (67%), Gaps = 2/108 (1%)

Query: 1   MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS    V   +F  EVLE S PV+VDFWA WC PC  ++P++D+IA + +D+VK+ K++ 
Sbjct: 1   MSVAAAVTDATFKQEVLESSIPVLVDFWAPWCGPCRMVAPVVDEIAQQYSDQVKVVKVNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+  ++++Y I SIPTL++FKDG+ +D ++ GA  ++ +   +   +
Sbjct: 61  DENPSVASQYGIRSIPTLMIFKDGQRVDTVV-GAVPKTTLANTLDKHL 107


>gi|312877468|ref|ZP_07737431.1| thioredoxin [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795789|gb|EFR12155.1| thioredoxin [Caldicellulosiruptor lactoaceticus 6A]
          Length = 108

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 78/109 (71%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + + +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL+
Sbjct: 1   MANNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  +I+  ++I SIPT++LFK+G+ +D+++ GA  +SD + +I   +
Sbjct: 61  VDDYGDIAYAFRIMSIPTIMLFKNGRAVDKII-GARPKSDFVNFINRNL 108


>gi|110635908|ref|YP_676116.1| thioredoxin [Mesorhizobium sp. BNC1]
 gi|110286892|gb|ABG64951.1| thioredoxin [Chelativorans sp. BNC1]
          Length = 107

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/103 (46%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD+ +F S+VL+   PVVVDFWA WC PC  ++P +++I+ E+  KVK+ KL+I+
Sbjct: 1   MATVKVDSGNFQSDVLQACEPVVVDFWAEWCGPCKMIAPALEEISSEMQGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ RY + SIPTL+LFK+G+V D  + GA+ ++ +  WI
Sbjct: 61  ENPELAARYGVRSIPTLMLFKNGEVADMKV-GAAPKTALSAWI 102


>gi|254281829|ref|ZP_04956797.1| thioredoxin [gamma proteobacterium NOR51-B]
 gi|219678032|gb|EED34381.1| thioredoxin [gamma proteobacterium NOR51-B]
          Length = 108

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   SF+S+VL    PV+VDFWA WC PC  ++P++++IA E A K+K+ K+D++ 
Sbjct: 4   AIVHVTDTSFESDVLTADEPVLVDFWAEWCGPCKMIAPVLEEIAAEYAGKLKVAKVDVDS 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     ++ I  IPTLILFKDG  +D  + GA S+S + E+I + +
Sbjct: 64  NPGTPEKFGIRGIPTLILFKDGNAVDTKV-GALSKSQLAEFIEASL 108


>gi|317494808|ref|ZP_07953219.1| thioredoxin [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917133|gb|EFV38481.1| thioredoxin [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 108

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+   P++VDFWA WC PC  ++PI+D+IA E   K+ I KL+
Sbjct: 1   MSDKIVHLSDNSFDTDVLKAEGPILVDFWAEWCGPCKMIAPILDEIATEYEGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + ++ I  IPTL+LFK+G V    + GA S++ + E++ + +
Sbjct: 61  IDENPATAPKFGIRGIPTLLLFKNGAVAATKV-GALSKTQLKEFLDANL 108


>gi|88705508|ref|ZP_01103218.1| Thioredoxin [Congregibacter litoralis KT71]
 gi|88700021|gb|EAQ97130.1| Thioredoxin [Congregibacter litoralis KT71]
          Length = 109

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   SF+ +VL    PV+VDFWA WC PC  ++P++D++A E A K+K+ K+D++ 
Sbjct: 4   AIVHVSDASFEQDVLSSDVPVLVDFWAEWCGPCKMIAPVLDELAGEFAGKLKVCKVDVDA 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E+  ++ I  IPTLILFKDG      + GA S+S ++E++   +
Sbjct: 64  NPEVPGKFGIRGIPTLILFKDGNAEATKV-GALSKSQLVEFVNESI 108


>gi|114319530|ref|YP_741213.1| thioredoxin [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225924|gb|ABI55723.1| thioredoxin [Alkalilimnicola ehrlichii MLHE-1]
          Length = 108

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +    ++F+ EV++   PV+VD+WA WC PC  ++PI+D++A E A K+K+ KL+
Sbjct: 1   MSGQIVHATDQNFEDEVIKAGEPVLVDYWADWCGPCKMITPILDEVASEYAGKLKVVKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ E   +Y I  IPTL+LFK+G V    + GA S+S +  +I S +
Sbjct: 61  IDENPETPPKYGIRGIPTLMLFKNGGVEATKV-GALSKSQLTAFIDSNL 108


>gi|332530636|ref|ZP_08406569.1| thioredoxin [Hylemonella gracilis ATCC 19624]
 gi|332039919|gb|EGI76312.1| thioredoxin [Hylemonella gracilis ATCC 19624]
          Length = 111

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      V   SF+++VL  S PV+VD+WA WC PC  ++P++D++A     K++I KL
Sbjct: 1   MASELIKHVSDASFEADVLNASQPVLVDYWAEWCGPCKMIAPVLDEVAGTYQGKLQIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ +I  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDENRDIPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFIDQQL 109


>gi|222529610|ref|YP_002573492.1| thioredoxin [Caldicellulosiruptor bescii DSM 6725]
 gi|312622172|ref|YP_004023785.1| thioredoxin [Caldicellulosiruptor kronotskyensis 2002]
 gi|222456457|gb|ACM60719.1| thioredoxin [Caldicellulosiruptor bescii DSM 6725]
 gi|312202639|gb|ADQ45966.1| thioredoxin [Caldicellulosiruptor kronotskyensis 2002]
          Length = 108

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 78/109 (71%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + + +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL+
Sbjct: 1   MADNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  +I+  ++I SIPT++LFK+G+ +D+++ GA  +SD + +I   +
Sbjct: 61  VDDYGDIAYAFRIMSIPTIMLFKNGRAVDKII-GARPKSDFVNFINRNL 108


>gi|149927013|ref|ZP_01915271.1| thioredoxin [Limnobacter sp. MED105]
 gi|149824234|gb|EDM83454.1| thioredoxin [Limnobacter sp. MED105]
          Length = 109

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 72/110 (65%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   SFDS+VL+   PV+VD+WA WC PC  ++PI+DD++ E   K++I K+
Sbjct: 1   MSSDLIKHVSDASFDSDVLKTDGPVLVDYWAEWCGPCKMIAPILDDLSSEYNGKLQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E++E   +Y I  IPTL+LFK+G V+   + GA S+S +  +I S +
Sbjct: 61  NVDENAETPAKYGIRGIPTLMLFKNGAVVATKV-GALSKSQLAAFIDSHL 109


>gi|83643187|ref|YP_431622.1| thioredoxin [Hahella chejuensis KCTC 2396]
 gi|83631230|gb|ABC27197.1| thioredoxin [Hahella chejuensis KCTC 2396]
          Length = 108

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+SEVL+   PV+VD+WA WC PC  ++P++++IA+E  D++KI KL+
Sbjct: 1   MSSRIVNVTDDSFESEVLKADGPVLVDYWAEWCGPCKMIAPVLEEIAEEYGDRLKICKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   ++ I  IPTL+LFK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDENEKTPPKFSIRGIPTLMLFKNGAVDATKV-GALSKSQLTAFLDSNL 108


>gi|241767094|ref|ZP_04764867.1| thioredoxin [Acidovorax delafieldii 2AN]
 gi|241362341|gb|EER58331.1| thioredoxin [Acidovorax delafieldii 2AN]
          Length = 110

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   SF+++VL+   PV+VD+WA WC PC  ++PI+D++A     K++I K+
Sbjct: 1   MASELIKHLSDASFEADVLKAGTPVLVDYWAEWCGPCKMIAPILDEVAGTYQGKLQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ EI  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDENREIPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFIEQQL 109


>gi|77166041|ref|YP_344566.1| thioredoxin [Nitrosococcus oceani ATCC 19707]
 gi|254436369|ref|ZP_05049875.1| thioredoxin [Nitrosococcus oceani AFC27]
 gi|76884355|gb|ABA59036.1| thioredoxin [Nitrosococcus oceani ATCC 19707]
 gi|207088059|gb|EDZ65332.1| thioredoxin [Nitrosococcus oceani AFC27]
          Length = 110

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F+ EVL+   P +VD+WA WC PC  ++PI+++IA++   K+KI KL+I+E+ 
Sbjct: 8   VTVTDATFEEEVLKSEQPALVDYWAEWCGPCKTVAPILEEIANDYQGKLKICKLNIDENP 67

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               RY I  IPTL+LFK+G V    + GA S+S +  +I S +
Sbjct: 68  STPPRYGIRGIPTLMLFKNGNVEATKV-GALSKSQLSAFIDSNL 110


>gi|209966105|ref|YP_002299020.1| thioredoxin [Rhodospirillum centenum SW]
 gi|209959571|gb|ACJ00208.1| thioredoxin [Rhodospirillum centenum SW]
          Length = 107

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS A  V   SF ++VLE S PV+VDFWA WC PC  ++P +D+IA EL  K+ + KL+I
Sbjct: 1   MSNATAVSDASFTTDVLEASGPVLVDFWAEWCGPCRMIAPALDEIAGELQGKLTVAKLNI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+    TRY +  IPTL++FKDGKV    + GA  +  +  WI   +
Sbjct: 61  DENPGTPTRYGVRGIPTLMIFKDGKVAATKI-GALPKQQLRNWIEENL 107


>gi|145636706|ref|ZP_01792372.1| thioredoxin [Haemophilus influenzae PittHH]
 gi|145270004|gb|EDK09941.1| thioredoxin [Haemophilus influenzae PittHH]
 gi|309972784|gb|ADO95985.1| Thioredoxin [Haemophilus influenzae R2846]
          Length = 107

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+  + PV++DFWA WC PC  ++P++D++A E + KVKI K+++
Sbjct: 1   MSEVLHINDADFESVVVNSNIPVLLDFWAPWCGPCKMIAPVLDELAPEFSGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA  ++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALPKTQLANFINQHI 107


>gi|251787807|ref|YP_003002528.1| thioredoxin [Dickeya zeae Ech1591]
 gi|247536428|gb|ACT05049.1| thioredoxin [Dickeya zeae Ech1591]
          Length = 108

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL   +  +VDFWA WC PC  ++PI+D+IADE   K+KI KL+
Sbjct: 1   MSDKIIHLTDDSFETDVLRSEHVTLVDFWADWCGPCKMIAPILDEIADEFEGKLKIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDDNPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLNANL 108


>gi|254491599|ref|ZP_05104778.1| thioredoxin [Methylophaga thiooxidans DMS010]
 gi|224463077|gb|EEF79347.1| thioredoxin [Methylophaga thiooxydans DMS010]
          Length = 108

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V    FDS+VL+   PV+VD+WA WC PC  ++P++++I  E A K+KI KL+
Sbjct: 1   MSENVTNVTDGDFDSQVLQSDMPVLVDYWAEWCGPCKMIAPVLEEIGSEYAGKLKICKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   RY I  IPTL+LFK G+V    + GA ++S +  ++ S +
Sbjct: 61  IDENQDTPPRYGIRGIPTLMLFKGGEVEATKV-GALTKSQLTAFLDSNI 108


>gi|146296734|ref|YP_001180505.1| thioredoxin [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410310|gb|ABP67314.1| thioredoxin [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 115

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 78/109 (71%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + + +++F+ EVL+   PVVVDFWA+WC PC  ++P+I+++A E A KVK  KL+
Sbjct: 8   MANNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLN 67

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  +I+  ++I SIPT++LFK+G+ +D+++ GA  +SD + +I   +
Sbjct: 68  VDDYGDIAYAFRIMSIPTIMLFKNGQAVDKII-GARPKSDFVNFINRNL 115


>gi|167629921|ref|YP_001680420.1| thioredoxin [Heliobacterium modesticaldum Ice1]
 gi|167592661|gb|ABZ84409.1| thioredoxin [Heliobacterium modesticaldum Ice1]
          Length = 109

 Score =  107 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 73/110 (66%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + +   +F ++VL+ S PV+VDFWA+WC PC  ++PIID++AD +A K  + KL
Sbjct: 1   MASANVVALTDDNFRTQVLQSSKPVLVDFWAAWCGPCKMIAPIIDEVADAMAGKAVVGKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+   +  Y I SIPTL++FK G+V+D+ + G   + ++I+ +   +
Sbjct: 61  NVDENRATAAEYGIMSIPTLLVFKGGQVVDKAI-GFKPKDELIKLLNKHI 109


>gi|148825638|ref|YP_001290391.1| thioredoxin [Haemophilus influenzae PittEE]
 gi|260582001|ref|ZP_05849796.1| thioredoxin [Haemophilus influenzae NT127]
 gi|148715798|gb|ABQ98008.1| thioredoxin [Haemophilus influenzae PittEE]
 gi|260094891|gb|EEW78784.1| thioredoxin [Haemophilus influenzae NT127]
          Length = 107

 Score =  107 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+    PV++DFWA WC PC  ++P++D++A E + KVKI K+++
Sbjct: 1   MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFSGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA  ++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALPKTQLANFINQHI 107


>gi|114776545|ref|ZP_01451590.1| thioredoxin [Mariprofundus ferrooxydans PV-1]
 gi|114553375|gb|EAU55773.1| thioredoxin [Mariprofundus ferrooxydans PV-1]
          Length = 110

 Score =  107 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    + V  +SFD++VL+ S PV+VDFWA WC PC +++PI+D++A E   +V I K+
Sbjct: 1   MSSDLIIHVSDESFDADVLKASGPVLVDFWAPWCGPCKQIAPILDEVAGEKQGQVTIAKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++     +Y +  IPTL+LF  G V    + GA +++ + E+I   +
Sbjct: 61  NIDDNPNTPGKYGVRGIPTLMLFSGGNVQGTKV-GAVNKAKLGEFIDEHL 109


>gi|300113245|ref|YP_003759820.1| thioredoxin [Nitrosococcus watsonii C-113]
 gi|299539182|gb|ADJ27499.1| thioredoxin [Nitrosococcus watsonii C-113]
          Length = 110

 Score =  107 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F+ EVL+   P +VD+WA WC PC  ++PI+++IA++   K+KI KL+I+E+ 
Sbjct: 8   VTVTDATFEEEVLKSEQPALVDYWAEWCGPCKTVAPILEEIANDYQGKIKICKLNIDENP 67

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               RY I  IPTL+LFK+G V    + GA S+S +  +I S +
Sbjct: 68  STPPRYGIRGIPTLMLFKNGNVEATKV-GALSKSQLSAFIDSNL 110


>gi|254422668|ref|ZP_05036386.1| thioredoxin [Synechococcus sp. PCC 7335]
 gi|196190157|gb|EDX85121.1| thioredoxin [Synechococcus sp. PCC 7335]
          Length = 106

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA +V   +F  EVLE   PV+VDFWA WC PC  ++P++D+I+++   +VK+ K++ +
Sbjct: 1   MSAAQVTDSTFKQEVLENETPVLVDFWAPWCGPCRMVAPVVDEISEQYDGQVKVVKVNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+  ++++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 61  ENPSVASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLANTLEKYL 106


>gi|218780249|ref|YP_002431567.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
 gi|218761633|gb|ACL04099.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
          Length = 108

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   L+V+  SFDS+V++   PV+VDFWA WC PC  ++P+++++A ++ DKV   K +
Sbjct: 1   MAEGILEVNDSSFDSDVMQSDKPVLVDFWAPWCGPCRAIAPVVEELAAQMGDKVAFAKCN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++    +++ I +IPTLI+FK G+V+++ + G   ++ I E +   +
Sbjct: 61  VDDNPATPSKFGIRAIPTLIVFKGGEVVEQ-ITGNVPRAKIEEALNKAL 108


>gi|325291475|ref|YP_004277339.1| thioredoxin [Agrobacterium sp. H13-3]
 gi|325059328|gb|ADY63019.1| thioredoxin [Agrobacterium sp. H13-3]
          Length = 106

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/103 (48%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE S PVVVDFWA WC PC  ++P +++I+ ELA KVK+ KL+I+
Sbjct: 1   MATVKVDAANFQSEVLESSEPVVVDFWAEWCGPCKMIAPSLEEISSELAGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA+ ++ +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKSGEVADIKV-GAAPKTALSAWI 102


>gi|237747651|ref|ZP_04578131.1| thioredoxin [Oxalobacter formigenes OXCC13]
 gi|229379013|gb|EEO29104.1| thioredoxin [Oxalobacter formigenes OXCC13]
          Length = 108

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+     +   SF+++VL+   PV+VDFWA WC PC  ++PI+D++A E A KV  TK+D
Sbjct: 1   MANNIKTISDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPIVDEVASEYAGKVNFTKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +     ++ I  IPTLILFK+G ++ + + GA S+S +  +I S +
Sbjct: 61  VDSNPATPAKFGIRGIPTLILFKNGAIVSQKV-GALSKSQLTAFIDSNI 108


>gi|34497039|ref|NP_901254.1| thioredoxin [Chromobacterium violaceum ATCC 12472]
 gi|34330323|gb|AAQ59260.2| thioredoxin [Chromobacterium violaceum ATCC 12472]
          Length = 108

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L V   SF++EVL+   PV+VD+WA WC PC  ++PI+D++A E   K+KI KL+
Sbjct: 1   MSDLILHVTDDSFENEVLKADRPVLVDYWAEWCGPCKMIAPILDEVAKEYDGKLKIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ +   ++ I  IPTL+LFKDG+V    + GA S+S +  +I S++
Sbjct: 61  IDQNEQTPPKFGIRGIPTLMLFKDGQVAATKV-GALSKSQLTAFIDSQL 108


>gi|68248634|ref|YP_247746.1| thioredoxin [Haemophilus influenzae 86-028NP]
 gi|145629039|ref|ZP_01784838.1| thioredoxin [Haemophilus influenzae 22.1-21]
 gi|145639623|ref|ZP_01795226.1| thioredoxin [Haemophilus influenzae PittII]
 gi|145642169|ref|ZP_01797738.1| thioredoxin [Haemophilus influenzae R3021]
 gi|68056833|gb|AAX87086.1| thioredoxin [Haemophilus influenzae 86-028NP]
 gi|144978542|gb|EDJ88265.1| thioredoxin [Haemophilus influenzae 22.1-21]
 gi|145271180|gb|EDK11094.1| thioredoxin [Haemophilus influenzae PittII]
 gi|145273160|gb|EDK13037.1| thioredoxin [Haemophilus influenzae 22.4-21]
 gi|301168677|emb|CBW28268.1| thioredoxin 1 [Haemophilus influenzae 10810]
 gi|309750596|gb|ADO80580.1| Thioredoxin [Haemophilus influenzae R2866]
          Length = 107

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+    PV++DFWA WC PC  ++P++D++A E A KVKI K+++
Sbjct: 1   MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA  ++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALPKTQLANFINQHI 107


>gi|319944210|ref|ZP_08018486.1| thioredoxin [Lautropia mirabilis ATCC 51599]
 gi|319742505|gb|EFV94916.1| thioredoxin [Lautropia mirabilis ATCC 51599]
          Length = 106

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    V   SFD++VL+   PV+VDFWA WC PC  ++PI+D+++ + +D++ + K++++
Sbjct: 1   MGIKNVSADSFDTDVLKSDVPVLVDFWAEWCGPCKLIAPILDEVSHDYSDRMAVAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +S  I+ +Y I  IPTL+LFK+G ++   + GA S+  +  ++ S +
Sbjct: 61  DSQAIAAKYGIRGIPTLMLFKNGTLVGTKV-GAVSKGQLTAFLDSNL 106


>gi|159184127|ref|NP_353062.2| thioredoxin [Agrobacterium tumefaciens str. C58]
 gi|159139464|gb|AAK85847.2| thioredoxin [Agrobacterium tumefaciens str. C58]
          Length = 106

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 76/106 (71%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ ELA KVK+ KL+I+
Sbjct: 1   MATVKVDAANFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISSELAGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E++ ++ + SIPTL +FK G+V D  + GA+ ++ +  WI S 
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADIKV-GAAPKTALSAWISSA 105


>gi|227823892|ref|YP_002827865.1| thioredoxin [Sinorhizobium fredii NGR234]
 gi|227342894|gb|ACP27112.1| thioredoxin [Sinorhizobium fredii NGR234]
          Length = 107

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/103 (48%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F  EVL  + PVVVDFWA WC PC  ++P +++IA ELA KVK+ KL+I+
Sbjct: 1   MATVKVDASNFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEIATELAGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ +Y + SIPTL LFK G+V D  + GA+ ++ +  WI
Sbjct: 61  ENPELAAQYGVRSIPTLALFKAGEVADIKV-GAAPKTALSSWI 102


>gi|170742304|ref|YP_001770959.1| thioredoxin [Methylobacterium sp. 4-46]
 gi|168196578|gb|ACA18525.1| thioredoxin [Methylobacterium sp. 4-46]
          Length = 107

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF  +VLE S PVVVDFWA WC PC  + P++++I+ E+  +VKI K++++
Sbjct: 1   MATVKVTDASFRQDVLEASEPVVVDFWAEWCGPCQAIGPVLEEISSEMQGRVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+  I + Y I  IPTL++FKDGK+  + + GA+ + D++ WI S +
Sbjct: 61  ENPGIVSEYGIRPIPTLMIFKDGKLASQKV-GAAPKGDLLRWIQSAI 106


>gi|237809399|ref|YP_002893839.1| thioredoxin [Tolumonas auensis DSM 9187]
 gi|237501660|gb|ACQ94253.1| thioredoxin [Tolumonas auensis DSM 9187]
          Length = 108

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+++VL  S PV+VDFWA WC PC  ++PI+D++A E A K+ I KL+
Sbjct: 1   MSDKIVHVTDASFENDVLNASAPVLVDFWAEWCGPCKMIAPILDEVAGEYAGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++S    ++ I  IPTL+LFK+G V    + GA S++ + E++ + +
Sbjct: 61  IDQNSGTPPKFGIRGIPTLLLFKNGAVAATKV-GALSKTQLKEFLDAHL 108


>gi|254503055|ref|ZP_05115206.1| thioredoxin [Labrenzia alexandrii DFL-11]
 gi|222439126|gb|EEE45805.1| thioredoxin [Labrenzia alexandrii DFL-11]
          Length = 106

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   SF+++VL    PVVVDFWA WC PC  ++P +++I++E+  +VKITKL+I+
Sbjct: 1   MATTQVTDASFEADVLNSDEPVVVDFWAEWCGPCKMIAPALEEISEEMNGQVKITKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++ +Y + SIP LILFK G+ +   + GA+ +  + +WI S +
Sbjct: 61  ENQDMAMKYGVRSIPMLILFKGGEPMATQV-GAAPKGKLSDWIKSAL 106


>gi|121594698|ref|YP_986594.1| thioredoxin [Acidovorax sp. JS42]
 gi|222110698|ref|YP_002552962.1| thioredoxin [Acidovorax ebreus TPSY]
 gi|120606778|gb|ABM42518.1| thioredoxin [Acidovorax sp. JS42]
 gi|221730142|gb|ACM32962.1| thioredoxin [Acidovorax ebreus TPSY]
          Length = 110

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   SF+++VL+   PV+VD+WA WC PC  ++PI+D++A     K+ I K+
Sbjct: 1   MASELIKHLSDASFEADVLKAGTPVLVDYWAEWCGPCKMIAPILDEVAGAYQGKLTIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ EI  ++ I  IPTL+LFK+G++    + GA S++ +  +I  ++
Sbjct: 61  NVDENREIPAKFGIRGIPTLMLFKNGELAATKV-GAMSKAQLTAFIDQQL 109


>gi|260913061|ref|ZP_05919543.1| thioredoxin-1 [Pasteurella dagmatis ATCC 43325]
 gi|260632648|gb|EEX50817.1| thioredoxin-1 [Pasteurella dagmatis ATCC 43325]
          Length = 106

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L     +F ++V+    PV++DFWA WC PC  +SPI+D+IA E + KVK+ K++I+
Sbjct: 1   MEVLHSTDATFAADVVNSDVPVLLDFWAPWCGPCRMISPILDEIATEFSGKVKVVKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  + SIPTL+LFKDGK +   + GA  ++ +  +I   +
Sbjct: 61  ENQATPAQLGVRSIPTLVLFKDGKPVATQV-GALPKNQLANFINQNI 106


>gi|304309757|ref|YP_003809355.1| Thioredoxin [gamma proteobacterium HdN1]
 gi|301795490|emb|CBL43688.1| Thioredoxin [gamma proteobacterium HdN1]
          Length = 108

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L +   +F++EVL   +PV+VD+WA WC PC  ++PI++++A E A KVK+ KL+
Sbjct: 1   MSNNILNITDSTFEAEVLSSDSPVLVDYWAEWCGPCKMIAPILEEVATEYAGKVKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++     RY I  IPTL+LFK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDQNPGTPPRYGIRGIPTLMLFKNGNVEATKV-GALSKSQLTAFLDSNI 108


>gi|17227548|ref|NP_484096.1| thioredoxin [Nostoc sp. PCC 7120]
 gi|75908866|ref|YP_323162.1| thioredoxin [Anabaena variabilis ATCC 29413]
 gi|61248483|sp|P0A4L1|THIO1_ANASP RecName: Full=Thioredoxin-1; Short=Trx-1; AltName:
           Full=Thioredoxin-M
 gi|61248485|sp|P0A4L2|THIO1_ANASO RecName: Full=Thioredoxin-1; Short=Trx-1; AltName:
           Full=Thioredoxin-M
 gi|7427614|pir||TXAI thioredoxin 1 - Anabaena sp
 gi|142118|gb|AAA22049.1| thioredoxin [Anabaena sp.]
 gi|17135030|dbj|BAB77576.1| thioredoxin [Nostoc sp. PCC 7120]
 gi|75702591|gb|ABA22267.1| thioredoxin [Anabaena variabilis ATCC 29413]
          Length = 107

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A +V   +F  EVL+   PV+VDFWA WC PC  ++P++D+IA +   K+K+ K++ +E
Sbjct: 3   AAAQVTDSTFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEIAQQYEGKIKVVKVNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +++++Y I SIPTL++FK G+ +D M+ GA  ++ + + +   +
Sbjct: 63  NPQVASQYGIRSIPTLMIFKGGQKVD-MVVGAVPKTTLSQTLEKHL 107


>gi|312796074|ref|YP_004028996.1| Thioredoxin [Burkholderia rhizoxinica HKI 454]
 gi|312167849|emb|CBW74852.1| Thioredoxin [Burkholderia rhizoxinica HKI 454]
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +VL+   PV++DFWA WC PC  ++P++D++A +  D++++ K+D
Sbjct: 1   MSEQIKHITDASFEQDVLKADKPVLLDFWAEWCGPCKMIAPLLDEVARDYGDRLQVAKID 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++     ++ +  IPTLILFK+G V+ +   GA S++ I   I S +
Sbjct: 61  VDQNPSTPAKFSVRGIPTLILFKNG-VVAQTKVGALSKAQITALIDSHI 108


>gi|158428377|pdb|2EIO|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
 gi|158428378|pdb|2EIO|B Chain B, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
 gi|158428379|pdb|2EIO|C Chain C, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
 gi|158428380|pdb|2EIO|D Chain D, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  +  ++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKCFLDANL 107


>gi|220933543|ref|YP_002512442.1| thioredoxin [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994853|gb|ACL71455.1| thioredoxin [Thioalkalivibrio sp. HL-EbGR7]
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L V   SF+ EVL+   PV+VD+WA WC PC  ++PI+D+IA E  D+VKI KL+
Sbjct: 1   MSEKILHVTDASFEDEVLKSEQPVLVDYWAEWCGPCKMIAPILDEIASEYGDRVKIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+     +Y I  IPTL+LFK G V    + GA S+S +  ++   +
Sbjct: 61  IDENPGTPPKYGIRGIPTLMLFKGGSVEATKV-GALSKSQLTAFLDQNI 108


>gi|33861617|ref|NP_893178.1| thioredoxin [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
 gi|33634194|emb|CAE19520.1| Thioredoxin [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
          Length = 107

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SFD EVL+ + PV+VDFWA WC PC  ++P++++I+ +   K+K+ KL+ +E+  +
Sbjct: 7   VTDSSFDKEVLQSNLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   +   +
Sbjct: 67  ASQYGIRSIPTLMIFKGGQKVDTVV-GAVPKATLSSTLSKHL 107


>gi|288817546|ref|YP_003431893.1| thioredoxin [Hydrogenobacter thermophilus TK-6]
 gi|288786945|dbj|BAI68692.1| thioredoxin [Hydrogenobacter thermophilus TK-6]
 gi|308751149|gb|ADO44632.1| thioredoxin [Hydrogenobacter thermophilus TK-6]
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + +   ++ +EV+    PVVVDFWA WC PC  ++PII+++A EL DKVK  KL+
Sbjct: 1   MAGGVIVLTESNWHAEVINSDKPVVVDFWAPWCGPCRIIAPIIEELAMELGDKVKFGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +E+  I+ +Y I +IPT++LF  G++ D  + G   +  + + ILS +
Sbjct: 61  TDENPNIAMQYGIRAIPTIMLFSKGEIADTRI-GVQPKEALKQMILSHI 108


>gi|152997586|ref|YP_001342421.1| thioredoxin [Marinomonas sp. MWYL1]
 gi|150838510|gb|ABR72486.1| thioredoxin [Marinomonas sp. MWYL1]
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++    F  EVL    PV+VDFWA WC PC  ++P+++D+A E A KVK+ KL+
Sbjct: 1   MSENTIQITDAQFAEEVLNSEIPVIVDFWAPWCGPCKMIAPVLEDVAAEYAGKVKVVKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+ E + +Y +  IPTL++ K G+V+   + GA S+S +++++ S +
Sbjct: 61  VDENQETAPKYNVRGIPTLLIVKGGEVVATKV-GAVSKSQLVDFVNSAI 108


>gi|183600258|ref|ZP_02961751.1| hypothetical protein PROSTU_03810 [Providencia stuartii ATCC 25827]
 gi|188020046|gb|EDU58086.1| hypothetical protein PROSTU_03810 [Providencia stuartii ATCC 25827]
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+SEVL  S+PV+VDFWA+WC PC  ++PI+D++ +E   K+ I KL+
Sbjct: 1   MSDKIIHITDASFESEVLNASSPVLVDFWAAWCGPCKMIAPILDEVVEEYTGKLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G V+   + G  S+  + E++   +
Sbjct: 61  IDDNPATAPKYGIRGIPTLLLFKNGNVVATKV-GIFSKIQLKEFLDENL 108


>gi|75765744|pdb|1ZCP|A Chain A, Crystal Structure Of A Catalytic Site Mutant E. Coli Trxa
           (Caca)
 gi|75765745|pdb|1ZCP|B Chain B, Crystal Structure Of A Catalytic Site Mutant E. Coli Trxa
           (Caca)
 gi|75765746|pdb|1ZCP|C Chain C, Crystal Structure Of A Catalytic Site Mutant E. Coli Trxa
           (Caca)
 gi|75765747|pdb|1ZCP|D Chain D, Crystal Structure Of A Catalytic Site Mutant E. Coli Trxa
           (Caca)
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC     ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|319763163|ref|YP_004127100.1| thioredoxin [Alicycliphilus denitrificans BC]
 gi|330825226|ref|YP_004388529.1| thioredoxin [Alicycliphilus denitrificans K601]
 gi|317117724|gb|ADV00213.1| thioredoxin [Alicycliphilus denitrificans BC]
 gi|329310598|gb|AEB85013.1| thioredoxin [Alicycliphilus denitrificans K601]
          Length = 110

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 73/110 (66%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+     ++   SF+++VL+ S PV+VD+WA WC PC  ++PI+D++A     K+++ K+
Sbjct: 1   MASDLIKQLSDASFEADVLKSSTPVLVDYWAEWCGPCKMIAPILDEVASAYQGKLQVAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++ EI  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDDNREIPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFIDQQL 109


>gi|239815306|ref|YP_002944216.1| thioredoxin [Variovorax paradoxus S110]
 gi|239801883|gb|ACS18950.1| thioredoxin [Variovorax paradoxus S110]
          Length = 110

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 72/110 (65%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   SF+++VL+ S PV+VD+WA WC PC  ++PI+D+++     K++I KL
Sbjct: 1   MASDLIKHISDSSFEADVLKSSQPVLVDYWAEWCGPCKMIAPILDEVSTAYEGKLQIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ +I  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDENRDIPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFIDQQL 109


>gi|123966384|ref|YP_001011465.1| thioredoxin [Prochlorococcus marinus str. MIT 9515]
 gi|123200750|gb|ABM72358.1| Thioredoxin [Prochlorococcus marinus str. MIT 9515]
          Length = 107

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SFD EVL+   PV+VDFWA WC PC  ++P++++I+ +   K+K+ KL+ +E+  +
Sbjct: 7   VTDSSFDKEVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   +   +
Sbjct: 67  ASQYGIRSIPTLMIFKGGQKVDTVV-GAVPKATLSSTLSKHL 107


>gi|319793172|ref|YP_004154812.1| thioredoxin [Variovorax paradoxus EPS]
 gi|315595635|gb|ADU36701.1| thioredoxin [Variovorax paradoxus EPS]
          Length = 110

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 72/110 (65%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   SF+++VL+ S PV+VD+WA WC PC  ++PI+D+++     K++I KL
Sbjct: 1   MASDLIKHISDSSFEADVLKSSQPVLVDYWAEWCGPCKMIAPILDEVSATYEGKLQIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ +I  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDENRDIPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFIDQQL 109


>gi|302388656|ref|YP_003824477.1| thioredoxin [Thermosediminibacter oceani DSM 16646]
 gi|302199284|gb|ADL06854.1| thioredoxin [Thermosediminibacter oceani DSM 16646]
          Length = 104

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 43/103 (41%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L +   +F+ EVL+   PV+VDFWA WC PC  ++P+ID++A E   K+K+ KL+++
Sbjct: 1   MKPLTLTDDNFEQEVLKSDVPVLVDFWAPWCGPCRMMAPVIDELAAEYEGKIKVGKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+   +  Y + SIPTLILFKDG+  D+ + G   + +II  +
Sbjct: 61  ENPNSAAAYGVMSIPTLILFKDGQP-DKKLIGFRPKREIIAEL 102


>gi|307265225|ref|ZP_07546784.1| thioredoxin [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326390141|ref|ZP_08211702.1| thioredoxin [Thermoanaerobacter ethanolicus JW 200]
 gi|306919847|gb|EFN50062.1| thioredoxin [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325993789|gb|EGD52220.1| thioredoxin [Thermoanaerobacter ethanolicus JW 200]
          Length = 223

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 78/107 (72%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EV+    PV++DFWA WC PC  ++PIID++A E   K+K+ K++++
Sbjct: 1   MAELVITLENFEQEVVNSDVPVLIDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E +E++ +++I SIPT+ LFK+GK++D+++ GA  ++D +++I   +
Sbjct: 61  EENELAMKFRIMSIPTIGLFKNGKMVDKII-GARPKADFVKFIEKHL 106



 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 76/104 (73%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   +F+ EV+    PV++DFWA WC PC  ++PIID++A E   K+K+ K++++E +
Sbjct: 119 VEITYDNFEEEVVNSDVPVLIDFWAEWCAPCRLVAPIIDELAKEYKGKIKVGKVNVDEEN 178

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++ +++I SIPT+ LFK+GK++D+++ GA  ++D +++I   +
Sbjct: 179 ELAMQFRIMSIPTIGLFKNGKMVDKII-GARPKADFVKFIEKHL 221


>gi|121605095|ref|YP_982424.1| thioredoxin [Polaromonas naphthalenivorans CJ2]
 gi|120594064|gb|ABM37503.1| thioredoxin [Polaromonas naphthalenivorans CJ2]
          Length = 110

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+          +FD++VL+ S PV+VD+WA WC PC  ++PI+D++A     K++I K+
Sbjct: 1   MANELIKHTTDATFDADVLKSSTPVLVDYWAEWCGPCKMIAPILDEVATGYEGKLQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ EI  ++ I  IPTL+LFKDG++    + GA S+S +  +I  ++
Sbjct: 61  NVDENREIPAKFGIRGIPTLMLFKDGQLAATKV-GALSKSQLTAFIDQQL 109


>gi|227325833|ref|ZP_03829857.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 108

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF ++VL+    ++VDFWA WC PC  ++PI+D+IA+E   K+ +TKL+
Sbjct: 1   MSDKIIHLTDDSFGTKVLQADGAILVDFWAEWCGPCKMIAPILDEIAEEFDGKLTVTKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLTANL 108


>gi|329894565|ref|ZP_08270372.1| Thioredoxin [gamma proteobacterium IMCC3088]
 gi|328922973|gb|EGG30300.1| Thioredoxin [gamma proteobacterium IMCC3088]
          Length = 108

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/108 (42%), Positives = 72/108 (66%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L V   +FD+ VL+   PV+VDFWA+WC PC  ++PI+D+IA E   +++I K+D+
Sbjct: 1   MSDILHVSDAAFDTAVLKSPVPVLVDFWAAWCGPCKMIAPILDEIAPEFDGRLQIAKVDV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + + E + +Y I  IPTLI+FKDG V    + GA S++ ++E+I   +
Sbjct: 61  DANPETAPKYGIRGIPTLIIFKDGAVAGTKV-GALSKTQLVEFINETL 107


>gi|213966238|ref|ZP_03394422.1| thioredoxin [Corynebacterium amycolatum SK46]
 gi|213951090|gb|EEB62488.1| thioredoxin [Corynebacterium amycolatum SK46]
          Length = 106

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +F S+VLE   PV+VDFWA WC PC K++P++D++A EL  K  I K++++
Sbjct: 1   MAPVTVTANTFKSDVLESDKPVLVDFWAEWCGPCKKIAPVLDEVATELDGKAVIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E   ++  +QI SIP+L+LFKDGK ++  + G   + +I   I   +
Sbjct: 61  EERALAGMFQIMSIPSLLLFKDGKKVEE-IRGVRPKGEITTLIEKHL 106


>gi|319404938|emb|CBI78540.1| thioredoxin [Bartonella sp. AR 15-3]
          Length = 107

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 81/107 (75%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D+ +F+SE+L    P+VVDFWA WC PC  ++PI+D+IA E+  ++K+ K++I+
Sbjct: 1   MTCIKIDSSNFESEILTSPLPIVVDFWAEWCGPCKSIAPILDEIATEMQSQIKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++T+Y I SIPTL++FK+GKV    + GA+S+  ++EWI + +
Sbjct: 61  ENPELATQYGIRSIPTLLMFKNGKVSSNKV-GAASKGHLVEWIKNNL 106


>gi|75674250|ref|YP_316671.1| thioredoxin [Nitrobacter winogradskyi Nb-255]
 gi|74419120|gb|ABA03319.1| thioredoxin [Nitrobacter winogradskyi Nb-255]
          Length = 106

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV   +F++EVL+ + PVVVDFWA WC PC  + P++D+I+  +  KVKI KL+++
Sbjct: 1   MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEISSAMGSKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FKDG++  R + GA+ +  + +WI + V
Sbjct: 61  ESPRTASKYGVMSIPTLMIFKDGELASRQV-GAAPKQKLEQWITATV 106


>gi|53719131|ref|YP_108117.1| thioredoxin 1 [Burkholderia pseudomallei K96243]
 gi|53723575|ref|YP_103023.1| thioredoxin [Burkholderia mallei ATCC 23344]
 gi|67639667|ref|ZP_00438507.1| thioredoxin [Burkholderia mallei GB8 horse 4]
 gi|121601527|ref|YP_993172.1| thioredoxin [Burkholderia mallei SAVP1]
 gi|124384408|ref|YP_001026053.1| thioredoxin [Burkholderia mallei NCTC 10229]
 gi|126440945|ref|YP_001059243.1| thioredoxin [Burkholderia pseudomallei 668]
 gi|126449535|ref|YP_001080679.1| thioredoxin [Burkholderia mallei NCTC 10247]
 gi|126454139|ref|YP_001066510.1| thioredoxin [Burkholderia pseudomallei 1106a]
 gi|134277757|ref|ZP_01764472.1| thioredoxin [Burkholderia pseudomallei 305]
 gi|167003445|ref|ZP_02269231.1| thioredoxin [Burkholderia mallei PRL-20]
 gi|167719244|ref|ZP_02402480.1| thioredoxin 1 [Burkholderia pseudomallei DM98]
 gi|167738241|ref|ZP_02411015.1| thioredoxin 1 [Burkholderia pseudomallei 14]
 gi|167815431|ref|ZP_02447111.1| thioredoxin 1 [Burkholderia pseudomallei 91]
 gi|167823841|ref|ZP_02455312.1| thioredoxin 1 [Burkholderia pseudomallei 9]
 gi|167845382|ref|ZP_02470890.1| thioredoxin 1 [Burkholderia pseudomallei B7210]
 gi|167893925|ref|ZP_02481327.1| thioredoxin 1 [Burkholderia pseudomallei 7894]
 gi|167902377|ref|ZP_02489582.1| thioredoxin 1 [Burkholderia pseudomallei NCTC 13177]
 gi|167910617|ref|ZP_02497708.1| thioredoxin 1 [Burkholderia pseudomallei 112]
 gi|167918642|ref|ZP_02505733.1| thioredoxin 1 [Burkholderia pseudomallei BCC215]
 gi|217421391|ref|ZP_03452895.1| thioredoxin [Burkholderia pseudomallei 576]
 gi|226197085|ref|ZP_03792662.1| thioredoxin [Burkholderia pseudomallei Pakistan 9]
 gi|237812567|ref|YP_002897018.1| thioredoxin [Burkholderia pseudomallei MSHR346]
 gi|242317808|ref|ZP_04816824.1| thioredoxin [Burkholderia pseudomallei 1106b]
 gi|254177698|ref|ZP_04884353.1| thioredoxin [Burkholderia mallei ATCC 10399]
 gi|254179533|ref|ZP_04886132.1| thioredoxin [Burkholderia pseudomallei 1655]
 gi|254189075|ref|ZP_04895586.1| thioredoxin [Burkholderia pseudomallei Pasteur 52237]
 gi|254197327|ref|ZP_04903749.1| thioredoxin [Burkholderia pseudomallei S13]
 gi|254199968|ref|ZP_04906334.1| thioredoxin [Burkholderia mallei FMH]
 gi|254206301|ref|ZP_04912653.1| thioredoxin [Burkholderia mallei JHU]
 gi|254258295|ref|ZP_04949349.1| thioredoxin [Burkholderia pseudomallei 1710a]
 gi|254297412|ref|ZP_04964865.1| thioredoxin [Burkholderia pseudomallei 406e]
 gi|254358285|ref|ZP_04974558.1| thioredoxin [Burkholderia mallei 2002721280]
 gi|52209545|emb|CAH35498.1| thioredoxin 1 [Burkholderia pseudomallei K96243]
 gi|52426998|gb|AAU47591.1| thioredoxin [Burkholderia mallei ATCC 23344]
 gi|121230337|gb|ABM52855.1| thioredoxin [Burkholderia mallei SAVP1]
 gi|124292428|gb|ABN01697.1| thioredoxin [Burkholderia mallei NCTC 10229]
 gi|126220438|gb|ABN83944.1| thioredoxin [Burkholderia pseudomallei 668]
 gi|126227781|gb|ABN91321.1| thioredoxin [Burkholderia pseudomallei 1106a]
 gi|126242405|gb|ABO05498.1| thioredoxin [Burkholderia mallei NCTC 10247]
 gi|134251407|gb|EBA51486.1| thioredoxin [Burkholderia pseudomallei 305]
 gi|147749564|gb|EDK56638.1| thioredoxin [Burkholderia mallei FMH]
 gi|147753744|gb|EDK60809.1| thioredoxin [Burkholderia mallei JHU]
 gi|148027412|gb|EDK85433.1| thioredoxin [Burkholderia mallei 2002721280]
 gi|157808016|gb|EDO85186.1| thioredoxin [Burkholderia pseudomallei 406e]
 gi|157936754|gb|EDO92424.1| thioredoxin [Burkholderia pseudomallei Pasteur 52237]
 gi|160698737|gb|EDP88707.1| thioredoxin [Burkholderia mallei ATCC 10399]
 gi|169654068|gb|EDS86761.1| thioredoxin [Burkholderia pseudomallei S13]
 gi|184210073|gb|EDU07116.1| thioredoxin [Burkholderia pseudomallei 1655]
 gi|217395133|gb|EEC35151.1| thioredoxin [Burkholderia pseudomallei 576]
 gi|225930464|gb|EEH26474.1| thioredoxin [Burkholderia pseudomallei Pakistan 9]
 gi|237503934|gb|ACQ96252.1| thioredoxin [Burkholderia pseudomallei MSHR346]
 gi|238520254|gb|EEP83716.1| thioredoxin [Burkholderia mallei GB8 horse 4]
 gi|242141047|gb|EES27449.1| thioredoxin [Burkholderia pseudomallei 1106b]
 gi|243061008|gb|EES43194.1| thioredoxin [Burkholderia mallei PRL-20]
 gi|254216984|gb|EET06368.1| thioredoxin [Burkholderia pseudomallei 1710a]
          Length = 108

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV++DFWA WC PC  ++PI+D++A +  DK++I K++
Sbjct: 1   MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+     ++ +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 61  VDENQATPAKFGVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|210060966|pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060967|pdb|3DXB|B Chain B, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060968|pdb|3DXB|C Chain C, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060969|pdb|3DXB|D Chain D, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060970|pdb|3DXB|E Chain E, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060971|pdb|3DXB|F Chain F, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060972|pdb|3DXB|G Chain G, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
 gi|210060973|pdb|3DXB|H Chain H, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin
          Length = 222

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+
Sbjct: 10  MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN 69

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 70  IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 117


>gi|116784111|gb|ABK23218.1| unknown [Picea sitchensis]
 gi|116791789|gb|ABK26109.1| unknown [Picea sitchensis]
 gi|116792223|gb|ABK26280.1| unknown [Picea sitchensis]
          Length = 191

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           AL+V+  ++   VLE + PV+VDFWA WC PC  ++P+ID++A + A K+   KL+ +ES
Sbjct: 85  ALEVNDSTWQKLVLESNIPVLVDFWAPWCGPCRMIAPLIDELAKQYAGKIMCLKLNTDES 144

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T Y I SIPT+++FK+G+  D ++ GA  ++ +I  +   +
Sbjct: 145 PNIATEYGIRSIPTVMVFKNGEKKDTVI-GAVPKTTLIATVEKYL 188


>gi|282600077|ref|ZP_05972913.2| thioredoxin [Providencia rustigianii DSM 4541]
 gi|282566968|gb|EFB72503.1| thioredoxin [Providencia rustigianii DSM 4541]
          Length = 122

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF S+VL  ++PV+VDFWA+WC PC  ++PI+D++A+E   KV I KL+
Sbjct: 15  MSDKIKHITDASFASDVLNANSPVLVDFWAAWCGPCKMIAPILDEVAEEYTGKVTIAKLN 74

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + ++ I  IPTL+LFK+G V    + GA S++ + E++   +
Sbjct: 75  IDDNPATAPKFGIRGIPTLLLFKNGSVAATKV-GALSKTQLKEFLDENL 122


>gi|254515492|ref|ZP_05127552.1| thioredoxin [gamma proteobacterium NOR5-3]
 gi|219675214|gb|EED31580.1| thioredoxin [gamma proteobacterium NOR5-3]
          Length = 109

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   SF+ +VL    PV+VDFWA WC PC  ++P++D+IA E A K+K+ K+D++ 
Sbjct: 4   AIVHVSDASFEKDVLGSDLPVLVDFWAEWCGPCKMIAPVLDEIAGEYAGKLKVCKVDVDA 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E+  ++ I  IPTLILFKDG      + GA S++ ++E++   +
Sbjct: 64  NPEVPGKFGIRGIPTLILFKDGNAEATKV-GALSKTQLVEFVNESI 108


>gi|33240589|ref|NP_875531.1| thioredoxin family protein [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
 gi|33238117|gb|AAQ00184.1| Thioredoxin family protein [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 107

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ EVL+   PV+VDFWA WC PC  +SPI+D+I+ +   K+K+ KL+ +E+  +
Sbjct: 7   VTDSSFEQEVLQSDLPVLVDFWAPWCGPCRMVSPIVDEISKDFEGKIKVCKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMIFKGGQKVDTVV-GAVPKATLSGTISKHL 107


>gi|160872103|ref|ZP_02062235.1| thioredoxin [Rickettsiella grylli]
 gi|159120902|gb|EDP46240.1| thioredoxin [Rickettsiella grylli]
          Length = 117

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLE-CSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           S + ++  SF+SEVL+  + P++VDFWA WC PC  +SPI+D ++++   K+KI KL+++
Sbjct: 5   SIVTLNDASFESEVLQFNATPILVDFWAEWCGPCKAISPILDKLSEKYRGKIKIGKLNVD 64

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +   +Y +  IPTLILFKDGK ++  + GA  +S +  ++   +
Sbjct: 65  ENPKTPAKYGVRGIPTLILFKDGKAVETKV-GALLESQLESFLEKHL 110


>gi|86605476|ref|YP_474239.1| thioredoxin [Synechococcus sp. JA-3-3Ab]
 gi|86554018|gb|ABC98976.1| thioredoxin [Synechococcus sp. JA-3-3Ab]
          Length = 113

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A+ V   +F++EVL    PV+VDFWA WC PC  ++P++ +IA++ A KVK+ K++ +E
Sbjct: 3   AAIDVADATFEAEVLRSDIPVLVDFWAPWCGPCRMVAPVVQEIAEQYAGKVKVVKINTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           + + +++Y I SIPTL+LFK G+ +D ++ GA  ++ +   +   
Sbjct: 63  NPQTASQYGIRSIPTLMLFKGGQKVD-VVVGAVPKATLTTILEKH 106


>gi|94311072|ref|YP_584282.1| thioredoxin [Cupriavidus metallidurans CH34]
 gi|93354924|gb|ABF09013.1| thioredoxin 1 [Cupriavidus metallidurans CH34]
          Length = 108

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SFD++VL+   PV++DFWA WC PC  ++PI+D++A +  DKV++ K++
Sbjct: 1   MSEQIKYVSDASFDADVLKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKVQVAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+ ++  ++ I  IPTLILFK+G+V  + + GA S+S +  ++ S++
Sbjct: 61  VDENQQVPAKFGIRGIPTLILFKNGQVAAQKV-GALSKSQLTAFLDSQL 108


>gi|186685639|ref|YP_001868835.1| thioredoxin [Nostoc punctiforme PCC 73102]
 gi|186468091|gb|ACC83892.1| thioredoxin [Nostoc punctiforme PCC 73102]
          Length = 107

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 73/108 (67%), Gaps = 2/108 (1%)

Query: 1   MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS   +V   SF  EVL+   PV+VDFWA WC PC  ++P++D+I+++   ++K+ K++ 
Sbjct: 1   MSTAAQVTDSSFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEISEQYKGQIKVVKVNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ +++++Y I SIPTL++FKDG+ +D M+ GA  +S +   +   +
Sbjct: 61  DENPQVASQYGIRSIPTLMIFKDGQKVD-MVVGAVPKSTLASTLEKYL 107


>gi|50123132|ref|YP_052299.1| thioredoxin [Pectobacterium atrosepticum SCRI1043]
 gi|49613658|emb|CAG77109.1| thioredoxin [Pectobacterium atrosepticum SCRI1043]
          Length = 108

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF ++VL+     +VDFWA WC PC  ++PI+D+IA+E   K+ +TKL+
Sbjct: 1   MSDKIIHLTDDSFGTKVLQAEGATLVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLTANL 108


>gi|89073868|ref|ZP_01160375.1| putative thioredoxin [Photobacterium sp. SKA34]
 gi|90581475|ref|ZP_01237269.1| putative thioredoxin [Vibrio angustum S14]
 gi|89050403|gb|EAR55904.1| putative thioredoxin [Photobacterium sp. SKA34]
 gi|90437336|gb|EAS62533.1| putative thioredoxin [Vibrio angustum S14]
          Length = 108

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SFD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKIVQLTDASFDTDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++E   ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAETPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|257437964|ref|ZP_05613719.1| thioredoxin [Faecalibacterium prausnitzii A2-165]
 gi|257199624|gb|EEU97908.1| thioredoxin [Faecalibacterium prausnitzii A2-165]
          Length = 130

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 77/103 (74%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F++EVL  + PV++DFWA+WC PC  LSPI+D++A+E    VK+ K++++
Sbjct: 6   MAVVTITKENFEAEVLHSTKPVLLDFWATWCGPCRMLSPIVDEVAEE-RTDVKVGKVNVD 64

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E+++++ + SIPTL++F+DGK++++ + GA  ++ ++  +
Sbjct: 65  EQPELASQFGVMSIPTLLVFRDGKLVNQAV-GARPKAGVLALL 106


>gi|110835323|ref|YP_694182.1| thioredoxin [Alcanivorax borkumensis SK2]
 gi|110648434|emb|CAL17910.1| thioredoxin [Alcanivorax borkumensis SK2]
          Length = 108

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V    F+++V+    PV+VD+WA WC PC  ++PI++ +A E  DK+ I K++
Sbjct: 1   MSGEIINVTDADFEAKVINADGPVLVDYWAPWCGPCKMVAPILEQLAGEYGDKLTIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ E   +Y +  IPTL +FK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDDNPETPKKYGVRGIPTLTVFKNGNVEATKV-GALSKSQLTAFLDSTL 108


>gi|157833946|pdb|1THO|A Chain A, Crystal Structure Of A Mutant Escherichia Coli Thioredoxin
           With An Arginine Insertion In The Active Site
          Length = 109

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 69/106 (65%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCR-PCVKLSPIIDDIADELADKVKITKLDIEE 61
            + +   SFD++VL+    ++VDFWA WC  PC  ++PI+D+IADE   K+ + KL+I++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGRPCKMIAPILDEIADEYQGKLTVAKLNIDQ 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  NPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 108


>gi|91788134|ref|YP_549086.1| thioredoxin [Polaromonas sp. JS666]
 gi|91697359|gb|ABE44188.1| thioredoxin [Polaromonas sp. JS666]
          Length = 110

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+          +F+++VL+ S PV+VD+WA WC PC  ++PI+D++A     K++I K+
Sbjct: 1   MASELIKHTTDATFEADVLKSSTPVLVDYWAEWCGPCKMIAPILDEVATGYDGKLQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ +I  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDENRDIPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTAFIDQQL 109


>gi|218885506|ref|YP_002434827.1| thioredoxin [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756460|gb|ACL07359.1| thioredoxin [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 107

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 72/106 (67%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  ++   +F++ VL+ S PV++DFWA WC PC  + P+ID++A E   KV I K++++
Sbjct: 1   MAV-QITDANFEANVLKSSIPVLIDFWAPWCGPCRAMGPVIDELAAEYDGKVLIAKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+    ++Y I +IPTLILFK G+V+++ + GA S+S I + I  +
Sbjct: 60  ENPATPSKYGIRAIPTLILFKGGEVVEQ-ITGAVSKSSIKDMIAQK 104


>gi|239993249|ref|ZP_04713773.1| thioredoxin [Alteromonas macleodii ATCC 27126]
 gi|332139979|ref|YP_004425717.1| thioredoxin [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550001|gb|AEA96719.1| thioredoxin [Alteromonas macleodii str. 'Deep ecotype']
          Length = 108

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++    F+++V+    PV+VDFWA WC PC  ++PI++++A E   K+ + KL+
Sbjct: 1   MSDKIIQLSDDKFEADVINAEGPVLVDFWAEWCGPCKMIAPILEEVATEFDGKLTVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E++E   +Y I  IPTL+LFK+G V    + GA S++ + E++   +
Sbjct: 61  VDENNETPPKYGIRGIPTLLLFKNGNVAATKV-GALSKAQLTEFLNENL 108


>gi|225847955|ref|YP_002728118.1| thioredoxin [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643086|gb|ACN98136.1| thioredoxin [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 105

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + V+  +F+ EVL    PV+VDFWA WC PC  ++PI+++IA+E+  + K+ K++
Sbjct: 1   MAGKVISVNESNFEQEVLNSDVPVLVDFWAPWCGPCRLIAPIVEEIAEEMEGRAKVVKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +E+  ++ +Y I +IPT+++FK+G+V+D  + G   +  +   +
Sbjct: 61  TDENPNLAMKYGIRAIPTIMVFKNGRVVDTRV-GVQPKEVLKALL 104


>gi|87121329|ref|ZP_01077219.1| thioredoxin [Marinomonas sp. MED121]
 gi|86163486|gb|EAQ64761.1| thioredoxin [Marinomonas sp. MED121]
          Length = 108

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++    F  EVL    PVVVDFWA WC PC  + P+++D+A E+  K+K+ K++++E+
Sbjct: 5   TIQITDAQFQEEVLNSEVPVVVDFWAPWCGPCKMIGPVLEDVAGEMEGKIKVVKINVDEN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + + +Y +  IPTL++ K G+V+   + GA S+S ++++I + +
Sbjct: 65  PDTAPKYNVRGIPTLLVVKGGEVVATKV-GAVSKSQLVDFIDTSI 108


>gi|227114352|ref|ZP_03828008.1| thioredoxin [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
 gi|253690373|ref|YP_003019563.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756951|gb|ACT15027.1| thioredoxin [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 108

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF ++VL+    ++VDFWA WC PC  ++PI+D+IA+E   K+ +TKL+
Sbjct: 1   MSDKIIHLTDDSFGTKVLQAEGAILVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 61  IDENPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLTANL 108


>gi|119946797|ref|YP_944477.1| thioredoxin [Psychromonas ingrahamii 37]
 gi|119865401|gb|ABM04878.1| thioredoxin [Psychromonas ingrahamii 37]
          Length = 108

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+ +V+    PV+VDFWA WC PC  ++PI+ ++A E A KV I KL+
Sbjct: 1   MSENIVTLSDASFEDDVVNAEGPVLVDFWAEWCGPCKMIAPILQEVAAEYAGKVTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+S    ++ I  IPTL+LFKDGKV    + GA S++ ++E++ + +
Sbjct: 61  IDENSATPPKFGIRGIPTLLLFKDGKVAATKV-GALSKTQLVEFLDANI 108


>gi|120553412|ref|YP_957763.1| thioredoxin [Marinobacter aquaeolei VT8]
 gi|120323261|gb|ABM17576.1| thioredoxin [Marinobacter aquaeolei VT8]
          Length = 108

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+ +VL+   PV+VD+WA WC PC  ++P++++IADE   K+K+ KL+
Sbjct: 1   MSGNIVNVTDASFEQDVLKSDVPVLVDYWAEWCGPCKMIAPVLEEIADEYDGKLKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   ++ I  IPTL+LFK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDENEQTPPKFNIRGIPTLMLFKNGNVDATKV-GALSKSQLAAFLDSNL 108


>gi|260220995|emb|CBA29118.1| Thioredoxin [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 110

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 72/110 (65%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      V   +F+++VL+ + P++VD+WA WC PC  ++PI+D+++     K++I K+
Sbjct: 1   MASELIKHVTDATFEADVLQSAQPILVDYWAEWCGPCKMIAPILDEVSATYEGKLQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ +I  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDENRDIPAKFGIRGIPTLMLFKDGQLAATKV-GALSKAQLTAFIDQQL 109


>gi|254429452|ref|ZP_05043159.1| thioredoxin [Alcanivorax sp. DG881]
 gi|196195621|gb|EDX90580.1| thioredoxin [Alcanivorax sp. DG881]
          Length = 108

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V    F+++V+    PV+VD+WA WC PC  ++PI++ +  E  DK+ I K++
Sbjct: 1   MSGEIINVTDADFEAQVINADGPVLVDYWAPWCGPCKMVAPILEQLVGEYGDKLTIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ E   +Y +  IPTL +FK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDDNPETPKKYGVRGIPTLTVFKNGNVEATKV-GALSKSQLTAFLDSTL 108


>gi|296283900|ref|ZP_06861898.1| thiol-disulfide isomerase [Citromicrobium bathyomarinum JL354]
          Length = 106

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF S+VL+   PV+VDFWA WC PC  ++P +++I+DELAD+V I K+DI 
Sbjct: 1   MATKTVTDASFQSDVLQSDKPVLVDFWAEWCGPCKMIAPALEEISDELADQVTIAKMDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+++   +  +  IP L+L+K+G+    +  GA  +S +  W+  ++
Sbjct: 61  ENTDTPGKLGVQGIPYLVLYKNGERAAEL-TGARPKSQLKAWLEEQL 106


>gi|296444511|ref|ZP_06886476.1| thioredoxin [Methylosinus trichosporium OB3b]
 gi|296258158|gb|EFH05220.1| thioredoxin [Methylosinus trichosporium OB3b]
          Length = 110

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 74/108 (68%), Gaps = 2/108 (1%)

Query: 1   MSA-LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  +KV   SF++EVL+   PVVVDFWA WC PC  ++P +++IA EL DK+K+ KL++
Sbjct: 1   MSTAIKVSDASFEAEVLKSDQPVVVDFWAEWCGPCRTIAPALEEIAIELKDKLKVVKLNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+  ++    I SIPTLI+FKDGK   + + GA+ + +++ WI   +
Sbjct: 61  DENPNVAGALGIRSIPTLIVFKDGKAAAQKV-GAAPKGELLRWINGAI 107


>gi|85714147|ref|ZP_01045136.1| thioredoxin [Nitrobacter sp. Nb-311A]
 gi|85699273|gb|EAQ37141.1| thioredoxin [Nitrobacter sp. Nb-311A]
          Length = 106

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV   +F++EVL+ + PVVVDFWA WC PC  + P++D+I+  +  KVKI KL+++
Sbjct: 1   MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEISSAMGSKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ESPRTASKYGVMSIPTLMIFKGGELASRQV-GAAPKQKLEQWITATV 106


>gi|254471037|ref|ZP_05084440.1| thioredoxin [Pseudovibrio sp. JE062]
 gi|211960179|gb|EEA95376.1| thioredoxin [Pseudovibrio sp. JE062]
          Length = 106

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V+  +F++EVL+ S PV+VDFWA+WC PC  ++P +++I++E+A +VKI KLDI+
Sbjct: 1   MATVNVEDGNFEAEVLQSSTPVLVDFWATWCGPCKMIAPSLEEISEEMAGQVKIAKLDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            + + +  Y + SIPT+ILFKDG+    ++ GA  +  I +WI  
Sbjct: 61  SNQQSAMNYGVRSIPTMILFKDGQPAATLV-GAQPKGKIADWIKQ 104


>gi|149376212|ref|ZP_01893976.1| thioredoxin [Marinobacter algicola DG893]
 gi|149359409|gb|EDM47869.1| thioredoxin [Marinobacter algicola DG893]
          Length = 108

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+ +VL+   PV+VD+WA WC PC  ++P+++++A+E   K+K+ KL+
Sbjct: 1   MSGNIVNVTDASFEQDVLQSDVPVLVDYWAEWCGPCKMIAPVLEEMAEEYEGKLKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   ++ I  IPTL+LFK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDENEQTPPKFNIRGIPTLMLFKNGNVDATKV-GALSKSQLAAFLDSNL 108


>gi|113461487|ref|YP_719556.1| thioredoxin [Haemophilus somnus 129PT]
 gi|170718407|ref|YP_001783629.1| thioredoxin [Haemophilus somnus 2336]
 gi|112823530|gb|ABI25619.1| thioredoxin [Haemophilus somnus 129PT]
 gi|168826536|gb|ACA31907.1| thioredoxin [Haemophilus somnus 2336]
          Length = 107

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L     +FD++VL+   PV++DFWA WC PC  + PI+++++ EL DKVKI K++I
Sbjct: 1   MSEVLHTTDATFDTDVLKSDIPVLLDFWAPWCGPCRMIGPILEELSAELGDKVKIVKINI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +E+     ++ + SIPTLI FK+GK +   + GA  ++ ++ +I   
Sbjct: 61  DENQATPAQFGVRSIPTLIFFKEGKAVATQV-GALPKNQLVNFINQN 106


>gi|78779455|ref|YP_397567.1| thioredoxin [Prochlorococcus marinus str. MIT 9312]
 gi|123968699|ref|YP_001009557.1| thioredoxin [Prochlorococcus marinus str. AS9601]
 gi|126696505|ref|YP_001091391.1| thioredoxin [Prochlorococcus marinus str. MIT 9301]
 gi|78712954|gb|ABB50131.1| thioredoxin [Prochlorococcus marinus str. MIT 9312]
 gi|123198809|gb|ABM70450.1| Thioredoxin [Prochlorococcus marinus str. AS9601]
 gi|126543548|gb|ABO17790.1| Thioredoxin [Prochlorococcus marinus str. MIT 9301]
          Length = 107

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SFD +VL+   PV+VDFWA WC PC  ++P++++I+ +   K+K+ KL+ +E+  +
Sbjct: 7   VTDSSFDKDVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   +   +
Sbjct: 67  ASQYGIRSIPTLMIFKGGQKVDTVV-GAVPKATLSSTLTKHL 107


>gi|282897039|ref|ZP_06305041.1| Thioredoxin [Raphidiopsis brookii D9]
 gi|281197691|gb|EFA72585.1| Thioredoxin [Raphidiopsis brookii D9]
          Length = 111

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +AL+V   SF  EV++   PV+VDFWA WC PC  ++P++D+IA +   ++K+ K++ +E
Sbjct: 3   AALQVTDASFKQEVIDSDIPVLVDFWAPWCGPCRMVAPVVDEIATQYEGQLKVVKMNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +++++Y I SIPTL++FK G+ +D M+ GA  +S + + +   +
Sbjct: 63  NPDVASKYGIRSIPTLMIFKGGQKVD-MVVGAVPKSTLSDTVKKYI 107


>gi|167562527|ref|ZP_02355443.1| thioredoxin 1 [Burkholderia oklahomensis EO147]
 gi|167569713|ref|ZP_02362587.1| thioredoxin 1 [Burkholderia oklahomensis C6786]
 gi|167581685|ref|ZP_02374559.1| thioredoxin 1 [Burkholderia thailandensis TXDOH]
 gi|167619802|ref|ZP_02388433.1| thioredoxin 1 [Burkholderia thailandensis Bt4]
 gi|257138951|ref|ZP_05587213.1| thioredoxin [Burkholderia thailandensis E264]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV++DFWA WC PC  ++PI+D++A +  DK++I K++
Sbjct: 1   MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++     ++ +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 61  VDDNQATPAKFGVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|226326725|ref|ZP_03802243.1| hypothetical protein PROPEN_00583 [Proteus penneri ATCC 35198]
 gi|225204946|gb|EEG87300.1| hypothetical protein PROPEN_00583 [Proteus penneri ATCC 35198]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L +    FD++VL  + PV+VDFWA WC PC  ++PI+D++A E A K+ + KL+
Sbjct: 1   MSDKILHLSDSKFDADVLNATGPVLVDFWAEWCGPCKMIAPILDEVATEYAGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTLILFK+G V    + GA S++ + E++   +
Sbjct: 61  IDQNPLTAPKYGIRGIPTLILFKNGAVAATKV-GALSKTQLKEFLDENI 108


>gi|167037452|ref|YP_001665030.1| thioredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040114|ref|YP_001663099.1| thioredoxin [Thermoanaerobacter sp. X514]
 gi|256752941|ref|ZP_05493770.1| thioredoxin [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914199|ref|ZP_07131515.1| thioredoxin [Thermoanaerobacter sp. X561]
 gi|307724566|ref|YP_003904317.1| thioredoxin [Thermoanaerobacter sp. X513]
 gi|320115866|ref|YP_004186025.1| thioredoxin [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166854354|gb|ABY92763.1| thioredoxin [Thermoanaerobacter sp. X514]
 gi|166856286|gb|ABY94694.1| thioredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256748174|gb|EEU61249.1| thioredoxin [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889134|gb|EFK84280.1| thioredoxin [Thermoanaerobacter sp. X561]
 gi|307581627|gb|ADN55026.1| thioredoxin [Thermoanaerobacter sp. X513]
 gi|319928957|gb|ADV79642.1| thioredoxin [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 223

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EV+    PV++DFWA WC PC  ++PIID++A E   K+K+ K++++
Sbjct: 1   MAELVITLENFEQEVVNSDVPVLIDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E +E++ +++I SIPT+ LFK+GK++D+++ GA  ++D + +I   +
Sbjct: 61  EENELAMKFRIMSIPTIGLFKNGKMVDKII-GARPKADFVRFIEKHL 106



 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 76/104 (73%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   +F+ EV+    PV++DFWA WC PC  ++PIID++A E   K+K+ K++++E +
Sbjct: 119 VEITYDNFEEEVVNSDVPVLIDFWAEWCAPCRLVAPIIDELAKEYKGKIKVGKVNVDEEN 178

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++ +++I SIPT+ LFK+GK++D+++ GA  ++D +++I   +
Sbjct: 179 ELAMQFRIMSIPTIGLFKNGKMVDKII-GARPKADFVKFIEKHL 221


>gi|78066598|ref|YP_369367.1| thioredoxin [Burkholderia sp. 383]
 gi|107028993|ref|YP_626088.1| thioredoxin [Burkholderia cenocepacia AU 1054]
 gi|115351817|ref|YP_773656.1| thioredoxin [Burkholderia ambifaria AMMD]
 gi|116689849|ref|YP_835472.1| thioredoxin [Burkholderia cenocepacia HI2424]
 gi|134295859|ref|YP_001119594.1| thioredoxin [Burkholderia vietnamiensis G4]
 gi|161524618|ref|YP_001579630.1| thioredoxin [Burkholderia multivorans ATCC 17616]
 gi|167587029|ref|ZP_02379417.1| thioredoxin 1 [Burkholderia ubonensis Bu]
 gi|170701508|ref|ZP_02892461.1| thioredoxin [Burkholderia ambifaria IOP40-10]
 gi|170733188|ref|YP_001765135.1| thioredoxin [Burkholderia cenocepacia MC0-3]
 gi|172060788|ref|YP_001808440.1| thioredoxin [Burkholderia ambifaria MC40-6]
 gi|189350626|ref|YP_001946254.1| thioredoxin 1 [Burkholderia multivorans ATCC 17616]
 gi|206560263|ref|YP_002231027.1| thioredoxin [Burkholderia cenocepacia J2315]
 gi|221198098|ref|ZP_03571144.1| thioredoxin [Burkholderia multivorans CGD2M]
 gi|221208411|ref|ZP_03581414.1| thioredoxin [Burkholderia multivorans CGD2]
 gi|221215163|ref|ZP_03588130.1| thioredoxin [Burkholderia multivorans CGD1]
 gi|254248056|ref|ZP_04941377.1| Thioredoxin [Burkholderia cenocepacia PC184]
 gi|77967343|gb|ABB08723.1| Thioredoxin [Burkholderia sp. 383]
 gi|105898157|gb|ABF81115.1| thioredoxin [Burkholderia cenocepacia AU 1054]
 gi|115281805|gb|ABI87322.1| thioredoxin [Burkholderia ambifaria AMMD]
 gi|116647938|gb|ABK08579.1| thioredoxin [Burkholderia cenocepacia HI2424]
 gi|124872832|gb|EAY64548.1| Thioredoxin [Burkholderia cenocepacia PC184]
 gi|134139016|gb|ABO54759.1| thioredoxin [Burkholderia vietnamiensis G4]
 gi|160342047|gb|ABX15133.1| thioredoxin [Burkholderia multivorans ATCC 17616]
 gi|169816430|gb|ACA91013.1| thioredoxin [Burkholderia cenocepacia MC0-3]
 gi|170133596|gb|EDT01971.1| thioredoxin [Burkholderia ambifaria IOP40-10]
 gi|171993305|gb|ACB64224.1| thioredoxin [Burkholderia ambifaria MC40-6]
 gi|189334648|dbj|BAG43718.1| thioredoxin 1 [Burkholderia multivorans ATCC 17616]
 gi|198036304|emb|CAR52200.1| thioredoxin [Burkholderia cenocepacia J2315]
 gi|221165099|gb|EED97578.1| thioredoxin [Burkholderia multivorans CGD1]
 gi|221171824|gb|EEE04268.1| thioredoxin [Burkholderia multivorans CGD2]
 gi|221182030|gb|EEE14431.1| thioredoxin [Burkholderia multivorans CGD2M]
 gi|325522359|gb|EGD00961.1| thioredoxin [Burkholderia sp. TJI49]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV+VDFWA WC PC  ++PI+D++A +  DK++I K++
Sbjct: 1   MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++     ++ +  IPTLILFK+G    + + GA S+S +  ++ S +
Sbjct: 61  VDDNQATPAKFGVRGIPTLILFKNGAAAAQKV-GALSKSQLTAFLDSHL 108


>gi|6137567|pdb|1TXX|A Chain A, Active-Site Variant Of E.Coli Thioredoxin
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC  C  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y I  IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|118594398|ref|ZP_01551745.1| Thioredoxin [Methylophilales bacterium HTCC2181]
 gi|118440176|gb|EAV46803.1| Thioredoxin [Methylophilales bacterium HTCC2181]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + +  ++F   VLE + PV+VD+WA WC PC  ++PI++ +  E   K+ I K +I++
Sbjct: 4   SIIHLTDETFQKTVLESNIPVLVDYWAEWCGPCKMIAPILESLVSEYEGKLIIAKHNIDD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +   +Y +  IPTL++FKDG +    + GA S+S +  +I S +
Sbjct: 64  NPQTPAKYGVRGIPTLMIFKDGNIEATKV-GALSKSQLAAFIDSTI 108


>gi|41410438|ref|NP_963274.1| TrxC [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|15808974|gb|AAL08576.1|AF418548_2 thioredoxin [Mycobacterium avium subsp. paratuberculosis]
 gi|41399272|gb|AAS06890.1| TrxC [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 117

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E  D + + KLD++ 
Sbjct: 9   ATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++  +   V
Sbjct: 69  NPETAQNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLRELSDAV 113


>gi|268315755|ref|YP_003289474.1| thioredoxin [Rhodothermus marinus DSM 4252]
 gi|262333289|gb|ACY47086.1| thioredoxin [Rhodothermus marinus DSM 4252]
          Length = 115

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +   +F+ EVL+   PV+VDFWA WC PC  ++PII+++A E   + K+ KLD++ + 
Sbjct: 8   VTLTDDNFEQEVLQSDVPVLVDFWAVWCGPCRMIAPIIEELAAEYEGRAKVGKLDVDHNP 67

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             + +Y I SIPTL+ FK+G+V+D+++ GA  +  ++E + + V
Sbjct: 68  RTAMQYGIRSIPTLLFFKNGQVVDQLI-GAVPKKVLVEKLEALV 110


>gi|323704143|ref|ZP_08115722.1| thioredoxin [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536209|gb|EGB25981.1| thioredoxin [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 106

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+   +F  EV+  + PV+VDFWA WC PC  +SPII+++A++   KVK+ K++++
Sbjct: 1   MAEVKITKDNFQEEVVNSNIPVLVDFWAEWCGPCRMVSPIIEELAEDYEGKVKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E +E++ +++I SIPT+ LFK GK++D+++ GA  +SD  ++I   +
Sbjct: 61  EENELAMQFRIMSIPTIGLFKGGKMVDKII-GARPKSDFEDFINRNL 106


>gi|171463385|ref|YP_001797498.1| thioredoxin [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171192923|gb|ACB43884.1| thioredoxin [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ +VL+   PV++DFWA WC PC  + PI++++A E  DK++I K++
Sbjct: 1   MSAGIKYVTDASFEQDVLKSDKPVLLDFWAEWCGPCKMIGPILEELAGEYGDKLQIAKMN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+  +  +  I  IPTLILFK+G V  + + GA ++S +  +I S +
Sbjct: 61  VDENQGVPAQLNIRGIPTLILFKNGTVAAQKV-GALAKSQLTAFIDSHL 108


>gi|158422339|ref|YP_001523631.1| thioredoxin [Azorhizobium caulinodans ORS 571]
 gi|158329228|dbj|BAF86713.1| thioredoxin [Azorhizobium caulinodans ORS 571]
          Length = 106

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/103 (49%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV  +SFD++VL+ S PVVVDFWA WC PC  ++P++D+++ EL DKVKI KL+++
Sbjct: 1   MAVEKVSDQSFDADVLQSSTPVVVDFWAEWCGPCRMVAPVLDELSGELGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+   +++Y I SIPTL+LFKDGK+  R + GA++++ +  WI
Sbjct: 61  ENPVTASKYGIMSIPTLLLFKDGKIASRQV-GAAAKAKLASWI 102


>gi|16272058|ref|NP_438257.1| thioredoxin [Haemophilus influenzae Rd KW20]
 gi|260580612|ref|ZP_05848439.1| thioredoxin [Haemophilus influenzae RdAW]
 gi|1174685|sp|P43785|THIO_HAEIN RecName: Full=Thioredoxin; Short=Trx
 gi|1573030|gb|AAC21757.1| thioredoxin (trxM) [Haemophilus influenzae Rd KW20]
 gi|260092674|gb|EEW76610.1| thioredoxin [Haemophilus influenzae RdAW]
          Length = 107

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+    P+++DFWA WC PC  ++P++D++A E A KVKI K+++
Sbjct: 1   MSEVLHINDADFESVVVNSDIPILLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA  ++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALPKTQLANFINQHI 107


>gi|86607693|ref|YP_476455.1| thioredoxin [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556235|gb|ABD01192.1| thioredoxin [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 113

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A+ +   +F++EVL    PV+VDFWA WC PC  ++P++ +IA++   KVK+ K++ +E
Sbjct: 3   AAIDIADATFEAEVLRSDIPVLVDFWAPWCGPCRMVAPVVQEIAEQYVGKVKVVKINTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           + + +++Y I SIPTL+LFK G+ +D ++ GA  ++ +   +   
Sbjct: 63  NPQTASQYGIRSIPTLMLFKGGQKVD-VVVGAVPKATLTTILEKH 106


>gi|15602859|ref|NP_245931.1| TrxM [Pasteurella multocida subsp. multocida str. Pm70]
 gi|20140774|sp|Q9CM49|THIO_PASMU RecName: Full=Thioredoxin; Short=Trx
 gi|12721321|gb|AAK03078.1| TrxM [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 106

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L     +F ++V+    PV++DFWA WC PC  +SPI+D+IA E + KVK+ K++I+
Sbjct: 1   MEVLHSTDATFTADVVNSDVPVLLDFWAPWCGPCRMISPILDEIAAEFSGKVKVVKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  + SIPTL+LFK+GK +   + GA  ++ +  +I   +
Sbjct: 61  ENQATPAQLGVRSIPTLVLFKNGKAVATQV-GALPKNQLANFINQNI 106


>gi|320540199|ref|ZP_08039854.1| thioredoxin 1 [Serratia symbiotica str. Tucson]
 gi|320029865|gb|EFW11889.1| thioredoxin 1 [Serratia symbiotica str. Tucson]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFDS VL+    ++VDFWA WC PC  ++PI+D+IA+E A K+ ITKL+
Sbjct: 1   MSDKIIHLTDNSFDSNVLKAEGSILVDFWAEWCAPCKMIAPILDEIAEEFAGKLTITKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + +++ + +
Sbjct: 61  IDQNPATAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKDFLNANL 108


>gi|157413531|ref|YP_001484397.1| thioredoxin [Prochlorococcus marinus str. MIT 9215]
 gi|254526803|ref|ZP_05138855.1| thioredoxin [Prochlorococcus marinus str. MIT 9202]
 gi|157388106|gb|ABV50811.1| Thioredoxin [Prochlorococcus marinus str. MIT 9215]
 gi|221538227|gb|EEE40680.1| thioredoxin [Prochlorococcus marinus str. MIT 9202]
          Length = 107

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SFD +VL+   PV+VDFWA WC PC  ++P++++I+ +   K+K+ KL+ +E+  +
Sbjct: 7   VTDSSFDKDVLQSDLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   +   +
Sbjct: 67  ASQYGIRSIPTLMIFKGGQKVDTVV-GAVPKATLSSTLSKHL 107


>gi|327479207|gb|AEA82517.1| thioredoxin [Pseudomonas stutzeri DSM 4166]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ +VL+   PV+VD+WA WC PC  ++P++D+IA +   ++K+ KL+
Sbjct: 1   MSDYINNVSDSSFEQDVLQADGPVLVDYWAEWCGPCKMIAPVLDEIAKDYEGRLKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ E   +Y +  IPTL+LFK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDENQETPPKYGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDSNI 108


>gi|92115691|ref|YP_575420.1| thioredoxin [Nitrobacter hamburgensis X14]
 gi|91798585|gb|ABE60960.1| thioredoxin [Nitrobacter hamburgensis X14]
          Length = 106

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV   +F++EVL+ + PVVVDFWA WC PC  + P++D+I+  + DKVKI KL+++
Sbjct: 1   MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEISGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ESPRTASKYGVMSIPTLMIFKGGELASRQV-GAAPKQKLEQWITATV 106


>gi|330991807|ref|ZP_08315756.1| Thioredoxin-1 [Gluconacetobacter sp. SXCC-1]
 gi|329760828|gb|EGG77323.1| Thioredoxin-1 [Gluconacetobacter sp. SXCC-1]
          Length = 139

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V    F S VL+   PV+VDFWA WC PC  ++P +D+I  E   ++ + K++
Sbjct: 31  MSENTIAVSDDQFKSLVLDSKEPVLVDFWAEWCGPCKMIAPALDEIGAEFKGRMTVAKVN 90

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++      Y + SIPTLILF+DGK + +   GA  +S +  W+ + +
Sbjct: 91  IDDNLRAPNEYAVQSIPTLILFRDGKPVAK-QSGAVPKSQLKAWVQANL 138


>gi|187928125|ref|YP_001898612.1| thioredoxin [Ralstonia pickettii 12J]
 gi|241662728|ref|YP_002981088.1| thioredoxin [Ralstonia pickettii 12D]
 gi|309782349|ref|ZP_07677075.1| thioredoxin [Ralstonia sp. 5_7_47FAA]
 gi|187725015|gb|ACD26180.1| thioredoxin [Ralstonia pickettii 12J]
 gi|240864755|gb|ACS62416.1| thioredoxin [Ralstonia pickettii 12D]
 gi|308918885|gb|EFP64556.1| thioredoxin [Ralstonia sp. 5_7_47FAA]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+++VL+   PV+VDFWA WC PC  ++PI+D+++ +  +KV+I K++
Sbjct: 1   MSEQIKYVSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGEKVQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+  +  ++ I  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 61  VDENQGVPAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|226946749|ref|YP_002801822.1| Thioredoxin 1, trx1 [Azotobacter vinelandii DJ]
 gi|226721676|gb|ACO80847.1| Thioredoxin 1, trx1 [Azotobacter vinelandii DJ]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ +VL+   PV+VD+WA WC PC  ++P++++IA +   ++KI KL+
Sbjct: 1   MSELITNVSDASFEQDVLQAEGPVLVDYWAEWCGPCKMIAPVLNEIAKDYEGRLKICKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+     +Y +  IPTL+LFK G V    + GA S+S +  ++ S +
Sbjct: 61  IDENQGTPAKYGVRGIPTLMLFKGGNVEATKV-GALSKSQLAAFLDSNI 108


>gi|88812098|ref|ZP_01127350.1| thioredoxin [Nitrococcus mobilis Nb-231]
 gi|88790602|gb|EAR21717.1| thioredoxin [Nitrococcus mobilis Nb-231]
          Length = 107

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + L++  ++F +EVL+   PV++D+WA WC PC  + PII+ +A+E A + K+ KL++++
Sbjct: 3   AVLELTDQNFHAEVLQSDRPVLIDYWAEWCAPCKAIGPIIEALAEEYAGRAKVGKLNVDD 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +   RY + SIPTL+LFKDG++    + GA S++++ + I + +
Sbjct: 63  NPDTPMRYGVRSIPTLMLFKDGEIQALKI-GADSKAELAQLIEAHL 107


>gi|153873432|ref|ZP_02002017.1| thioredoxin [Beggiatoa sp. PS]
 gi|152070103|gb|EDN67984.1| thioredoxin [Beggiatoa sp. PS]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   +FD EVL+ + PV+VD+WA WC PC  ++PI++ IA +   ++KI KL+
Sbjct: 1   MSEHITYVTDDTFDEEVLKSAIPVLVDYWAEWCGPCKMIAPILEGIAPDYVGRLKIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+     +Y I  IPTLILFKDG+V++  + GA S+S +  +I S +
Sbjct: 61  IDENPNTPPKYGIRGIPTLILFKDGEVLNTKI-GALSKSQLTAFIDSNL 108


>gi|150398433|ref|YP_001328900.1| thioredoxin [Sinorhizobium medicae WSM419]
 gi|150029948|gb|ABR62065.1| thioredoxin [Sinorhizobium medicae WSM419]
          Length = 107

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/107 (46%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVDT +F  EVL  + PVVVDFWA WC PC  ++P +++I+ ELA KVK+ KL+I+
Sbjct: 1   MATVKVDTSNFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEISTELAGKVKVVKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++ +Y + SIPTL +FK G+V D  + GA+ ++ +  WI + V
Sbjct: 61  ENPELAAQYGVRSIPTLAMFKGGEVADIKV-GAAPKTALSSWISNAV 106


>gi|85860040|ref|YP_462242.1| thioredoxin [Syntrophus aciditrophicus SB]
 gi|85723131|gb|ABC78074.1| thioredoxin [Syntrophus aciditrophicus SB]
          Length = 110

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S L V   +F+ E+++   P +VDFWA+WC PC  + P+++ +A+    +VKI+KL+++E
Sbjct: 6   SLLHVTDANFEEEIIKSDKPALVDFWATWCGPCRAIGPLVEGLAETYKGRVKISKLNVDE 65

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + + +  + + SIPTLILFKDGKV+D ++ G  S+  +  ++   +
Sbjct: 66  NPKTAADFGVRSIPTLILFKDGKVMDTLV-GVVSKERLETFVNQSL 110


>gi|72382530|ref|YP_291885.1| thioredoxin [Prochlorococcus marinus str. NATL2A]
 gi|124026231|ref|YP_001015347.1| thioredoxin [Prochlorococcus marinus str. NATL1A]
 gi|72002380|gb|AAZ58182.1| thioredoxin [Prochlorococcus marinus str. NATL2A]
 gi|123961299|gb|ABM76082.1| Thioredoxin [Prochlorococcus marinus str. NATL1A]
          Length = 107

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 1   MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS    V   SF+ EVL+   PV+VDFWA WC PC  ++PI+++I+ +   K+K+ KL+ 
Sbjct: 1   MSTASAVTDSSFEQEVLQSDVPVLVDFWAPWCGPCRMVAPIVEEISKDFEGKIKVYKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+  ++++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 61  DENPNVASQYGIRSIPTLMIFKGGQKVDTVV-GAVPKATLSGTISKHL 107


>gi|88812430|ref|ZP_01127679.1| thioredoxin [Nitrococcus mobilis Nb-231]
 gi|88790216|gb|EAR21334.1| thioredoxin [Nitrococcus mobilis Nb-231]
          Length = 108

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +    ++F+ EVL+ + PV+VD+WA WC PC  ++PI+D++A+  A K+K+ KL+
Sbjct: 1   MSGNIVHASDETFEQEVLKAAEPVLVDYWAEWCGPCKMIAPILDEVAEAYAGKLKVIKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ E   +Y I  IPTL+LFK+G+V    + GA S+S +  ++ S +
Sbjct: 61  IDDNPETPPKYGIRGIPTLMLFKNGEVEATKV-GAVSKSQLTAFLDSNL 108


>gi|212710199|ref|ZP_03318327.1| hypothetical protein PROVALCAL_01258 [Providencia alcalifaciens DSM
           30120]
 gi|212687198|gb|EEB46726.1| hypothetical protein PROVALCAL_01258 [Providencia alcalifaciens DSM
           30120]
          Length = 122

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+S+VL  ++P++VDFWA WC PC  ++PI+D++A+E   KV I KL+
Sbjct: 15  MSDKIKHITDASFESDVLNANSPILVDFWAEWCGPCKMIAPILDEVAEEYTGKVTIAKLN 74

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ +   + ++ I  IPTL+LFK+G V    + GA S++ + E++   +
Sbjct: 75  IDNNPATAPKFGIRGIPTLLLFKNGSVAATKV-GALSKTQLKEFLDENL 122


>gi|303245510|ref|ZP_07331794.1| thioredoxin [Desulfovibrio fructosovorans JJ]
 gi|302493359|gb|EFL53221.1| thioredoxin [Desulfovibrio fructosovorans JJ]
          Length = 106

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++   +F++E L+C  PV+VDFWA WC PC  + P+ID++A+E   +VK+ K++++
Sbjct: 1   MA-IQLSDANFEAEALQCDLPVLVDFWAPWCGPCRAMGPVIDELANEYTGQVKVAKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+    ++Y I +IPTLILFK G+V+++ + GA S+S I E +  +
Sbjct: 60  ENPSTPSKYGIRAIPTLILFKGGEVVEQ-ITGAVSKSSIKEMLTQK 104


>gi|283850647|ref|ZP_06367934.1| thioredoxin [Desulfovibrio sp. FW1012B]
 gi|283573890|gb|EFC21863.1| thioredoxin [Desulfovibrio sp. FW1012B]
          Length = 106

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++   +F++E L+C  PV+VDFWA WC PC  + P+ID++A+E   +VK+ K++++
Sbjct: 1   MA-IQLSDANFEAEALQCDLPVLVDFWAPWCGPCRAMGPVIDELANEYTGQVKVAKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+    ++Y I +IPTLILFK G+V+++ + GA S+S I E I  +
Sbjct: 60  ENPSTPSKYGIRAIPTLILFKGGEVVEQ-ITGAVSKSSIKEMISQK 104


>gi|15963786|ref|NP_384139.1| thioredoxin protein [Sinorhizobium meliloti 1021]
 gi|307310974|ref|ZP_07590619.1| thioredoxin [Sinorhizobium meliloti BL225C]
 gi|307322015|ref|ZP_07601394.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|15072961|emb|CAC41420.1| Probable thioredoxin protein [Sinorhizobium meliloti 1021]
 gi|306892353|gb|EFN23160.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|306899654|gb|EFN30281.1| thioredoxin [Sinorhizobium meliloti BL225C]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/107 (47%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVDT +F  EVL  + PVVVDFWA WC PC  ++P +++IA ELA KVK+ KL+I+
Sbjct: 1   MATVKVDTANFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEIATELAGKVKVVKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++ +Y + SIPTL +FK G+V D  + GA+ ++ +  WI + V
Sbjct: 61  ENPELAAQYGVRSIPTLAMFKGGEVADIKV-GAAPKTALSSWISNAV 106


>gi|254780822|ref|YP_003065235.1| thioredoxin [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040499|gb|ACT57295.1| thioredoxin [Candidatus Liberibacter asiaticus str. psy62]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE
Sbjct: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV
Sbjct: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107


>gi|254784464|ref|YP_003071892.1| thioredoxin [Teredinibacter turnerae T7901]
 gi|237684810|gb|ACR12074.1| thioredoxin [Teredinibacter turnerae T7901]
          Length = 108

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 67/106 (63%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +     SF+ +VL    PV+VDFWA+WC PC  ++P++D++A E   K+KI K+D++ 
Sbjct: 4   AIVHTSDASFEQDVLTADGPVLVDFWAAWCGPCKMIAPVLDELAQEYEGKIKICKMDVDA 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E   ++ I  IPTLI+FK+G      + GA S++ + E+I + V
Sbjct: 64  NKETPAKFNIRGIPTLIIFKNGSAEGTKV-GALSKAQLKEFIDANV 108


>gi|146305349|ref|YP_001185814.1| thioredoxin [Pseudomonas mendocina ymp]
 gi|330501282|ref|YP_004378151.1| thioredoxin [Pseudomonas mendocina NK-01]
 gi|145573550|gb|ABP83082.1| thioredoxin [Pseudomonas mendocina ymp]
 gi|328915568|gb|AEB56399.1| thioredoxin [Pseudomonas mendocina NK-01]
          Length = 108

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SFD +V++   PV+VD+WA WC PC  ++P++D+IA +   K+KI KL+
Sbjct: 1   MSEFITNVSDASFDQDVIQAEGPVLVDYWAEWCGPCKMIAPVLDEIAKDYQGKLKICKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ E   +Y +  IPTL+LFK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDENQETPPKYGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDSNI 108


>gi|90421912|ref|YP_530282.1| thioredoxin [Rhodopseudomonas palustris BisB18]
 gi|90103926|gb|ABD85963.1| thioredoxin [Rhodopseudomonas palustris BisB18]
          Length = 106

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F+SEVL  + PVVVDFWA WC PC  ++P +D+I+  L +KVKI KL+++
Sbjct: 1   MAVGKVSDADFESEVLNATGPVVVDFWAEWCGPCRMIAPALDEISSALGEKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ + +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ENPQTASKYSVMSIPTLLIFKGGEMASRQV-GAAPKQKLHQWISAAV 106


>gi|330938793|gb|EGH42318.1| thioredoxin [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 109

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +FD+EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL
Sbjct: 1   MSSDLIKHVTDANFDAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDEIAGTYEGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++ E   ++ +  IPTL+LFKDG V    + GA S+S +  ++ + +
Sbjct: 61  NIDQNPETPAKHGVRGIPTLMLFKDGNVEATKV-GALSKSQLAAFLDANI 109


>gi|167836376|ref|ZP_02463259.1| thioredoxin 1 [Burkholderia thailandensis MSMB43]
          Length = 108

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV++DFWA WC PC  ++PI+D++A +  D+++I K++
Sbjct: 1   MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDRLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++      ++ +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 61  VDDHQATPAKFGVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|311897297|dbj|BAJ29705.1| putative thioredoxin [Kitasatospora setae KM-6054]
          Length = 108

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +  +V   +FD+EVL+   PV+VDFWA+WC PC +++P+++DIA E  DK+ + KLD++ 
Sbjct: 4   ATKEVTDATFDAEVLKSDKPVLVDFWATWCGPCRQVAPVLEDIAAEHGDKLTVVKLDVDA 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  Y + SIPTL ++K G+++   + GA  ++ ++  +   +
Sbjct: 64  NQETAAAYNVISIPTLNVYKGGELVKT-ITGARPKAALLRELAEYL 108


>gi|114328675|ref|YP_745832.1| thioredoxin [Granulibacter bethesdensis CGDNIH1]
 gi|114316849|gb|ABI62909.1| thioredoxin [Granulibacter bethesdensis CGDNIH1]
          Length = 115

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   +F+++VL  S PV+VDFWA WC PC  ++P ++++A E   ++ + K++
Sbjct: 8   MSEHTKPVTDATFETDVLGASGPVLVDFWAEWCGPCRMIAPALEEVAAENTGRLTVAKVN 67

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   RY ++ IPTLILFKDG+ I + + GA  +S + +W+   +
Sbjct: 68  IDENPDSPNRYGVTGIPTLILFKDGQPIAKQV-GALPKSALKQWVSGNI 115


>gi|289674520|ref|ZP_06495410.1| thioredoxin [Pseudomonas syringae pv. syringae FF5]
          Length = 109

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +FD+EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL
Sbjct: 1   MSSDLIKHVTDANFDAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDEIASTYKGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++ +   ++ +  IPTL+LFKDG V    + GA S+S +  ++ + +
Sbjct: 61  NIDQNPDTPAKHGVRGIPTLMLFKDGNVEATKV-GALSKSQLAAFLDANI 109


>gi|49474855|ref|YP_032896.1| thioredoxin [Bartonella henselae str. Houston-1]
 gi|49237660|emb|CAF26842.1| Thioredoxin [Bartonella henselae str. Houston-1]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 78/105 (74%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS +KVD  +F+SEVL  S PVVVDFWA WC PC  ++PI+D+I+ E+ ++VKI K++I+
Sbjct: 1   MSCIKVDKSNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQNQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++T+Y + SIPTL++FKDG  I   M GA+S+  + EWI  
Sbjct: 61  ENPELATQYGVRSIPTLLMFKDGN-IASNMVGAASKGRVSEWIKE 104


>gi|85373842|ref|YP_457904.1| thiol-disulfide isomerase [Erythrobacter litoralis HTCC2594]
 gi|84786925|gb|ABC63107.1| thiol-disulfide isomerase [Erythrobacter litoralis HTCC2594]
          Length = 106

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   SF ++VLE   PV+VDFWA WC PC  ++P +++I++EL ++V I K+DI 
Sbjct: 1   MATVNVTDASFKADVLESDKPVLVDFWAEWCGPCKMIAPALEEISEELGEQVTIAKMDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+++ ++   + SIP ++LFK+G+ + R + GA+ +S + +WI S +
Sbjct: 61  ENTDTASEMGVQSIPLMVLFKNGEAVARKV-GAAPKSQLKDWIESEI 106


>gi|319403512|emb|CBI77091.1| thioredoxin [Bartonella rochalimae ATCC BAA-1498]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 80/107 (74%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D+ +F++EVL    PVVVDFWA WC PC  ++PI+D+IA E+  ++K+ K++I+
Sbjct: 1   MTCIKIDSSNFENEVLSSPLPVVVDFWAEWCGPCKSIAPILDEIATEMQSQIKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++T+Y I SIPTL++F +GKV    + GA+S+  ++EWI + +
Sbjct: 61  ENPDLATQYGIRSIPTLLMFTNGKVSSNKV-GATSKGHLVEWIKNSL 106


>gi|148251713|ref|YP_001236298.1| thioredoxin 1, redox factor [Bradyrhizobium sp. BTAi1]
 gi|146403886|gb|ABQ32392.1| thioredoxin 1, redox factor [Bradyrhizobium sp. BTAi1]
          Length = 106

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F+SEVL+   PVVVDFWA WC PC  ++P +D+I+  + DKVKI KL+++
Sbjct: 1   MAVGKVSDADFESEVLQADGPVVVDFWAEWCGPCRMIAPALDEISSAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  ESPKTASKYGVMSIPTLMVFKGGEMASRQV-GAAPKAKLQQWISSAV 106


>gi|11465476|ref|NP_045133.1| thioredoxin [Cyanidium caldarium]
 gi|586100|sp|P37395|THIO_CYACA RecName: Full=Thioredoxin; Short=Trx
 gi|6466379|gb|AAF12961.1|AF022186_84 unknown [Cyanidium caldarium]
 gi|14403|emb|CAA79820.1| thioredoxin [Cyanidium caldarium]
          Length = 107

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S ++V   SF+ EV+     V+VDFWA WC PC  +SP+ID++A E  ++VKI K++ +E
Sbjct: 3   SPIQVTDFSFEKEVVNSEKLVLVDFWAPWCGPCRMISPVIDELAQEYVEQVKIVKINTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  IS  Y I SIPTL+LFKDGK +D ++ GA  +S +   +   +
Sbjct: 63  NPSISAEYGIRSIPTLMLFKDGKRVDTVI-GAVPKSTLTNALKKYL 107


>gi|148654106|ref|YP_001281199.1| thioredoxin [Psychrobacter sp. PRwf-1]
 gi|148573190|gb|ABQ95249.1| thioredoxin [Psychrobacter sp. PRwf-1]
          Length = 108

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +     +F+ +V +   PV+VDFWA+WC PC  ++P+++++AD+   KVKI K+D
Sbjct: 1   MSDLIVNSTDSNFEQDVAQSDVPVLVDFWAAWCGPCKAIAPVLEELADDYNGKVKIVKID 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+ E ++R+ I SIPTL++FK G+ +D  + G   +SD+   +   +
Sbjct: 61  VDENPETASRFGIRSIPTLMVFKGGEKVDT-VMGLQPKSDLAALLDKHL 108


>gi|325108580|ref|YP_004269648.1| thioredoxin [Planctomyces brasiliensis DSM 5305]
 gi|324968848|gb|ADY59626.1| thioredoxin [Planctomyces brasiliensis DSM 5305]
          Length = 108

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   L+    +F +EVL    PV+VDFWA WC PC  ++P I+++A + A KV+I KL+
Sbjct: 1   MAGDVLEFTDGNFQTEVLSGDQPVLVDFWAPWCGPCKMMTPTIEELATDYAGKVRIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +++   ++ + IS+IPTL+LFK+G++++R+  G   +  +   +   +
Sbjct: 61  TDDNPNTASEHGISAIPTLMLFKNGELVERL-TGVVPKDQLATTLDKHL 108


>gi|239906801|ref|YP_002953542.1| thioredoxin [Desulfovibrio magneticus RS-1]
 gi|239796667|dbj|BAH75656.1| thioredoxin [Desulfovibrio magneticus RS-1]
          Length = 106

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++   +F++E L+C  PV+VDFWA WC PC  + P+ID++A+E   +VK+ K++++
Sbjct: 1   MA-IQLSDANFEAEALQCDLPVLVDFWAPWCGPCRAMGPVIDELANEYTGQVKVAKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+    ++Y I +IPTLILFK G+V+++ + GA S+S I E +  +
Sbjct: 60  ENPSTPSKYGIRAIPTLILFKGGEVVEQ-ITGAVSKSSIKEMLSQK 104


>gi|78357110|ref|YP_388559.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78219515|gb|ABB38864.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 107

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 72/106 (67%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   +F++EV++   P ++DFWA WC PC  + P+ID++A E A KV I K++++
Sbjct: 1   MAV-QVTDSNFEAEVIKSELPTLIDFWAPWCGPCRAMGPVIDELAAEFAGKVNIVKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+    ++Y I +IPTLILFK G+V+++ + GA S+S I + I  +
Sbjct: 60  ENPATPSKYGIRAIPTLILFKGGEVVEQ-ITGAVSKSSIKDMITQK 104


>gi|33602206|ref|NP_889766.1| thioredoxin 1 [Bordetella bronchiseptica RB50]
 gi|33576644|emb|CAE33722.1| thioredoxin 1 [Bordetella bronchiseptica RB50]
          Length = 141

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+++VL+   PV+VD+WA+WC PC  ++PI++++A E A ++ + KL+
Sbjct: 34  MSEQIKNVSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVASEYAGRLTVAKLN 93

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+ + + +Y +  IPTL+LFKDG+     + GA S+S +  ++   +
Sbjct: 94  VDENQDTAAKYGVRGIPTLMLFKDGQAAATKV-GALSKSQLTAFLDGAL 141


>gi|145589488|ref|YP_001156085.1| thioredoxin [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047894|gb|ABP34521.1| thioredoxin [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ +VL+   PV++DFWA WC PC  + PI+++++ E  DK++I K++
Sbjct: 1   MSAGIKYVTDASFEQDVLKSDKPVLLDFWAEWCGPCKMIGPILEELSGEYGDKLQIAKMN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+  +  ++ I  IPTLILFK+G V  + + GA ++S +  +I S +
Sbjct: 61  VDENQGVPAQFNIRGIPTLILFKNGTVAAQKV-GALAKSQLSAFIDSNI 108


>gi|118465727|ref|YP_884412.1| thioredoxin [Mycobacterium avium 104]
 gi|118167014|gb|ABK67911.1| thioredoxin [Mycobacterium avium 104]
          Length = 117

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E  D + + KLD++ 
Sbjct: 9   ATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++  +   V
Sbjct: 69  NPETAQNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLRELSDAV 113


>gi|135741|sp|P00275|THIO1_CORNE RecName: Full=Thioredoxin C-1
          Length = 105

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 78/104 (75%), Gaps = 1/104 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KVD  +F S+VL+ S PVVVDFWA WC PC  ++P +D+IA E+A +VKI K++I+E
Sbjct: 1   ATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKMIAPALDEIATEMAGQVKIAKVNIDE 60

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + E++ ++ + SIPTL++FKDG++   M+ GA+ +S + +WI +
Sbjct: 61  NPELAAQFGVRSIPTLLMFKDGELAANMV-GAAPKSRLADWIKA 103


>gi|171059486|ref|YP_001791835.1| thioredoxin [Leptothrix cholodnii SP-6]
 gi|170776931|gb|ACB35070.1| thioredoxin [Leptothrix cholodnii SP-6]
          Length = 109

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +FD +V++   PV+VD+WA WC PC  ++PI+D++A + + +++I K+
Sbjct: 1   MSSDLIKHVSDATFDGDVVQSDKPVLVDYWAEWCGPCKMIAPILDEVAKDYSGRLQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ E+  ++ I  IPTL+LFK G++    + GA S++ +  ++ + +
Sbjct: 61  NVDENREVPAKFGIRGIPTLMLFKGGQLAATKV-GALSKAQLTSFLDAHL 109


>gi|300691833|ref|YP_003752828.1| thioredoxin [Ralstonia solanacearum PSI07]
 gi|299078893|emb|CBJ51554.1| thioredoxin [Ralstonia solanacearum PSI07]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ EVL+   PV+VDFWA WC PC  ++PI+D+++ +  DKV+I KL+
Sbjct: 1   MSEQIKYVSDASFEDEVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGDKVQIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E++ +  ++ I  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 61  VDENAGVPAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|237755583|ref|ZP_04584199.1| thioredoxin [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237692246|gb|EEP61238.1| thioredoxin [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 105

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + V+  +F+ EVL    PV+VDFWA WC PC  ++PI++++A EL  K K+ K++
Sbjct: 1   MAGKVISVNESNFEQEVLNSDVPVLVDFWAPWCGPCRLIAPIVEELAVELEGKAKVVKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +E+  ++ RY I +IPT+++FK+G+V+D  + G  S+  +   +
Sbjct: 61  TDENPNLAMRYGIRAIPTIMVFKNGRVVDTKV-GVQSKEVLKALL 104


>gi|147669275|ref|YP_001214093.1| thioredoxin [Dehalococcoides sp. BAV1]
 gi|146270223|gb|ABQ17215.1| thioredoxin [Dehalococcoides sp. BAV1]
          Length = 107

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++  +SF +EVL+   PV+VDFWA WC PC  ++PIID ++ + A K K  KL+++E+
Sbjct: 2   VMELTDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYAGKFKFCKLNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +T+Y++ SIPTL+ FK G+V D M+ GA  +S + + I   +
Sbjct: 62  KTTATQYRVMSIPTLLFFKGGQVAD-MVVGAVPESALSQKIDQLI 105


>gi|83816367|ref|YP_446755.1| thioredoxin [Salinibacter ruber DSM 13855]
 gi|83757761|gb|ABC45874.1| thioredoxin [Salinibacter ruber DSM 13855]
          Length = 114

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 73/111 (65%), Gaps = 5/111 (4%)

Query: 1   MS----ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITK 56
           M+     + +   +F+ EV+    PV+VDFWA+WC PC +++PI++++ADE   + KI K
Sbjct: 1   MAESANVITLTDDNFEDEVIGADQPVLVDFWATWCGPCRQIAPIVEELADEYEGQAKIGK 60

Query: 57  LDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +D++E+ + +  Y + SIPTL+ FKDG+  ++++ GA+ +  + E + + +
Sbjct: 61  VDVDENPQTAQEYGVRSIPTLLFFKDGEAKEQVV-GAAGKQPLKENLEALL 110


>gi|171321033|ref|ZP_02910019.1| thioredoxin [Burkholderia ambifaria MEX-5]
 gi|171093712|gb|EDT38857.1| thioredoxin [Burkholderia ambifaria MEX-5]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV+VDFWA WC PC  ++PI+D++A +  DK++I K++
Sbjct: 1   MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++     ++ +  IPTLILFK+G    + + GA S+S +  ++ S +
Sbjct: 61  VDDNQATPAKFGVRGIPTLILFKNGAAAAQKV-GALSKSQLTAFLDSNL 108


>gi|33592390|ref|NP_880034.1| thioredoxin 1 [Bordetella pertussis Tohama I]
 gi|33596499|ref|NP_884142.1| thioredoxin 1 [Bordetella parapertussis 12822]
 gi|33566268|emb|CAE37179.1| thioredoxin 1 [Bordetella parapertussis]
 gi|33572035|emb|CAE41559.1| thioredoxin 1 [Bordetella pertussis Tohama I]
 gi|332381806|gb|AEE66653.1| thioredoxin 1 [Bordetella pertussis CS]
          Length = 141

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+++VL+   PV+VD+WA+WC PC  ++PI++++A E A ++ + KL+
Sbjct: 34  MSEQIKNVSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVAAEYAGRLTVAKLN 93

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+ + + +Y +  IPTL+LFKDG+     + GA S+S +  ++   +
Sbjct: 94  VDENQDTAAKYGVRGIPTLMLFKDGQAAATKV-GALSKSQLTAFLDGAL 141


>gi|144901314|emb|CAM78178.1| Thioredoxin (TRX) [Magnetospirillum gryphiswaldense MSR-1]
          Length = 104

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V  ++F++EVL+   PV+VDFWA WC PC +++P ++D+A +L  K+ + K++I+E+  
Sbjct: 3   NVTDQTFETEVLKADGPVLVDFWAEWCGPCRQIAPALEDLAKDLEGKLTVAKINIDENPG 62

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +Y +  IPTL++FK G+V    + GA  +S ++EW+ S +
Sbjct: 63  TPGKYGVRGIPTLMIFKGGQVAATKI-GALPKSKLVEWVNSSL 104


>gi|83590509|ref|YP_430518.1| thioredoxin [Moorella thermoacetica ATCC 39073]
 gi|83573423|gb|ABC19975.1| thioredoxin [Moorella thermoacetica ATCC 39073]
          Length = 109

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 73/110 (66%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + +   +F+ EVL  + PV+VDFWA+WC PC  ++PI+D++A E A KVK+ KL
Sbjct: 1   MAASNIITLTDANFEEEVLSATTPVLVDFWAAWCGPCRMIAPIVDELAQEYAGKVKVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E  +I   Y I SIPTLILFK+G+VI R + G  S+  + + + + +
Sbjct: 61  NVDEYPKIPADYGIMSIPTLILFKNGEVIARTV-GYQSKEKLAQVLENNL 109


>gi|330447221|ref|ZP_08310871.1| thioredoxin [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491412|dbj|GAA05368.1| thioredoxin [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SFD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKIVQLTDASFDTDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|51210005|ref|YP_063669.1| thioredoxin [Gracilaria tenuistipitata var. liui]
 gi|50657759|gb|AAT79744.1| thioredoxin [Gracilaria tenuistipitata var. liui]
          Length = 113

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L+V   SF+ EV++ S PV+VDFWA WC PC  ++P+++ IA E  DK+K+  L+ +
Sbjct: 1   MHVLEVMDASFNEEVIKSSYPVLVDFWAPWCGPCRMVAPVVNQIAHEYKDKLKVVTLNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++   +  Y I SIPTLI+F +G+ +  ++ GA  +S +I  +   +
Sbjct: 61  KNPSTAAEYGIRSIPTLIIFIEGQRVHTVV-GAIPKSTLISTLNKHL 106


>gi|91776641|ref|YP_546397.1| thioredoxin [Methylobacillus flagellatus KT]
 gi|91710628|gb|ABE50556.1| thioredoxin [Methylobacillus flagellatus KT]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   +FD EVL+   PV+VD+WA WC PC  ++PI+D+IA E A ++KI KL+
Sbjct: 1   MSEHITHISDDTFDQEVLQSQLPVLVDYWAEWCGPCKMIAPILDEIAKEYAGRLKIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+     +Y I  IPTL+LFKDG V    + GA S+S +  +I S +
Sbjct: 61  IDENQNTPPKYGIRGIPTLMLFKDGNVEATKV-GALSKSQLTAFIDSNI 108


>gi|90994416|ref|YP_536906.1| thioredoxin [Porphyra yezoensis]
 gi|1729949|sp|P50254|THIO_PORYE RecName: Full=Thioredoxin; Short=Trx
 gi|509277|emb|CAA54077.1| thioredoxin [Porphyra yezoensis]
 gi|90818980|dbj|BAE92349.1| thioredoxin [Porphyra yezoensis]
          Length = 107

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  +V   SF  EV+  + PV+VDFWA WC PC  +SP++D+IA+E    +K+ K++ +
Sbjct: 1   MSVSQVTDASFKQEVINNNLPVLVDFWAPWCGPCRMVSPVVDEIAEEYESSIKVVKINTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++  I+  Y I SIPTL++FK G+ +D ++ GA  +S +   +   +
Sbjct: 61  DNPTIAAEYGIRSIPTLMIFKAGERVDTVI-GAVPKSTLASTLNKYI 106


>gi|302186814|ref|ZP_07263487.1| thioredoxin [Pseudomonas syringae pv. syringae 642]
          Length = 109

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL
Sbjct: 1   MSSDLIKHVTDATFEAEVLQAQGPVLVDYWAEWCGPCKMIAPVLDEIASTYQGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ +   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQDTPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 109


>gi|222084226|ref|YP_002542752.1| thioredoxin [Agrobacterium radiobacter K84]
 gi|221721674|gb|ACM24830.1| thioredoxin [Agrobacterium radiobacter K84]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 74/104 (71%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVL+ + PV+VDFWA WC PC  ++P +++++++   KVK+ KL+I+
Sbjct: 1   MATVKVDNANFASEVLQSAEPVIVDFWAEWCGPCKMIAPSLEELSEQFEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E+ E++ ++ + SIPTL +FK G+V D  + GA+ +S +  WI 
Sbjct: 61  ENPELAAQFGVRSIPTLAMFKAGEVADIKV-GAAPKSALESWIK 103


>gi|332970273|gb|EGK09265.1| thioredoxin [Kingella kingae ATCC 23330]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   +F++EVL+ S PV++DFWA WC PC  ++PI+D +ADE A K+KI K++
Sbjct: 1   MSNQIVHVTDATFEAEVLQSSQPVLLDFWAPWCGPCKMIAPILDQLADEWAGKIKIAKMN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  I  ++ I SIPTL++ KDG+V+    PGA ++  +  ++ + +
Sbjct: 61  VDDNQAIPAQFGIRSIPTLVVLKDGQVLATR-PGALAKPQLEAFVNASL 108


>gi|262172592|ref|ZP_06040270.1| thioredoxin reductase [Vibrio mimicus MB-451]
 gi|261893668|gb|EEY39654.1| thioredoxin reductase [Vibrio mimicus MB-451]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++V++ + PV+VDFWA WC PC  ++PI+D++ADE A K+ I KL+
Sbjct: 1   MSDKILQLTDDGFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEVADEYAGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    +Y I  IPTL+LFKDG V+   + GA S++ + E++ + +
Sbjct: 61  IDHNAGTPPKYGIRGIPTLLLFKDGSVVATKV-GALSKTQLKEFLDANL 108


>gi|262273618|ref|ZP_06051432.1| thioredoxin [Grimontia hollisae CIP 101886]
 gi|262222596|gb|EEY73907.1| thioredoxin [Grimontia hollisae CIP 101886]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++   SFD++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   KV I KL+
Sbjct: 1   MSDKILQLTDDSFDADVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKVTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 108


>gi|78224421|ref|YP_386168.1| thioredoxin [Geobacter metallireducens GS-15]
 gi|78195676|gb|ABB33443.1| Thioredoxin [Geobacter metallireducens GS-15]
          Length = 109

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L     +FD++VL+ + PV+VDFWA+WC PC  ++P+ID IADE   KVK+ K+
Sbjct: 1   MASEKVLTFSDDNFDTDVLKATVPVLVDFWATWCAPCKAIAPVIDAIADEYDGKVKVGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++     +Y +  IPT+ILFKDGKV+D+++ GA  ++ +   I   +
Sbjct: 61  NVDDNPGTPGKYGVRGIPTVILFKDGKVVDQVV-GAVPKAQLEALIKKAL 109


>gi|85708413|ref|ZP_01039479.1| hypothetical protein NAP1_04220 [Erythrobacter sp. NAP1]
 gi|85689947|gb|EAQ29950.1| hypothetical protein NAP1_04220 [Erythrobacter sp. NAP1]
          Length = 118

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  +SF S+VLE   PV+VDFWA WC PC  ++P +++I++EL ++V I K+DI 
Sbjct: 13  MATVNVTDESFKSDVLESDKPVLVDFWADWCGPCKMIAPALEEISNELGEQVTIAKMDIM 72

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++ I     + SIP ++LFK+G+ + R + GA+ +S + +W+ S +
Sbjct: 73  ENTGIPAEMGVQSIPLMVLFKNGEAVARKV-GAAPKSQLKDWLESEI 118


>gi|257455702|ref|ZP_05620931.1| thioredoxin [Enhydrobacter aerosaccus SK60]
 gi|257446985|gb|EEV21999.1| thioredoxin [Enhydrobacter aerosaccus SK60]
          Length = 107

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 67/106 (63%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +  D  +F+  VL+   PV+VDFWA+WC PC  ++P++D+++ E   K +I K+D+++
Sbjct: 3   SVIHADEGTFEKAVLQSDTPVLVDFWATWCGPCKAIAPVLDELSSEFEGKARIVKIDVDQ 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  ++ +Y I SIPTL +FK+G+ +D  M G   ++ +   I   +
Sbjct: 63  NPNLAAQYGIRSIPTLFMFKNGEKVDATM-GMQPKAQLTALINKHL 107


>gi|332185862|ref|ZP_08387609.1| thioredoxin [Sphingomonas sp. S17]
 gi|332014220|gb|EGI56278.1| thioredoxin [Sphingomonas sp. S17]
          Length = 106

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  ++   SF+++VL    PV+VDFWA WC PC  + P ++++++EL ++V I KL+I+
Sbjct: 1   MATKQITDASFEADVLNSDKPVLVDFWAEWCGPCKMIGPSLEELSEELGEQVTIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +   RY +  IPT+ILFK G      + GA  +  I  W+   +
Sbjct: 61  DNPDAPGRYGVRGIPTMILFKGGAAAATKV-GAEPKGRIKAWLEGAL 106


>gi|317485233|ref|ZP_07944114.1| thioredoxin [Bilophila wadsworthia 3_1_6]
 gi|316923524|gb|EFV44729.1| thioredoxin [Bilophila wadsworthia 3_1_6]
          Length = 107

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 72/106 (67%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V+  +FD+ VL+   PV+VDFWA WC PC  + PIID++A+E   K+ + KL+++
Sbjct: 1   MAT-QVNDSNFDAVVLQSQLPVLVDFWAPWCGPCRAIGPIIDELANEYEGKLSVVKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ES     +Y I +IPTLILFK+G+V+++ + GA S+S I   I  +
Sbjct: 60  ESPSTPGKYGIRAIPTLILFKNGEVVEQ-VTGAVSKSSIATMIEQK 104


>gi|170078222|ref|YP_001734860.1| thioredoxin [Synechococcus sp. PCC 7002]
 gi|169885891|gb|ACA99604.1| thioredoxin [Synechococcus sp. PCC 7002]
          Length = 107

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F  EVLE   PV+VDFWA WC PC  ++P++++IA++  D++K+ KL+ +E+  +
Sbjct: 7   VTDATFQEEVLESDVPVLVDFWAPWCGPCRMVAPVVEEIAEQYQDQIKVFKLNTDENPGV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ Y I SIPTL++FK GK +  M+ GA  ++ +   I   +
Sbjct: 67  ASEYGIRSIPTLMIFKGGKKV-SMVVGAVPKTTLAAAIDKEL 107


>gi|253582058|ref|ZP_04859282.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251836407|gb|EES64944.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 104

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/101 (43%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++FD EVL+   PV+VDFWA WC PC  L PI++++  ELA  VKI K++I+
Sbjct: 1   MAILHITKENFDKEVLKSDVPVLVDFWADWCGPCKALGPILEEVESELAPGVKIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E  E++ ++++ SIPTL+LFK+G+ +++ + G  S+  +IE
Sbjct: 61  EQEELAAQFRVMSIPTLLLFKNGQPVEKSV-GLISKDQVIE 100


>gi|152982671|ref|YP_001352313.1| thioredoxin [Janthinobacterium sp. Marseille]
 gi|151282748|gb|ABR91158.1| thioredoxin [Janthinobacterium sp. Marseille]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SFD++VL+   PV+VDFWA WC PC  ++PI++D+A E A K++ITK+D
Sbjct: 1   MSENIKHITDASFDTDVLKSDKPVLVDFWAEWCGPCKMIAPILEDVAKEYAGKIQITKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +  I  ++ I  IPTLILFK+G    + + GA ++  +  +I S +
Sbjct: 61  VDANQAIPAKFGIRGIPTLILFKNGAPAAQKV-GALAKGQLTAFIDSNI 108


>gi|183985448|ref|YP_001853739.1| thioredoxin TrxC [Mycobacterium marinum M]
 gi|183178774|gb|ACC43884.1| thioredoxin TrxC [Mycobacterium marinum M]
          Length = 117

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF +EVL  + PV+VDFWA+WC PC  ++P++++IA E AD + + KLD++ 
Sbjct: 9   ATIEVSDASFSTEVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERADSLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++  +   V
Sbjct: 69  NPETARNFQVVSIPTMILFKDGEPVKRIV-GAKGKAALLRELSDAV 113


>gi|269836181|ref|YP_003318409.1| thioredoxin [Sphaerobacter thermophilus DSM 20745]
 gi|269785444|gb|ACZ37587.1| thioredoxin [Sphaerobacter thermophilus DSM 20745]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 76/108 (70%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + V   +FD EVL+   PV+VDFWA WC PC  ++PI+D+IA+E A  +K+ K+++
Sbjct: 1   MSKPVTVSDATFDQEVLKSDVPVLVDFWAVWCGPCRMVAPILDEIAEEKAGSLKVAKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E++ ++ +  I+SIPTLIL+KDG+ ++R++ GA  +  +++ I   +
Sbjct: 61  DENARVAAQLGITSIPTLILYKDGQPVERII-GAHPKQRLLQQIEKHL 107


>gi|302342569|ref|YP_003807098.1| thioredoxin [Desulfarculus baarsii DSM 2075]
 gi|301639182|gb|ADK84504.1| thioredoxin [Desulfarculus baarsii DSM 2075]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 76/109 (69%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   ++V   SF+ E+L+   P +VDFWASWC PC  ++P++++++++ A KVK+ KL+
Sbjct: 1   MAGNVVQVTDDSFEQEILKSELPTLVDFWASWCGPCRAIAPVVEELSEDYAGKVKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ES +   +Y I +IPTLI+FKDGK +D+ + GA S++ I E +   +
Sbjct: 61  VDESPKTPGQYGIRAIPTLIMFKDGKQVDQ-ITGAVSKAHIEEALKKLL 108


>gi|269103751|ref|ZP_06156448.1| thioredoxin [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163649|gb|EEZ42145.1| thioredoxin [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SFDS+V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+
Sbjct: 1   MSDKIVQLTDASFDSDVVNAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 108


>gi|331006629|ref|ZP_08329914.1| Thioredoxin [gamma proteobacterium IMCC1989]
 gi|330419568|gb|EGG93949.1| Thioredoxin [gamma proteobacterium IMCC1989]
          Length = 108

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 68/106 (64%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V   SFD +VL    PV+VDFWA+WC PC  ++P++D +A E A K+ I K+D++ 
Sbjct: 4   AMTHVTDASFDQDVLAADGPVLVDFWAAWCGPCKMIAPVLDQLAGEYAGKLTICKMDVDG 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E   ++ I  IPTL++FK+G +  + + GA S+ D+ E+I + +
Sbjct: 64  NKETPAKFGIRGIPTLMIFKNGNMEAQTV-GALSKPDLEEFIKTNL 108


>gi|163867332|ref|YP_001608526.1| thioredoxin [Bartonella tribocorum CIP 105476]
 gi|161016973|emb|CAK00531.1| thioredoxin [Bartonella tribocorum CIP 105476]
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 78/104 (75%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F+SEVL  S PVVVDFWA WC PC  ++PI+D+I+ E+ ++VKI K++I+
Sbjct: 1   MTCVKVDKDNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISTEMQNQVKIVKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E+ E++T+Y + SIPTL++FK+G  +   M GA+S+  + EWI 
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGN-VSSNMVGATSKGRLSEWIK 103


>gi|89901669|ref|YP_524140.1| thioredoxin [Rhodoferax ferrireducens T118]
 gi|89346406|gb|ABD70609.1| thioredoxin [Rhodoferax ferrireducens T118]
          Length = 133

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 72/110 (65%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      V   SF+++VL+ + PV+VD+WA WC PC  ++PI+++IA     K++I K+
Sbjct: 24  MASELIKHVSDASFEADVLQSTQPVLVDYWAEWCGPCKMIAPILEEIATSYEGKLQIAKM 83

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ +I  ++ I  IPTL+LFKDG++    + GA S+S +  +I  ++
Sbjct: 84  NVDENRDIPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKSQMTAFIDQQL 132


>gi|159903670|ref|YP_001551014.1| Thiol-disulfide isomerase and thioredoxin [Prochlorococcus marinus
           str. MIT 9211]
 gi|159888846|gb|ABX09060.1| Thiol-disulfide isomerase and thioredoxin [Prochlorococcus marinus
           str. MIT 9211]
          Length = 148

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ EVL+   PV+VDFWA WC PC  ++PI+D+I+ +   K+K+ KL+ +E+  +
Sbjct: 48  VTDSSFEQEVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKDFEGKIKVCKLNTDENPNV 107

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 108 ASQYGIRSIPTLMIFKGGQKVDTVV-GAVPKATLSGTISKHI 148


>gi|197116802|ref|YP_002137229.1| thioredoxin [Geobacter bemidjiensis Bem]
 gi|197086162|gb|ACH37433.1| thioredoxin [Geobacter bemidjiensis Bem]
          Length = 109

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+          +F+ EVL+ + PV+VDFWA+WC PC  ++P+ID IA E   ++K+ K+
Sbjct: 1   MASENVHTFTDDNFEKEVLQSNIPVLVDFWATWCAPCKAIAPLIDTIASEYDGRIKVGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++     +Y +  IPT+IL KDGKV+D+++ GA  ++ +   I   +
Sbjct: 61  NVDDNPGTPAKYGVRGIPTVILLKDGKVVDQVV-GAIPKAQLEALIKKAL 109


>gi|145630610|ref|ZP_01786389.1| thioredoxin [Haemophilus influenzae R3021]
 gi|144983736|gb|EDJ91186.1| thioredoxin [Haemophilus influenzae R3021]
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+  + PV++DFWA WC PC  ++P++D++A E A KVKI K+++
Sbjct: 1   MSEVLHINDADFESVVVNSNIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA +++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALAKTQLANFINQHI 107


>gi|135769|sp|P09857|THIO_CHRVI RecName: Full=Thioredoxin; Short=Trx
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + V   SF+ EV +  +PV+VD+WA WC PC   +P+ D+IADE A +VK  K + +E
Sbjct: 3   SIVHVTDDSFEEEVXKSPDPVLVDYWADWCGPCKMXAPVXDEIADEYAGRVKXAKXNXDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +     RY    IPTL+LF+ G+V    + GA S+S +  ++ S 
Sbjct: 63  NPNTPPRYGXRGIPTLMLFRGGEVEATKV-GAVSKSQLTAFLDSN 106


>gi|332994629|gb|AEF04684.1| thioredoxin [Alteromonas sp. SN2]
          Length = 108

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++    F+++V+    PV+VDFWA WC PC  ++PI++++A+E   K+ + KL+
Sbjct: 1   MSDKIIQLSDDKFEADVINAEGPVLVDFWAEWCGPCKMIAPILEEVANEFEGKLTVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E++E   +Y I  IPTL+LFK+G V    + GA S++ + E++   +
Sbjct: 61  VDENNETPPKYGIRGIPTLLLFKNGNVAATKV-GALSKTQLAEFLNENL 108


>gi|17545907|ref|NP_519309.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum
           GMI1000]
 gi|17428202|emb|CAD14890.1| probable thioredoxin 1 (redox factor) protein [Ralstonia
           solanacearum GMI1000]
 gi|299067240|emb|CBJ38437.1| thioredoxin [Ralstonia solanacearum CMR15]
          Length = 108

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+++VL+   PV+VDFWA WC PC  ++PI+D+++ +  DKV+I KL+
Sbjct: 1   MSEQIKYVSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGDKVQIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E++ +  ++ I  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 61  VDENAGVPAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|148827234|ref|YP_001291987.1| thioredoxin [Haemophilus influenzae PittGG]
 gi|148718476|gb|ABQ99603.1| thioredoxin [Haemophilus influenzae PittGG]
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+    PV++DFWA WC PC  ++P++D++A E A KVKI K+++
Sbjct: 1   MSQVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA +++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALAKTQLANFINQHI 107


>gi|27375862|ref|NP_767391.1| thioredoxin C-1 [Bradyrhizobium japonicum USDA 110]
 gi|27349000|dbj|BAC46016.1| thioredoxin C-1 [Bradyrhizobium japonicum USDA 110]
          Length = 106

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F++EVL+ + PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MAVGKVSDTDFEAEVLKANGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  ESPKTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWITSAV 106


>gi|67924828|ref|ZP_00518225.1| Thioredoxin [Crocosphaera watsonii WH 8501]
 gi|67853315|gb|EAM48677.1| Thioredoxin [Crocosphaera watsonii WH 8501]
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A++V   +F ++VL+   PV+VDFWA WC PC  ++P++++IAD+ A +VK+ KL+ +E
Sbjct: 3   AAVQVTDGTFKADVLDSDVPVLVDFWAPWCGPCRMVAPVVEEIADQYAGQVKVVKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 63  NPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLASTLEKYL 107


>gi|294508688|ref|YP_003572747.1| Thioredoxin [Salinibacter ruber M8]
 gi|294345017|emb|CBH25795.1| Thioredoxin [Salinibacter ruber M8]
          Length = 114

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 73/111 (65%), Gaps = 5/111 (4%)

Query: 1   MS----ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITK 56
           M+     + +   +F+ EV+    PV+VDFWA+WC PC +++PI++++ADE   + KI K
Sbjct: 1   MAESANVITLTDDNFEDEVIGADQPVLVDFWATWCGPCRQIAPIVEELADEYEGQAKIGK 60

Query: 57  LDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +D++E+ + +  Y + SIPTL+ FKDG+  ++++ GA+ +  + E + + +
Sbjct: 61  VDVDENPQTAQEYGVRSIPTLLFFKDGEAQEQVV-GAAGKQPLKENLEALL 110


>gi|296136199|ref|YP_003643441.1| thioredoxin [Thiomonas intermedia K12]
 gi|294340434|emb|CAZ88815.1| Thioredoxin 1 (TRX1) (TRX) [Thiomonas sp. 3As]
 gi|295796321|gb|ADG31111.1| thioredoxin [Thiomonas intermedia K12]
          Length = 109

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+       +   F+ +VL+   PV+VDFWA WC PC  ++P +D++A E   K+ I K+
Sbjct: 1   MASELIKHTNDADFEQDVLKSGVPVLVDFWAEWCGPCRMIAPTLDEMASEYQGKLAIMKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+  I  ++ I  IPTL+LFK+G++    + GA+S+S +  ++ + +
Sbjct: 61  NVDENRSIPAKFGIRGIPTLLLFKNGELAGNKV-GAASKSQLTAFVDAHL 109


>gi|330951205|gb|EGH51465.1| thioredoxin [Pseudomonas syringae Cit 7]
          Length = 109

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL
Sbjct: 1   MSSDLIKHVTDATFEAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDEIASTYEGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ +   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQDTPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 109


>gi|127511272|ref|YP_001092469.1| thioredoxin [Shewanella loihica PV-4]
 gi|126636567|gb|ABO22210.1| thioredoxin [Shewanella loihica PV-4]
          Length = 108

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 76/109 (69%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+   PV+VDFWA WC PC  ++PI+DD+ADE A KV I KL+
Sbjct: 1   MSDKIITLSDDSFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVADEYAGKVTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL+LFK+G++ D  + GA S++ + E+I +++
Sbjct: 61  VDQNNASPAKYGVRGIPTLLLFKNGELADTKV-GALSKTQLKEFIDAQL 108


>gi|160931597|ref|ZP_02078992.1| hypothetical protein CLOLEP_00429 [Clostridium leptum DSM 753]
 gi|156869468|gb|EDO62840.1| hypothetical protein CLOLEP_00429 [Clostridium leptum DSM 753]
          Length = 105

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++  ++F SEV E    V++DFWASWC PC  +SPI+D+IA+E    VK+ K++++
Sbjct: 1   MAVIELTKQNFQSEVAESKEKVLIDFWASWCGPCRMVSPIVDEIAEESPAGVKVCKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E  E++ ++Q+ SIPTL++ KDGK +   + GA  +  I++ I   
Sbjct: 61  EQPELAQQFQVMSIPTLLVMKDGKPVASSV-GARPKQFIVKMIEEA 105


>gi|145597089|ref|YP_001161386.1| thioredoxin [Salinispora tropica CNB-440]
 gi|145306426|gb|ABP57008.1| thioredoxin [Salinispora tropica CNB-440]
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V   SF +EVL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I++
Sbjct: 3   ATKSVTDASFTTEVLKSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMGDQVTIVKLNIDD 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  Y+I S+PTL +FKDGK + + + GA  + ++++ I S +
Sbjct: 63  NPETARTYRIMSVPTLTVFKDGKPV-QSIAGAKPKGELVKLIQSAL 107


>gi|325274689|ref|ZP_08140736.1| thioredoxin [Pseudomonas sp. TJI-51]
 gi|324100177|gb|EGB97976.1| thioredoxin [Pseudomonas sp. TJI-51]
          Length = 109

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+   PV+VD+WA WC PC  ++P++DDIA     K+ + KL
Sbjct: 1   MSSDLIKHVTDATFEAEVLQAQGPVLVDYWAEWCGPCKMIAPVLDDIASTYEGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDDNQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDAHL 109


>gi|188996320|ref|YP_001930571.1| thioredoxin [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931387|gb|ACD66017.1| thioredoxin [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 105

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + V+  +F+ EVL    PV+VDFWA WC PC  ++PI++++A EL  K K+ K++
Sbjct: 1   MAGKVISVNESNFEQEVLNSDVPVLVDFWAPWCGPCRLIAPIVEELAVELEGKAKVVKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +E+  ++ +Y I +IPT+++FK+G+V+D  + G  S+  +   +
Sbjct: 61  TDENPNLAMKYGIRAIPTIMVFKNGRVVDTKV-GVQSKEVLKALL 104


>gi|240849708|ref|YP_002971096.1| thioredoxin [Bartonella grahamii as4aup]
 gi|240266831|gb|ACS50419.1| thioredoxin [Bartonella grahamii as4aup]
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 78/104 (75%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F+SEVL  S PVVVDFWA WC PC  ++PI+D+I+ E+ ++VKI K++I+
Sbjct: 1   MTCIKVDKDNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQNQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E+ E++T+Y + SIPTL++FK+G  I   M GA+S+  + EWI 
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGN-ISSNMVGATSKGRLSEWIK 103


>gi|152979502|ref|YP_001345131.1| thioredoxin [Actinobacillus succinogenes 130Z]
 gi|150841225|gb|ABR75196.1| thioredoxin [Actinobacillus succinogenes 130Z]
          Length = 107

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+        SF+++VL+   PV++DFWA WC PC  + PI++++A E  DKVKI K++I
Sbjct: 1   MAEVFHSTDASFEADVLKADVPVLLDFWAPWCGPCRMVGPILEELAAEYGDKVKIVKINI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+     ++ + SIPTL+LFKDGKV+   + GA  ++ +  ++   +
Sbjct: 61  DENQGTPAQFGVRSIPTLLLFKDGKVVGTQV-GALPKNQLANFVNQAL 107


>gi|89093776|ref|ZP_01166722.1| thioredoxin [Oceanospirillum sp. MED92]
 gi|89081906|gb|EAR61132.1| thioredoxin [Oceanospirillum sp. MED92]
          Length = 108

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+ +VL+    V+VD+WA WC PC  ++P++++IA E  D++KI KL+
Sbjct: 1   MSENIVNVTDASFEEDVLKAEGAVLVDYWAEWCGPCKMIAPVLEEIAKEYGDQLKICKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+SE   ++ I  IPTL+LFK G V    + GA S+S +  +I + +
Sbjct: 61  IDENSETPPKFGIRGIPTLMLFKGGNVEATKV-GALSKSQLAAFIEANL 108


>gi|219555761|ref|ZP_03534837.1| thioredoxin trxC [Mycobacterium tuberculosis T17]
          Length = 121

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 8   ATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDT 67

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++  +
Sbjct: 68  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLREL 108


>gi|311693120|gb|ADP95993.1| thioredoxin [marine bacterium HP15]
          Length = 114

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+ +VL+   PV+VD+WA WC PC  ++P++++IADE   K+K+ KL+
Sbjct: 7   MSGNIVNVTDASFEQDVLQSDVPVLVDYWAEWCGPCKMIAPVLEEIADEYDGKLKVCKLN 66

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   ++ I  IPTL+LFK+G V    + GA S+S +  ++ S +
Sbjct: 67  IDENEQTPPKFNIRGIPTLMLFKNGNVDATKV-GALSKSQLAAFLDSNL 114


>gi|229845482|ref|ZP_04465611.1| thioredoxin [Haemophilus influenzae 6P18H1]
 gi|319775023|ref|YP_004137511.1| thioredoxin [Haemophilus influenzae F3047]
 gi|329123071|ref|ZP_08251641.1| thioredoxin [Haemophilus aegyptius ATCC 11116]
 gi|229811585|gb|EEP47285.1| thioredoxin [Haemophilus influenzae 6P18H1]
 gi|317449614|emb|CBY85820.1| thioredoxin [Haemophilus influenzae F3047]
 gi|327471626|gb|EGF17068.1| thioredoxin [Haemophilus aegyptius ATCC 11116]
          Length = 107

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+    PV++DFWA WC PC  ++P++D++A E A KVKI K+++
Sbjct: 1   MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA +++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALAKTQLANFINQHI 107


>gi|94970094|ref|YP_592142.1| thioredoxin [Candidatus Koribacter versatilis Ellin345]
 gi|94552144|gb|ABF42068.1| thioredoxin [Candidatus Koribacter versatilis Ellin345]
          Length = 109

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    ++V   +FD  VL+   PV++DFWA+WC PC  L+PI+D++A     KV + K+
Sbjct: 1   MATDTIVEVTDSNFDQLVLKSDKPVLIDFWAAWCGPCKALAPIVDEVAQSYNGKVTVGKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           D+++++   +RY I  IPTL+LFK G+V ++++ G  ++  I + I   +
Sbjct: 61  DVDKNAATPSRYGIRGIPTLLLFKGGQVQEQIV-GYVARERIEQAINKAL 109


>gi|319406426|emb|CBI80066.1| thioredoxin [Bartonella sp. 1-1C]
          Length = 107

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 80/107 (74%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D+ +F++EVL    PVVVDFWA WC PC  ++PI+D+IA E+  ++K+ K++I+
Sbjct: 1   MTCIKIDSSNFENEVLTSPLPVVVDFWAEWCGPCKSIAPILDEIATEMQSQIKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++T+Y I SIPTL++F +GKV    + GA+S+  ++EWI + +
Sbjct: 61  ENPDLATQYGIRSIPTLLMFTNGKVSSNKV-GATSKGHLVEWIKNSL 106


>gi|220905793|ref|YP_002481104.1| thioredoxin [Cyanothece sp. PCC 7425]
 gi|219862404|gb|ACL42743.1| thioredoxin [Cyanothece sp. PCC 7425]
          Length = 107

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/108 (42%), Positives = 74/108 (68%), Gaps = 2/108 (1%)

Query: 1   MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MSA+ +V   +F  EVLE   PV+VDFWA WC PC  ++P++D++A +   +VK+ KL+ 
Sbjct: 1   MSAVAQVTNATFRQEVLEDRLPVLVDFWAPWCGPCRMVAPVVDEVASQYEGQVKVVKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E  EI+++Y I SIPTLILFK+G+ +DR++ GA  ++ +   +   +
Sbjct: 61  DEHPEIASQYGIRSIPTLILFKEGQAVDRVV-GAVPKTTLSSTLEKYL 107


>gi|170724195|ref|YP_001751883.1| thioredoxin [Pseudomonas putida W619]
 gi|169762198|gb|ACA75514.1| thioredoxin [Pseudomonas putida W619]
          Length = 109

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+   PV+VD+WA WC PC  ++P++DDIA     K+ + KL
Sbjct: 1   MSSDLIKHVTDATFEAEVLQAQGPVLVDYWAEWCGPCKMIAPVLDDIATTYEGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDDNQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDAHL 109


>gi|118620069|ref|YP_908401.1| thioredoxin TrxC [Mycobacterium ulcerans Agy99]
 gi|118572179|gb|ABL06930.1| thioredoxin TrxC [Mycobacterium ulcerans Agy99]
          Length = 117

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF +EVL  + PV+VDFWA+WC PC  ++P++++IA E AD + + KLD++ 
Sbjct: 9   ATIEVSDASFSTEVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERADNLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++  +   V
Sbjct: 69  NPETARNFQVVSIPTMILFKDGEPVKRIV-GAKGKAALLRELSDAV 113


>gi|330817183|ref|YP_004360888.1| thioredoxin 1 [Burkholderia gladioli BSR3]
 gi|327369576|gb|AEA60932.1| thioredoxin 1 [Burkholderia gladioli BSR3]
          Length = 108

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     ++  SF+ +V+    PV++DFWA WC PC  ++PI+D+++ +  DK++I K++
Sbjct: 1   MSELIKHINDASFEQDVVRSDKPVLLDFWAEWCGPCKMIAPILDEVSKDYGDKLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    ++ +  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 61  VDDNTATPAKFGVRGIPTLILFKNGVVAAQKV-GALSKSQLTAFLDSHL 108


>gi|39998370|ref|NP_954321.1| thioredoxin [Geobacter sulfurreducens PCA]
 gi|39985316|gb|AAR36671.1| thioredoxin [Geobacter sulfurreducens PCA]
 gi|307635165|gb|ADI86033.2| thioredoxin [Geobacter sulfurreducens KN400]
          Length = 109

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 72/110 (65%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L     +FDSEVL+   PV+VDFWA+WC PC  ++P+ID IADE   KVK+ K+
Sbjct: 1   MASDKVLTFSDDTFDSEVLKSPVPVLVDFWATWCAPCKAIAPVIDAIADEFDGKVKVGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++     +Y +  IPT+ILFK+GKV+D+++ GA  ++ +   I   +
Sbjct: 61  NVDDNPGTPGKYGVRGIPTVILFKEGKVVDQVV-GAVPKAQLEALIKKAL 109


>gi|256823807|ref|YP_003147770.1| thioredoxin [Kangiella koreensis DSM 16069]
 gi|256797346|gb|ACV28002.1| thioredoxin [Kangiella koreensis DSM 16069]
          Length = 108

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   +F++EVL    PV+VD+WA WC PC  ++PI++++A+    KVK+ KL+
Sbjct: 1   MSDKIVYLTDATFEAEVLNSDQPVLVDYWAEWCGPCKMIAPILNEVAEMYEGKVKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+SE   +Y I  IPTL+LFK G +    + GA S+S ++ +I S V
Sbjct: 61  IDENSETPPKYGIRGIPTLMLFKGGNIEATKV-GALSKSQLMAFIDSNV 108


>gi|294011637|ref|YP_003545097.1| thioredoxin 1 [Sphingobium japonicum UT26S]
 gi|292674967|dbj|BAI96485.1| thioredoxin 1 [Sphingobium japonicum UT26S]
          Length = 106

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF  +V+    PV+VDFWA WC PC  + P +++I+DELADKV I K++I+
Sbjct: 1   MATKAVTDLSFQQDVINADKPVLVDFWAEWCGPCKMIGPALEEISDELADKVVIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ +   RY +  IPT+ILFK+G+     + GA+ +S +  WI S
Sbjct: 61  ENPDAPGRYGVRGIPTMILFKNGEAAATKV-GAAPKSALKGWIES 104


>gi|196230444|ref|ZP_03129306.1| thioredoxin [Chthoniobacter flavus Ellin428]
 gi|196225374|gb|EDY19882.1| thioredoxin [Chthoniobacter flavus Ellin428]
          Length = 109

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 75/108 (69%), Gaps = 4/108 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + V   +FD+EVL+   PV+VDFWA WC PCV+LSP+ID+IA   A   K+ K+
Sbjct: 1   MANANVVTVTDANFDTEVLKSDKPVLVDFWAPWCGPCVQLSPVIDEIATAKAGSAKVAKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +++E+ +++ RY+I+SIP L+ FK+G+V  +++ G   +++I+  + S
Sbjct: 61  NVDENQQVAARYRINSIPALLFFKNGEVQGQLV-GRQPKTEIVAKLDS 107


>gi|157833855|pdb|1SRX|A Chain A, Three-Dimensional Structure Of Escherichia Coli
           Thioredoxin- S2 To 2.8 Angstroms Resolution
          Length = 108

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD+++++    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y    IPTL+LFK+G+V    + GA S+  + E++ + +
Sbjct: 64  PGTAPKYIERGIPTLLLFKNGEVAATKV-GALSKGQLKEFLDANL 107


>gi|83749757|ref|ZP_00946733.1| Thioredoxin [Ralstonia solanacearum UW551]
 gi|207723135|ref|YP_002253534.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum MolK2]
 gi|207743472|ref|YP_002259864.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum
           IPO1609]
 gi|300704441|ref|YP_003746044.1| thioredoxin [Ralstonia solanacearum CFBP2957]
 gi|83723577|gb|EAP70779.1| Thioredoxin [Ralstonia solanacearum UW551]
 gi|206588328|emb|CAQ35291.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum MolK2]
 gi|206594869|emb|CAQ61796.1| thioredoxin 1 (redox factor) protein [Ralstonia solanacearum
           IPO1609]
 gi|299072105|emb|CBJ43437.1| thioredoxin [Ralstonia solanacearum CFBP2957]
          Length = 108

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+++VL+   PV+VDFWA WC PC  ++PI+D+++ + ADKV+I KL+
Sbjct: 1   MSEQIKYVSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYADKVQIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E++ +  ++ I  IPTLILFK+G V  + + GA S+S +  ++ S +
Sbjct: 61  VDENAGVPAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDSHL 108


>gi|262276727|ref|ZP_06054520.1| thioredoxin [alpha proteobacterium HIMB114]
 gi|262223830|gb|EEY74289.1| thioredoxin [alpha proteobacterium HIMB114]
          Length = 107

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M ALKV  ++F+  +     PV+V F A WC PC  ++  ++++ADE++D++ I   DI+
Sbjct: 1   MPALKVTDENFEETIGNKDKPVLVKFGAEWCGPCKMIAGPLNELADEMSDQIVIGDHDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            S    T++ +  +PT++LFK G+V+D  + GA+S+ DI  WI S+V
Sbjct: 61  NSPNAPTKFGVRGVPTMLLFKGGEVVDSKV-GAASKEDIKTWINSKV 106


>gi|226940610|ref|YP_002795684.1| TrxA [Laribacter hongkongensis HLHK9]
 gi|226715537|gb|ACO74675.1| TrxA [Laribacter hongkongensis HLHK9]
          Length = 109

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    + V   SF+ EVL+   PV+VD+WA WC PC  ++PI+D++A E   K+K+ KL
Sbjct: 1   MSSELIVHVTDASFEEEVLKAQGPVLVDYWAEWCGPCKMIAPILDEVAREYDGKLKVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++     ++ I  IPTL++FKDG V+   + GA ++S +  +I S +
Sbjct: 61  NIDQNEATPPKFGIRGIPTLMIFKDGNVVATKV-GALAKSQLAAFIDSNI 109


>gi|187478869|ref|YP_786893.1| thioredoxin 1 [Bordetella avium 197N]
 gi|115423455|emb|CAJ49989.1| thioredoxin 1 [Bordetella avium 197N]
          Length = 114

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ +VL+ S PV+VD+WA+WC PC  ++PI++++A E A ++ + KL+
Sbjct: 7   MSEQIKNVSDASFEGDVLKSSQPVLVDYWAAWCGPCKMIAPILEEVASEYAGRLTVAKLN 66

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+   + +Y I  IPTL+LFKDG+     + GA S+S +  ++ S +
Sbjct: 67  VDENQGTAAKYGIRGIPTLMLFKDGQAAATKV-GALSKSQLTAFLDSAL 114


>gi|253699054|ref|YP_003020243.1| thioredoxin [Geobacter sp. M21]
 gi|251773904|gb|ACT16485.1| thioredoxin [Geobacter sp. M21]
          Length = 109

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+          +F+ EVL+ + PV+VDFWA+WC PC  ++P+ID +A E   ++K+ K+
Sbjct: 1   MASENVHTFTDDNFEKEVLQSNIPVLVDFWATWCAPCKAIAPLIDTVAAEYEGRIKVGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++     +Y +  IPT+IL KDGKV+D+++ GA  ++ +   I   +
Sbjct: 61  NVDDNPGTPAKYGVRGIPTVILLKDGKVVDQVV-GAIPKAQLEALIKKAL 109


>gi|121602565|ref|YP_989605.1| thioredoxin [Bartonella bacilliformis KC583]
 gi|120614742|gb|ABM45343.1| thioredoxin [Bartonella bacilliformis KC583]
          Length = 107

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+D  +F++EVL  S PVVVDFWA WC PC  ++PI+D+I+ E+  +VKI K+ I+
Sbjct: 1   MTCIKIDNSNFENEVLTSSIPVVVDFWAEWCGPCKMIAPILDEISAEMEGQVKIAKISID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++T+Y + SIPTL++FK+G  +   + GA+S+  + EWI   +
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGN-VSSNVVGATSKGRLCEWIKDNL 106


>gi|167042846|gb|ABZ07563.1| putative thioredoxin [uncultured marine microorganism
           HF4000_ANIW137J11]
          Length = 205

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
           A++V   +F+S + + +  V+VDFWA WC PC  ++P++++IADE  DKV I K++ +E+
Sbjct: 103 AIEVTDDTFESTIAD-NKLVLVDFWAPWCGPCRMVAPVLEEIADEHGDKVTIAKVNTDEN 161

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
             +++++ I SIPT++LFKDG+ ID+M+ GA  +  I+  +   
Sbjct: 162 QAVASKHGIMSIPTMMLFKDGEKIDQMV-GALPKPQIMAKLEPH 204


>gi|149278872|ref|ZP_01885007.1| thioredoxin [Pedobacter sp. BAL39]
 gi|149230491|gb|EDM35875.1| thioredoxin [Pedobacter sp. BAL39]
          Length = 105

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+   PV+VDFWA WC PC  + P++D+I+ E   K  + K++++
Sbjct: 1   MA-LEITDANFEELVLKSDKPVLVDFWAEWCGPCRMVGPVVDEISKEYDGKAIVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +IST++ I +IP L+ FK+G+V+D+ + GA  +S + + +  ++
Sbjct: 60  NNPQISTQFGIRNIPALLYFKNGEVVDKQV-GAVPKSVLAQKLEKQL 105


>gi|145633709|ref|ZP_01789435.1| thioredoxin [Haemophilus influenzae 3655]
 gi|229847001|ref|ZP_04467107.1| thioredoxin [Haemophilus influenzae 7P49H1]
 gi|144985469|gb|EDJ92290.1| thioredoxin [Haemophilus influenzae 3655]
 gi|229810085|gb|EEP45805.1| thioredoxin [Haemophilus influenzae 7P49H1]
          Length = 107

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+    PV++DFWA WC PC  ++P++D++A E A KVKI K+++
Sbjct: 1   MSEVLHINDVDFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA  ++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALPKTQLANFINQHI 107


>gi|146278982|ref|YP_001169141.1| thioredoxin [Rhodobacter sphaeroides ATCC 17025]
 gi|145557223|gb|ABP71836.1| thioredoxin [Rhodobacter sphaeroides ATCC 17025]
          Length = 106

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV +   PVVVDFWA WC PC ++ P ++++++E A KVKI K++++
Sbjct: 1   MSTVPVTDATFDTEVRKSDVPVVVDFWAEWCGPCRQIGPALEELSNEYAGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E      +  IP L LFKDG+V+   + GA+ ++ +  WI S +
Sbjct: 61  ENPESPAMLGVRGIPALFLFKDGQVVSNKV-GAAPKAALASWIASAL 106


>gi|119475469|ref|ZP_01615822.1| thioredoxin [marine gamma proteobacterium HTCC2143]
 gi|119451672|gb|EAW32905.1| thioredoxin [marine gamma proteobacterium HTCC2143]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+S+VL    PV+VDFWA WC PC  ++P+I +IA+E   K+K+ K+D
Sbjct: 1   MSDNIVHVTDASFESDVLGADVPVLVDFWAEWCGPCKMIAPVIAEIANEYEGKLKVCKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ ++E + ++ I  IPTL++FK+G      + GA S++ + E+I S +
Sbjct: 61  VDANTETAPKFGIRGIPTLMIFKNGNAEATKV-GALSKTQLTEFITSAL 108


>gi|73748494|ref|YP_307733.1| thioredoxin [Dehalococcoides sp. CBDB1]
 gi|289432542|ref|YP_003462415.1| thioredoxin [Dehalococcoides sp. GT]
 gi|73660210|emb|CAI82817.1| thioredoxin [Dehalococcoides sp. CBDB1]
 gi|288946262|gb|ADC73959.1| thioredoxin [Dehalococcoides sp. GT]
          Length = 107

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++  +SF +EVL+   PV+VDFWA WC PC  ++PIID ++ + A K K  KL+++E+
Sbjct: 2   VMEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYAGKFKFCKLNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +T+Y++ SIPTL+ FK G+V D M+ GA  +S + + I   +
Sbjct: 62  KTTATQYRVMSIPTLLFFKGGQVAD-MVVGAVPESALSQKIDQLI 105


>gi|11465691|ref|NP_053835.1| thioredoxin [Porphyra purpurea]
 gi|1729948|sp|P51225|THIO_PORPU RecName: Full=Thioredoxin; Short=Trx
 gi|1276691|gb|AAC08111.1| thioredoxin [Porphyra purpurea]
          Length = 107

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  +V   SF  EV+    PV+VDFWA WC PC  +SP++D IA+E    +K+ K++ +
Sbjct: 1   MSVSQVTDASFKQEVINNDLPVLVDFWAPWCGPCRMVSPVVDAIAEEYESSIKVVKINTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++  I+  Y I SIPTL++FK G+ +D ++ GA  +S +   +   +
Sbjct: 61  DNPTIAAEYGIRSIPTLMIFKSGERVDTVI-GAVPKSTLESTLNKYI 106


>gi|221236589|ref|YP_002519026.1| thioredoxin [Caulobacter crescentus NA1000]
 gi|220965762|gb|ACL97118.1| thioredoxin [Caulobacter crescentus NA1000]
          Length = 127

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +F+++VL+ S PV+VDFWA WC PC +++P ++ +++ELAD V I K++IE
Sbjct: 18  MSTVAVTDATFEADVLKSSKPVLVDFWAEWCGPCKQIAPALEQLSEELADVVTIAKVNIE 77

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +S    +RY +  IPT++LF+DG++    + GA  +  I+EW+   
Sbjct: 78  DSPTTPSRYGVRGIPTMMLFRDGQMTSMKV-GAMPKQKILEWLNEA 122


>gi|86148270|ref|ZP_01066566.1| thioredoxin [Vibrio sp. MED222]
 gi|85833966|gb|EAQ52128.1| thioredoxin [Vibrio sp. MED222]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   ++ I KL+
Sbjct: 1   MSDKILQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGQLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|117617736|ref|YP_854623.1| thioredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117559143|gb|ABK36091.1| thioredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++V++    V+VDFWA WC PC  ++PI++++A E A +V + KL+
Sbjct: 1   MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILNEVAQEYAGRVTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ +++   +Y I  IPTL+LFK+G+V    + GA S++ + E++   +
Sbjct: 61  IDHNADTPPKYGIRGIPTLLLFKNGEVAATKV-GALSKTQLKEFLDGNL 108


>gi|90414228|ref|ZP_01222208.1| putative thioredoxin [Photobacterium profundum 3TCK]
 gi|90324675|gb|EAS41216.1| putative thioredoxin [Photobacterium profundum 3TCK]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 71/105 (67%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++   +FDS+V+  + PV+VDFWA WC PC  ++PI+D+IA+E   KV I KL+I+++
Sbjct: 5   IVQLTDATFDSDVVNAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGKVTIGKLNIDQN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 65  AATPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 108


>gi|115522487|ref|YP_779398.1| thioredoxin [Rhodopseudomonas palustris BisA53]
 gi|115516434|gb|ABJ04418.1| thioredoxin [Rhodopseudomonas palustris BisA53]
          Length = 106

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    FDSEVL  + PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MAVGKVSDADFDSEVLNATGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ ++ + +WI + V
Sbjct: 61  ESPKTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWISAAV 106


>gi|238027055|ref|YP_002911286.1| thioredoxin [Burkholderia glumae BGR1]
 gi|237876249|gb|ACR28582.1| Thioredoxin [Burkholderia glumae BGR1]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V+    PV++DFWA WC PC  ++PI+D+I+ E  DK+ I K++
Sbjct: 1   MSEQIKHISDTSFEQDVVRSDKPVLLDFWAEWCGPCKMIAPILDEISKEYGDKLTIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    RY +  IPTLILFK+G +  + + GA S+S +  ++ S +
Sbjct: 61  VDDNTATPARYGVRGIPTLILFKNGVLAAQKV-GALSKSQLTAFLDSHL 108


>gi|90420587|ref|ZP_01228494.1| thioredoxin [Aurantimonas manganoxydans SI85-9A1]
 gi|90335315|gb|EAS49068.1| thioredoxin [Aurantimonas manganoxydans SI85-9A1]
          Length = 106

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 70/105 (66%), Gaps = 2/105 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  K+DT +F ++VL    PVVVDFWA WC PC  ++P   +      D V+I K++I+
Sbjct: 1   MATTKIDTSNFQTDVLGSDKPVVVDFWAEWCGPCKMIAP-SLEEISNEMDNVRIAKVNID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ +I+ ++ + SIPTL++FK+G+  D M+ GA S+S +++WI  
Sbjct: 60  ENPDIAAQFGVRSIPTLMIFKNGEHADTMV-GAQSKSKLVDWINK 103


>gi|163797154|ref|ZP_02191109.1| Thioredoxin [alpha proteobacterium BAL199]
 gi|159177670|gb|EDP62223.1| Thioredoxin [alpha proteobacterium BAL199]
          Length = 106

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   SFD +VL+   PVVVDFWA WC PC  ++P +++IA+EL DKV + K++I+
Sbjct: 1   MVTVPVSDGSFDDDVLKSEKPVVVDFWAEWCGPCKMIAPALEEIANELGDKVTVAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +    Y +  IPTL+LFKDG+V    + GA  + D+  WI S +
Sbjct: 61  DNPKTPAAYGVRGIPTLMLFKDGQVAAMKI-GALPKGDLKAWIESSI 106


>gi|16127769|ref|NP_422333.1| thioredoxin [Caulobacter crescentus CB15]
 gi|13425273|gb|AAK25501.1| thioredoxin [Caulobacter crescentus CB15]
          Length = 110

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +F+++VL+ S PV+VDFWA WC PC +++P ++ +++ELAD V I K++IE
Sbjct: 1   MSTVAVTDATFEADVLKSSKPVLVDFWAEWCGPCKQIAPALEQLSEELADVVTIAKVNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +S    +RY +  IPT++LF+DG++    + GA  +  I+EW+   
Sbjct: 61  DSPTTPSRYGVRGIPTMMLFRDGQMTSMKV-GAMPKQKILEWLNEA 105


>gi|23015726|ref|ZP_00055494.1| COG0526: Thiol-disulfide isomerase and thioredoxins
           [Magnetospirillum magnetotacticum MS-1]
          Length = 104

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF++EVL+   PV+VDFWA WC PC +++P +++++ + ADK+ I K++I+E+   
Sbjct: 4   VTDSSFEAEVLKAPGPVLVDFWAEWCGPCRQIAPALEELSKDRADKITIAKINIDENPGT 63

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y +  IPTL++FK+G+V    + GA  +S + EW+ S +
Sbjct: 64  PGKYGVRGIPTLMIFKNGQVAATKI-GALPKSKLYEWVDSSL 104


>gi|328545809|ref|YP_004305918.1| Thiol-disulfide isomerase and thioredoxins [polymorphum gilvum
           SL003B-26A1]
 gi|326415549|gb|ADZ72612.1| Thiol-disulfide isomerase and thioredoxins [Polymorphum gilvum
           SL003B-26A1]
          Length = 106

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  K+   SF+++VL+ S PVVVDFWA WC PC  ++P +++I++E+A KVKI KL+I+
Sbjct: 1   MATSKITDASFEADVLKSSEPVVVDFWAEWCGPCKMIAPALEEISEEMAGKVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+  ++ +Y + SIP LILFK+G+ +   + GA+ +  I +WI + +
Sbjct: 61  ENQNMAMKYGVRSIPMLILFKNGEPMATQV-GAAPKGKIADWIKNAL 106


>gi|260775115|ref|ZP_05884014.1| thioredoxin [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609032|gb|EEX35192.1| thioredoxin [Vibrio coralliilyticus ATCC BAA-450]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++VL  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFEADVLNAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|289578238|ref|YP_003476865.1| thioredoxin [Thermoanaerobacter italicus Ab9]
 gi|297544518|ref|YP_003676820.1| thioredoxin [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289527951|gb|ADD02303.1| thioredoxin [Thermoanaerobacter italicus Ab9]
 gi|296842293|gb|ADH60809.1| thioredoxin [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F+ EV+    PV+VDFWA WC PC  ++PIID++A E   K+K+ K++++
Sbjct: 1   MAEVVITLENFEEEVVNSDVPVLVDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E +E++ +++I SIPT+ LFK+GK++D+++ GA  + D +++I   +
Sbjct: 61  EENELAMKFRIMSIPTIGLFKNGKMVDKII-GARPKGDFVKFIEKHL 106


>gi|304316705|ref|YP_003851850.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778207|gb|ADL68766.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 106

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +   +F  EV+  + PV+VDFWA WC PC  +SPII+++A++   KVK+ K++++
Sbjct: 1   MAEVTITKNNFQEEVVNSNIPVLVDFWAEWCGPCRMVSPIIEELANDYEGKVKVGKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +E++ +++I SIPT+ LFKDGK++D+++ GA  +SD  ++I   +
Sbjct: 61  DENELAVQFKIMSIPTIALFKDGKMVDKIV-GARPKSDFEDFINRNI 106


>gi|308803759|ref|XP_003079192.1| Thioredoxin (ISS) [Ostreococcus tauri]
 gi|116057647|emb|CAL53850.1| Thioredoxin (ISS) [Ostreococcus tauri]
          Length = 216

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 64/102 (62%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F+ +VL+    V+VDFWA WC PC  ++P+ID +A+E   K+K  KL+ +ES  I
Sbjct: 116 VTDATFEQDVLKSDTLVMVDFWAPWCGPCRMIAPLIDQLAEEYQGKLKAVKLNTDESPSI 175

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT++ FK G+ +D ++ GA  +S +   I   +
Sbjct: 176 ATEYGIRSIPTVMFFKGGQKVDTVI-GAVPKSTLTGTIEKYL 216


>gi|330831668|ref|YP_004394620.1| thiol-disulfide isomerase and thioredoxin [Aeromonas veronii B565]
 gi|328806804|gb|AEB52003.1| Thiol-disulfide isomerase and thioredoxin [Aeromonas veronii B565]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++V++    V+VDFWA WC PC  ++PI++++A E   +V + KL+
Sbjct: 1   MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILEEVAQEYEGRVTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ +S+   +Y I  IPTL+LFK+G+V    + GA S++ + E++   +
Sbjct: 61  IDHNSDTPPKYGIRGIPTLLLFKNGEVAATKV-GALSKTQLKEFLDGNL 108


>gi|296133423|ref|YP_003640670.1| thioredoxin [Thermincola sp. JR]
 gi|296032001|gb|ADG82769.1| thioredoxin [Thermincola potens JR]
          Length = 109

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L +   +F  +V      V+VDFWASWC PC  ++P+ID++A E   K+KI K+
Sbjct: 1   MAGDKVLTLTDANFGEQVENYEGVVLVDFWASWCGPCRMIAPVIDELAVEYDGKMKIGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+   + +Y + SIPTL++FK GK +DR++ G   + D+ + +   V
Sbjct: 61  NVDENRATAAKYGVMSIPTLLVFKGGKEVDRLV-GFRPKEDLKKELDKYV 109


>gi|52425681|ref|YP_088818.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307733|gb|AAU38233.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 107

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L     SF+++VL    PV+VD WA WC PC  ++PI+DD+A ELA KVKI K++I
Sbjct: 1   MSEVLHATDASFEADVLRSDVPVLVDLWAPWCGPCRMVAPILDDLAAELAGKVKIVKINI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+     ++ + SIPTL++FKDG+++   + GA  ++ +  ++   +
Sbjct: 61  DENQGTPAQFGVRSIPTLLMFKDGQLVGTQV-GALPKNQLAAFVEKNL 107


>gi|209693768|ref|YP_002261696.1| thioredoxin 1 [Aliivibrio salmonicida LFI1238]
 gi|208007719|emb|CAQ77832.1| thioredoxin 1 [Aliivibrio salmonicida LFI1238]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+  V+  S PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFEESVINASGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|53802748|ref|YP_112597.1| thioredoxin [Methylococcus capsulatus str. Bath]
 gi|53756509|gb|AAU90800.1| thioredoxin [Methylococcus capsulatus str. Bath]
          Length = 109

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 67/110 (60%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    L V    F+ +VL+   PV+VD+WA WC PC  ++PI+D+IA E   ++ + KL
Sbjct: 1   MSSDKILHVTDAEFEDKVLKAPGPVLVDYWAEWCGPCKMIAPILDEIAGEYEGRLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++     RY +  IPTL++FK G+V+   + GA ++S +  ++   +
Sbjct: 61  NIDDNPATPQRYGVRGIPTLMVFKGGEVVASKV-GALTKSQLAAFLEGNM 109


>gi|255281235|ref|ZP_05345790.1| thioredoxin [Bryantella formatexigens DSM 14469]
 gi|255268192|gb|EET61397.1| thioredoxin [Bryantella formatexigens DSM 14469]
          Length = 101

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 74/103 (71%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+AL +   +F  EVLE   PV+VDFWASWC PC  + PI++++++E    +K+ K++++
Sbjct: 1   MAALHITKDNFQKEVLESDKPVLVDFWASWCGPCRMVGPIVEEVSEE-RPDIKVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E+++ YQ+ SIPTL++ K+G++++R + GA  ++DI+  +
Sbjct: 60  EEQELASAYQVMSIPTLMVVKNGEIVNRSV-GAKPKADILAML 101


>gi|307313939|ref|ZP_07593554.1| thioredoxin [Sinorhizobium meliloti BL225C]
 gi|307322027|ref|ZP_07601405.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|306892316|gb|EFN23124.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|306899213|gb|EFN29851.1| thioredoxin [Sinorhizobium meliloti BL225C]
          Length = 107

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 51/107 (47%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  LKVDT +F  EVL  + PVVVDFWA WC PC  ++P +++I+ ELA KVK+ KL+I+
Sbjct: 1   MPTLKVDTSNFQKEVLNSAEPVVVDFWAPWCGPCKMIAPSLEEISTELAGKVKLVKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++  Y + SIP L +FK G+V D  + GA+ ++ +I WIL+ +
Sbjct: 61  ENPELTAEYGVRSIPMLAMFKAGEVADTKV-GAAPKTALISWILNAI 106


>gi|317153534|ref|YP_004121582.1| thioredoxin [Desulfovibrio aespoeensis Aspo-2]
 gi|316943785|gb|ADU62836.1| thioredoxin [Desulfovibrio aespoeensis Aspo-2]
          Length = 106

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 71/106 (66%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  ++   +FD EVL+   PV++DFWA WC PC  + P+ID++A E   +VKI K++++
Sbjct: 1   MAN-QITDGNFDQEVLQSDVPVLIDFWAPWCGPCRAMGPVIDELAVEYEGQVKIVKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+S    +Y I +IPTLILFK G+V+D+   GA S+S I E I  +
Sbjct: 60  ENSATPGKYGIRAIPTLILFKGGEVVDQS-TGAVSKSSIKEMITKK 104


>gi|15615660|ref|NP_243964.1| thioredoxin [Bacillus halodurans C-125]
 gi|10175720|dbj|BAB06817.1| thioredoxin [Bacillus halodurans C-125]
          Length = 104

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  ++F  E       V+ DFWA WC PC  ++P+++++  E+ DKVKI KLD++
Sbjct: 1   MAIVNVTDQTFAQET--SEGLVLADFWAPWCGPCKMIAPVLEELDGEMGDKVKIAKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E ++++ + SIPTLI+FKDG+V+D+ + G   +  + E +   +
Sbjct: 59  ENQETASKFNVMSIPTLIVFKDGQVVDQ-VTGFQPKDALAELLNKHL 104


>gi|326796183|ref|YP_004314003.1| thioredoxin [Marinomonas mediterranea MMB-1]
 gi|326546947|gb|ADZ92167.1| thioredoxin [Marinomonas mediterranea MMB-1]
          Length = 108

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L +    F SEVLE   PV+VDFWA WC PC  ++PI+ D+ADE   KVK+ KL+
Sbjct: 1   MSENILNITDAQFQSEVLESDVPVIVDFWAPWCGPCKMIAPILADVADEFEGKVKVVKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E++E + +Y +  IPTLI+ K G+V    + GA ++S +I+++ S +
Sbjct: 61  VDENTETAPKYNVRGIPTLIIVKGGEVAATKV-GAVTKSQLIDFVQSAL 108


>gi|330957135|gb|EGH57395.1| thioredoxin [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 109

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+ + PV+VD+WA WC PC  ++P++D+IA+    K+ I KL
Sbjct: 1   MSNEKIKHVTDATFEAEVLKATGPVLVDYWAEWCGPCKMIAPVLDEIANTYDGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 109


>gi|94496380|ref|ZP_01302957.1| thioredoxin [Sphingomonas sp. SKA58]
 gi|94424126|gb|EAT09150.1| thioredoxin [Sphingomonas sp. SKA58]
          Length = 106

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF  +V+    PV+VDFWA WC PC  + P +++I++EL DKV I K++I+
Sbjct: 1   MATKAVTDVSFQQDVIAADKPVLVDFWAEWCGPCKMIGPALEEISEELGDKVTIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ +   +Y +  IPT+ILFK+G+V    + GA+ +S +  WI S
Sbjct: 61  ENPDAPGKYGVRGIPTMILFKNGEVSATKV-GAAPKSALKGWIES 104


>gi|146337258|ref|YP_001202306.1| thioredoxin 1, redox factor [Bradyrhizobium sp. ORS278]
 gi|146190064|emb|CAL74056.1| thioredoxin 1, redox factor [Bradyrhizobium sp. ORS278]
          Length = 107

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 77/108 (71%), Gaps = 2/108 (1%)

Query: 1   MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+A+ KV    F+SEVL+   PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL++
Sbjct: 1   MAAVAKVSDADFESEVLKADGPVVVDFWAEWCGPCRMIAPALDEIASAMGDKVKIVKLNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +ES + +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  DESPKTASKYGVMSIPTLMVFKGGELASRQV-GAAPKAKLQQWISSAV 107


>gi|121607640|ref|YP_995447.1| thioredoxin [Verminephrobacter eiseniae EF01-2]
 gi|121552280|gb|ABM56429.1| thioredoxin [Verminephrobacter eiseniae EF01-2]
          Length = 111

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   SF+++VL+   PV+VD+WA WC PC  ++P++DD AD    +++I K+D++++
Sbjct: 6   IKHVSDASFEADVLQADTPVLVDYWAPWCGPCKMIAPLLDDAADRYQGRLQIVKMDVDDN 65

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   ++ I  +PTL+LFKDG+     + GA  ++ + E++  ++
Sbjct: 66  RQTPAKFGIRGVPTLMLFKDGQPAATQV-GALGRAQLTEFLDQQL 109


>gi|148262446|ref|YP_001229152.1| thioredoxin [Geobacter uraniireducens Rf4]
 gi|146395946|gb|ABQ24579.1| thioredoxin [Geobacter uraniireducens Rf4]
          Length = 109

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L     +F++ VL+   PV+VDFWA+WC PC  ++P+ID IADE   K+K+ K+
Sbjct: 1   MASEKVLTFTDDNFEAAVLQSDVPVLVDFWATWCAPCKAIAPLIDTIADEYDGKIKVGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++     +Y +  IPT+IL KDGKV+D+++ GA  ++ +   I   V
Sbjct: 61  NVDDNPGTPGKYGVRGIPTVILIKDGKVVDQVV-GAVPKAQLEALIKKAV 109


>gi|15640334|ref|NP_229961.1| thioredoxin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121591060|ref|ZP_01678373.1| thioredoxin [Vibrio cholerae 2740-80]
 gi|121729653|ref|ZP_01682130.1| thioredoxin [Vibrio cholerae V52]
 gi|147675356|ref|YP_001218576.1| thioredoxin [Vibrio cholerae O395]
 gi|153803142|ref|ZP_01957728.1| thioredoxin [Vibrio cholerae MZO-3]
 gi|153819602|ref|ZP_01972269.1| thioredoxin [Vibrio cholerae NCTC 8457]
 gi|153822823|ref|ZP_01975490.1| thioredoxin [Vibrio cholerae B33]
 gi|153827151|ref|ZP_01979818.1| thioredoxin [Vibrio cholerae MZO-2]
 gi|153831015|ref|ZP_01983682.1| thioredoxin [Vibrio cholerae 623-39]
 gi|227080520|ref|YP_002809071.1| thioredoxin [Vibrio cholerae M66-2]
 gi|229506897|ref|ZP_04396405.1| thioredoxin [Vibrio cholerae BX 330286]
 gi|229509270|ref|ZP_04398753.1| thioredoxin [Vibrio cholerae B33]
 gi|229512686|ref|ZP_04402154.1| thioredoxin [Vibrio cholerae TMA 21]
 gi|229516214|ref|ZP_04405662.1| thioredoxin [Vibrio cholerae RC9]
 gi|229520975|ref|ZP_04410396.1| thioredoxin [Vibrio cholerae TM 11079-80]
 gi|229524736|ref|ZP_04414141.1| thioredoxin [Vibrio cholerae bv. albensis VL426]
 gi|229527199|ref|ZP_04416592.1| thioredoxin [Vibrio cholerae 12129(1)]
 gi|229606410|ref|YP_002877058.1| thioredoxin [Vibrio cholerae MJ-1236]
 gi|254227020|ref|ZP_04920580.1| thioredoxin [Vibrio cholerae V51]
 gi|254286223|ref|ZP_04961182.1| thioredoxin [Vibrio cholerae AM-19226]
 gi|254851440|ref|ZP_05240790.1| thioredoxin [Vibrio cholerae MO10]
 gi|255744104|ref|ZP_05418058.1| thioredoxin [Vibrio cholera CIRS 101]
 gi|258620668|ref|ZP_05715705.1| thioredoxin [Vibrio mimicus VM573]
 gi|258623758|ref|ZP_05718716.1| thioredoxin [Vibrio mimicus VM603]
 gi|261210410|ref|ZP_05924704.1| thioredoxin reductase [Vibrio sp. RC341]
 gi|262161996|ref|ZP_06031013.1| thioredoxin [Vibrio cholerae INDRE 91/1]
 gi|262163842|ref|ZP_06031582.1| thioredoxin [Vibrio mimicus VM223]
 gi|262167973|ref|ZP_06035672.1| thioredoxin [Vibrio cholerae RC27]
 gi|262192567|ref|ZP_06050717.1| thioredoxin [Vibrio cholerae CT 5369-93]
 gi|262405029|ref|ZP_06081581.1| thioredoxin [Vibrio sp. RC586]
 gi|297581768|ref|ZP_06943690.1| thioredoxin [Vibrio cholerae RC385]
 gi|298500938|ref|ZP_07010740.1| thioredoxin [Vibrio cholerae MAK 757]
 gi|9654719|gb|AAF93480.1| thioredoxin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121547093|gb|EAX57228.1| thioredoxin [Vibrio cholerae 2740-80]
 gi|121628587|gb|EAX61066.1| thioredoxin [Vibrio cholerae V52]
 gi|124121333|gb|EAY40076.1| thioredoxin [Vibrio cholerae MZO-3]
 gi|125620456|gb|EAZ48830.1| thioredoxin [Vibrio cholerae V51]
 gi|126509858|gb|EAZ72452.1| thioredoxin [Vibrio cholerae NCTC 8457]
 gi|126519641|gb|EAZ76864.1| thioredoxin [Vibrio cholerae B33]
 gi|146317239|gb|ABQ21778.1| thioredoxin [Vibrio cholerae O395]
 gi|148873507|gb|EDL71642.1| thioredoxin [Vibrio cholerae 623-39]
 gi|149738948|gb|EDM53266.1| thioredoxin [Vibrio cholerae MZO-2]
 gi|150423638|gb|EDN15580.1| thioredoxin [Vibrio cholerae AM-19226]
 gi|227008408|gb|ACP04620.1| thioredoxin [Vibrio cholerae M66-2]
 gi|227012165|gb|ACP08375.1| thioredoxin [Vibrio cholerae O395]
 gi|229335207|gb|EEO00691.1| thioredoxin [Vibrio cholerae 12129(1)]
 gi|229338317|gb|EEO03334.1| thioredoxin [Vibrio cholerae bv. albensis VL426]
 gi|229341860|gb|EEO06861.1| thioredoxin [Vibrio cholerae TM 11079-80]
 gi|229346640|gb|EEO11610.1| thioredoxin [Vibrio cholerae RC9]
 gi|229350196|gb|EEO15148.1| thioredoxin [Vibrio cholerae TMA 21]
 gi|229353585|gb|EEO18522.1| thioredoxin [Vibrio cholerae B33]
 gi|229356002|gb|EEO20921.1| thioredoxin [Vibrio cholerae BX 330286]
 gi|229369065|gb|ACQ59488.1| thioredoxin [Vibrio cholerae MJ-1236]
 gi|254847145|gb|EET25559.1| thioredoxin [Vibrio cholerae MO10]
 gi|255738369|gb|EET93760.1| thioredoxin [Vibrio cholera CIRS 101]
 gi|258583955|gb|EEW08746.1| thioredoxin [Vibrio mimicus VM603]
 gi|258587183|gb|EEW11895.1| thioredoxin [Vibrio mimicus VM573]
 gi|260840468|gb|EEX67034.1| thioredoxin reductase [Vibrio sp. RC341]
 gi|262023506|gb|EEY42208.1| thioredoxin [Vibrio cholerae RC27]
 gi|262027822|gb|EEY46487.1| thioredoxin [Vibrio mimicus VM223]
 gi|262028374|gb|EEY47030.1| thioredoxin [Vibrio cholerae INDRE 91/1]
 gi|262031612|gb|EEY50200.1| thioredoxin [Vibrio cholerae CT 5369-93]
 gi|262348868|gb|EEY98009.1| thioredoxin [Vibrio sp. RC586]
 gi|297534175|gb|EFH73014.1| thioredoxin [Vibrio cholerae RC385]
 gi|297540442|gb|EFH76501.1| thioredoxin [Vibrio cholerae MAK 757]
 gi|327483176|gb|AEA77583.1| Thioredoxin [Vibrio cholerae LMA3894-4]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++V++ + PV+VDFWA WC PC  ++PI+D++ADE A K+ I KL+
Sbjct: 1   MSDKILQLTDDGFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEVADEYAGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    ++ I  IPTL+LFKDG V+   + GA S++ + E++ + +
Sbjct: 61  IDHNAGTPPKFGIRGIPTLLLFKDGSVVATKV-GALSKTQLKEFLDANL 108


>gi|315634767|ref|ZP_07890050.1| thioredoxin [Aggregatibacter segnis ATCC 33393]
 gi|315476525|gb|EFU67274.1| thioredoxin [Aggregatibacter segnis ATCC 33393]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 67/108 (62%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L     +F ++VL    PV++DFWA WC PC  ++PI+DD+A E   KVKI K++I
Sbjct: 1   MSEVLHSSDATFVADVLNSDVPVLLDFWAPWCGPCKMIAPILDDLAAEFDGKVKIVKINI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+LFKDGK +   + GA  ++ +  +I   +
Sbjct: 61  DDNQATPMQFGVRSIPTLLLFKDGKPVATQV-GALPKNQLAAFINQNI 107


>gi|258515471|ref|YP_003191693.1| thioredoxin [Desulfotomaculum acetoxidans DSM 771]
 gi|257779176|gb|ACV63070.1| thioredoxin [Desulfotomaculum acetoxidans DSM 771]
          Length = 105

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 75/105 (71%), Gaps = 2/105 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L+V+  +F+SEVL+ S PVVVDFWA WC PC  ++P+I+++A +   K KI KL+++
Sbjct: 1   MA-LEVNQSNFESEVLKASEPVVVDFWAPWCGPCRSMAPVIEELAKDFEGKAKIAKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+  ++ ++ + SIPTLI FKDGK +D ++ G + ++ I E I +
Sbjct: 60  ENQALAGQFGVMSIPTLIFFKDGKAVDTVV-GFTPKNKIAEKINA 103


>gi|302870717|ref|YP_003839354.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
 gi|302573576|gb|ADL49778.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V   SF S+VL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I+E
Sbjct: 3   ATKAVTDASFVSDVLQSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMKDQVTIVKLNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  Y++ S+PTL +FK+G+ + + + GA  + ++++ I S +
Sbjct: 63  NPETARAYRVMSVPTLTIFKNGQPV-QSIAGAKPKGELVKLIESAL 107


>gi|217075538|gb|ACJ86129.1| unknown [Medicago truncatula]
          Length = 175

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   S++  VL    PV+VDFWA WC PC  ++PIID++A E A K+   KL+ +E+  I
Sbjct: 73  VTDSSWNELVLASDTPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKISCYKLNTDENPNI 132

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T+Y I SIPT++ FK+G+     + GA  +S +   +   +
Sbjct: 133 ATKYGIRSIPTVLFFKNGEK-KESVIGAVPKSTLSTTVEKYI 173


>gi|270308018|ref|YP_003330076.1| thioredoxin [Dehalococcoides sp. VS]
 gi|270153910|gb|ACZ61748.1| thioredoxin [Dehalococcoides sp. VS]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++  +SF +EVL+   PV+VDFWA WC PC  ++PIID ++ +   K K  KL+++E+
Sbjct: 2   VMEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYEGKFKFCKLNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y++ SIPTL+ FK G+V D M+ GA  +S + + I   +
Sbjct: 62  KTTAAQYRVMSIPTLLFFKGGQVAD-MVVGAVPESALSQKIDQLI 105


>gi|119512335|ref|ZP_01631420.1| Thioredoxin [Nodularia spumigena CCY9414]
 gi|119462986|gb|EAW43938.1| Thioredoxin [Nodularia spumigena CCY9414]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A +V   SF  EVLE   PV+VDFWA WC PC  ++P++++IA +   ++K+ K++ +E
Sbjct: 3   AAEQVTDSSFKQEVLESDVPVLVDFWAPWCGPCRMVAPVVEEIAGQYEGQIKVVKVNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +++++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 63  NPQVASQYGIRSIPTLMIFKGGQKVD-MVVGAVPKTTLANTLEKYL 107


>gi|15594012|emb|CAC69854.1| putative thioredoxin m2 [Pisum sativum]
          Length = 180

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              +   ++ S V+E   PV+V+FWA WC PC  + PIID++A E   K K  KL+ +ES
Sbjct: 77  VASITDGNWQSLVIESDTPVLVEFWAPWCGPCRMMHPIIDELAKEYVGKFKCYKLNTDES 136

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +TRY I SIPT+I FKDG+  D ++ G+  ++ +I  I   +
Sbjct: 137 PSTATRYGIRSIPTVIFFKDGEKKDAII-GSVPKASLITTIEKFL 180


>gi|293604497|ref|ZP_06686902.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Achromobacter
           piechaudii ATCC 43553]
 gi|311105319|ref|YP_003978172.1| thioredoxin 1 [Achromobacter xylosoxidans A8]
 gi|292817078|gb|EFF76154.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Achromobacter
           piechaudii ATCC 43553]
 gi|310760008|gb|ADP15457.1| thioredoxin 1 [Achromobacter xylosoxidans A8]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SFD++VL+   PV+VD+WA+WC PC  ++PI++++A E A ++ I KL+
Sbjct: 1   MSDQIKNVSDASFDADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVATEYAGRLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+   +T+Y I  IPTL+LFKDG+     + GA S+S +  ++   +
Sbjct: 61  VDENQGTATKYGIRGIPTLMLFKDGQAAATKV-GALSKSQLTAFLDGAL 108


>gi|163803185|ref|ZP_02197067.1| transcription termination factor Rho [Vibrio sp. AND4]
 gi|159173006|gb|EDP57840.1| transcription termination factor Rho [Vibrio sp. AND4]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ +     ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDHNPGTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANI 108


>gi|237736442|ref|ZP_04566923.1| thioredoxin [Fusobacterium mortiferum ATCC 9817]
 gi|229421484|gb|EEO36531.1| thioredoxin [Fusobacterium mortiferum ATCC 9817]
          Length = 104

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 76/104 (73%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EVL+   PVVVDFWASWC PC  L+PI++++  ELA  VK+ K++I+
Sbjct: 1   MAILHITKENFEKEVLQSKEPVVVDFWASWCGPCKALAPILEEVDAELAGTVKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++ ++++ SIPTL+LFK+G+V+++ + G + + +++ +  
Sbjct: 61  EEEELAAQFRVMSIPTLLLFKNGEVVNKSV-GLAPKEEVVAFAK 103


>gi|113953145|ref|YP_730183.1| thioredoxin [Synechococcus sp. CC9311]
 gi|113880496|gb|ABI45454.1| thioredoxin [Synechococcus sp. CC9311]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E
Sbjct: 3   SATAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  ++++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 63  NPNVASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKATLSGTISKHL 107


>gi|82703204|ref|YP_412770.1| thioredoxin [Nitrosospira multiformis ATCC 25196]
 gi|82411269|gb|ABB75378.1| thioredoxin [Nitrosospira multiformis ATCC 25196]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS    +   +F++EVL+ + PV+VD+WA WC PC  ++PI+D++A E  D++K+ KL+I
Sbjct: 1   MSHTHHISDGNFETEVLQSTVPVLVDYWAEWCGPCKMIAPILDEVAKEYGDRLKVAKLNI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+     +Y I  IPTL+LFK+G +    + GA S+S +  +I S +
Sbjct: 61  DENQATPPKYGIRGIPTLMLFKNGNIEATKV-GALSKSQLTAFIDSHI 107


>gi|221632106|ref|YP_002521327.1| thioredoxin [Thermomicrobium roseum DSM 5159]
 gi|221156598|gb|ACM05725.1| thioredoxin [Thermomicrobium roseum DSM 5159]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 78/108 (72%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + V  ++F+ EV++   PV+VDFWA WC PC  ++PI+++IA+E A K+K+ K+++
Sbjct: 1   MAKPVTVSDETFEREVVQSPVPVLVDFWAPWCGPCRMIAPILEEIAEEKAGKLKVAKINV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ +++ ++ ISSIPTLIL+K GK ++R++ GA  +  +++ I   +
Sbjct: 61  DENMQVAMQHGISSIPTLILYKGGKPVERII-GAMPKQRLLQQIEKHL 107


>gi|78484472|ref|YP_390397.1| thioredoxin [Thiomicrospira crunogena XCL-2]
 gi|78362758|gb|ABB40723.1| thioredoxin [Thiomicrospira crunogena XCL-2]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +     +FDSEVL+   PV+VDFWA WC PC  ++PI+D++A E A K+K+ KL+
Sbjct: 1   MSDNMIATSDANFDSEVLQSDVPVLVDFWAEWCGPCKMIAPILDEVAGEYAGKIKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+     +Y +  IPTL+LFK+G  +D    GA S+S +  ++   +
Sbjct: 61  IDENPATPPKYGVRGIPTLVLFKNG-EVDATQVGALSKSQLCAFLDGNL 108


>gi|317132285|ref|YP_004091599.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
 gi|315470264|gb|ADU26868.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
          Length = 104

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+ V   +F++ VL+   PV++DFWA+WC PC  +SPI+D++++EL+  +++ K++++
Sbjct: 1   MAAITVTKDNFNTIVLQADKPVLIDFWATWCGPCRMVSPIVDELSEELSGTIEVAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E+++++ + SIPTL+L K G V    + GA  + DI + +
Sbjct: 61  EEPELASKFGVMSIPTLVLVKGGTVAATSV-GARPKEDIRQQL 102


>gi|121534191|ref|ZP_01666016.1| thioredoxin [Thermosinus carboxydivorans Nor1]
 gi|121307294|gb|EAX48211.1| thioredoxin [Thermosinus carboxydivorans Nor1]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/108 (26%), Positives = 67/108 (62%), Gaps = 2/108 (1%)

Query: 1   MSALKVDT-KSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS + + + + F+ +VL+   PV+VDFWA WC PC  + P ++ +A+  A +  + K+++
Sbjct: 1   MSVINITSREEFEEKVLKADKPVLVDFWAPWCGPCKMVGPEVEAVAETFAGRAYVVKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++   ++  YQ+  +PTL++ K+G+ ++R++ G   + ++   + + +
Sbjct: 61  DDQPGLANDYQVMGVPTLLVIKNGQEMNRIV-GYRPRQELSAALENAL 107


>gi|148555594|ref|YP_001263176.1| thioredoxin [Sphingomonas wittichii RW1]
 gi|148500784|gb|ABQ69038.1| thioredoxin [Sphingomonas wittichii RW1]
          Length = 106

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    +   SF  +V+    PV+VDFWA WC PC  + P +++IADEL +KV I K++I+
Sbjct: 1   MPTKAITDSSFHDDVISADKPVLVDFWAEWCGPCKMIGPALEEIADELGEKVTIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +   +Y +  IPT+ILFK+G+     + GA+ +S +  W+   +
Sbjct: 61  DNPDAPGKYGVRGIPTMILFKNGQPTATKV-GAAPKSQLKGWLEGEL 106


>gi|84393642|ref|ZP_00992393.1| thioredoxin [Vibrio splendidus 12B01]
 gi|84375710|gb|EAP92606.1| thioredoxin [Vibrio splendidus 12B01]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|322421448|ref|YP_004200671.1| thioredoxin [Geobacter sp. M18]
 gi|320127835|gb|ADW15395.1| thioredoxin [Geobacter sp. M18]
          Length = 109

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+          +F+ EVL+   PV+VDFWA+WC PC  ++P+ID +A E   +VK+ K+
Sbjct: 1   MASENVHTFTDDNFEKEVLQSEIPVLVDFWATWCAPCKAIAPLIDTVASEYEGRVKVGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++     +Y +  IPT+IL KDGKV+D+++ GA  ++ +   I   +
Sbjct: 61  NVDDNPATPGKYGVRGIPTVILIKDGKVLDQVV-GAIPKAQLEALIKKAL 109


>gi|87308247|ref|ZP_01090388.1| thioredoxin 1 [Blastopirellula marina DSM 3645]
 gi|87288804|gb|EAQ80697.1| thioredoxin 1 [Blastopirellula marina DSM 3645]
          Length = 106

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 71/106 (66%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  + +  +F++EVL+ + PV+VDFWA WC PC +L+P+ID ++ E     K+ K+D +
Sbjct: 1   MA-KEFNEANFETEVLQSTEPVLVDFWAPWCGPCRQLAPVIDQLSQEYESGAKVGKVDTD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++  ++ +Y I SIPT+++FKDG+V+ + M G   +S + E I S 
Sbjct: 60  QNPSLARKYGIQSIPTVMIFKDGEVVSQFM-GVQPKSKLQEAIDSA 104


>gi|317050788|ref|YP_004111904.1| thioredoxin [Desulfurispirillum indicum S5]
 gi|316945872|gb|ADU65348.1| thioredoxin [Desulfurispirillum indicum S5]
          Length = 109

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S L     SFDS+VL+ S PV+VD+WASWC PC  LSP ID +A+E   K K+ K++++E
Sbjct: 5   SVLNFTDASFDSDVLQSSTPVLVDYWASWCAPCRMLSPTIDALAEEFVGKAKVGKVNVDE 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + + S ++ + SIPT+++FK G+V+D+ + G  S+  +   +   +
Sbjct: 65  NPQTSQKFGVRSIPTIMIFKGGQVVDQAV-GVQSKEALKALLTKHL 109


>gi|307825387|ref|ZP_07655606.1| thioredoxin [Methylobacter tundripaludum SV96]
 gi|307733562|gb|EFO04420.1| thioredoxin [Methylobacter tundripaludum SV96]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S L V    F+  V++ + PV+VD+WA WC PC  ++PI+DDIA E A K+ + KL+I+E
Sbjct: 4   SVLHVGDSEFNETVIKAAGPVLVDYWAEWCGPCKMIAPILDDIAKEYAGKLTVVKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E    Y +  IPTL+LFKDG+V    + GA S+S +  ++ S +
Sbjct: 64  NPETPQHYGVRGIPTLMLFKDGEVEATKV-GALSKSQLAAFLDSNI 108


>gi|319896494|ref|YP_004134687.1| thioredoxin [Haemophilus influenzae F3031]
 gi|317431996|emb|CBY80344.1| thioredoxin [Haemophilus influenzae F3031]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+    PV++DFWA WC PC  ++P++D++  E A KVKI K+++
Sbjct: 1   MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELVSEFAGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA +++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALAKTQLANFINQHI 107


>gi|332975615|gb|EGK12504.1| thioredoxin [Psychrobacter sp. 1501(2011)]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS         +FD +V +   PV+VDFWA+WC PC  ++PI+++IA++   KVKI K+D
Sbjct: 1   MSDLITNTTDANFDQDVAQSDVPVLVDFWAAWCGPCKAIAPILEEIANDYNGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+ E ++R+ I SIPTL++FK G+ +D  + G   ++D+   +   +
Sbjct: 61  VDENPETASRFGIRSIPTLMVFKGGEKVDT-VMGLQPKADLAALLDKHL 108


>gi|317403446|gb|EFV83957.1| thioredoxin [Achromobacter xylosoxidans C54]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SFD++VL+   PV+VD+WA+WC PC  ++PI++++A E A ++ I KL+
Sbjct: 1   MSDQIKNVSDASFDADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVATEYAGRLTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+   + +Y I  IPTL+LFKDG+     + GA S+S +  ++   +
Sbjct: 61  VDENQGTAAKYGIRGIPTLMLFKDGQAAATKV-GALSKSQLTAFLDGAL 108


>gi|242089607|ref|XP_002440636.1| hypothetical protein SORBIDRAFT_09g004370 [Sorghum bicolor]
 gi|241945921|gb|EES19066.1| hypothetical protein SORBIDRAFT_09g004370 [Sorghum bicolor]
          Length = 367

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDI 59
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+P+ +      +  D V I  LD 
Sbjct: 150 SVVVLTPETFDSIVLDETKDVLVEFYAPWCGHCKHLAPVYEKLASVFKQDDGVVIANLDA 209

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ ++++ +Y +S  PTL  F  G        G     D +++I  +
Sbjct: 210 DKHTDLAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVKFINEK 256



 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +    F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 33  VVALTEADFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 91

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   G  S   + E++ S 
Sbjct: 92  EHKGLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSVEALAEYVNSE 137


>gi|126030712|pdb|2I4A|A Chain A, Crystal Structure Of Thioredoxin From The Acidophile
           Acetobacter Aceti
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 66/104 (63%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L V   SFD +VL+ S  V+VDFWA WC PC  + P + +I  E A KV + K++I+++
Sbjct: 4   TLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
            E    YQ+ SIPTL+L +DGKVID+ + GA  +S +  W+ S 
Sbjct: 64  PETPNAYQVRSIPTLMLVRDGKVIDKKV-GALPKSQLKAWVESA 106


>gi|330900036|gb|EGH31455.1| thioredoxin [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330977253|gb|EGH77209.1| thioredoxin [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 109

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 67/110 (60%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+   PV+VD+WA WC PC  ++P++D+IA     K+ + KL
Sbjct: 1   MSSDLIKHVTDATFEAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDEIAGTYEGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++ E   ++ +  IPTL+LFK G V    + GA S+S +  ++ + +
Sbjct: 61  NIDQNPETPAKHGVRGIPTLMLFKGGNVEATKV-GALSKSQLAAFLDANI 109


>gi|158337952|ref|YP_001519128.1| thioredoxin [Acaryochloris marina MBIC11017]
 gi|158308193|gb|ABW29810.1| thioredoxin [Acaryochloris marina MBIC11017]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 76/106 (71%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S   ++  +F +EVLE   PV+VDFWA WC PC  + PI+DDIA +  D+VK+ K +++E
Sbjct: 3   STTAINDTTFTAEVLESQQPVLVDFWAPWCGPCRMVGPIVDDIAADYQDQVKVVKFNVDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           SS++++RY I SIPTLI+FK+G+ ++ ++ GAS ++ ++E +   +
Sbjct: 63  SSDVASRYGIRSIPTLIVFKEGQPVETLV-GASPKATLVESLDKHL 107


>gi|319780203|ref|YP_004139679.1| thioredoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166091|gb|ADV09629.1| thioredoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 107

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F ++VL+ + PVVVDFWA WC PC  ++P ++DIA EL  KVKI KL+I+
Sbjct: 1   MATVKVDKSNFQADVLDANVPVVVDFWAEWCGPCKMIAPALEDIATELGAKVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++ ++ + SIPTL++FK G++ D  + GA+ ++ +  WI   +
Sbjct: 61  ENPELAAQFGVRSIPTLMIFKGGEMADMKV-GAAPKTALSHWINGNL 106


>gi|83313385|ref|YP_423649.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum
           magneticum AMB-1]
 gi|82948226|dbj|BAE53090.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum
           magneticum AMB-1]
          Length = 118

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF++EVL+   PV+VDFWA WC PC +++P +++++ + ADK+ I K++I+E+   
Sbjct: 18  VTDSSFEAEVLKAPGPVLVDFWAEWCGPCRQIAPALEELSKDRADKITIAKINIDENPGT 77

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y +  IPTL++FK+G+V    + GA  +S + EW+ S +
Sbjct: 78  PGKYGVRGIPTLMIFKNGQVAATKI-GALPKSKLYEWVDSSL 118


>gi|149908490|ref|ZP_01897152.1| putative thioredoxin [Moritella sp. PE36]
 gi|149808324|gb|EDM68261.1| putative thioredoxin [Moritella sp. PE36]
          Length = 108

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   +FD++V+    PV+VDFWA WC PC  ++PI+ ++A+E A KV I KL+
Sbjct: 1   MSDKIIQLTDAAFDTDVINSELPVLVDFWAEWCGPCKMIAPILSEVAEEYAGKVIIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++S    ++ I  IPTL+LFK+G V    + GA S++ +  ++   +
Sbjct: 61  IDQNSGTPPKFGIRGIPTLLLFKNGAVAATKV-GALSKAQLQSFLDENL 108


>gi|114848857|gb|ABI83631.1| thioredoxin [Acetobacter aceti]
          Length = 108

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 68/108 (62%), Gaps = 3/108 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L V   SFD +VL+ S  V+VDFWA WC PC  + P + +I  E A KV + K++
Sbjct: 1   MSEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           I+++ E    YQ+ SIPTL+L +DGKVID+ + GA  +S +  W+ S 
Sbjct: 61  IDDNPETPNAYQVRSIPTLMLVRDGKVIDKKV-GALPKSQLKAWVESA 107


>gi|238020525|ref|ZP_04600951.1| hypothetical protein GCWU000324_00409 [Kingella oralis ATCC 51147]
 gi|237867505|gb|EEP68511.1| hypothetical protein GCWU000324_00409 [Kingella oralis ATCC 51147]
          Length = 109

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   +F++EVL+ S PV++DFWA WC PC  ++PI+D +A+E   KVKI K++
Sbjct: 1   MSDKIIHVTDATFEAEVLQSSVPVLLDFWAPWCGPCKMIAPILDQLAEEYDGKVKIAKMN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+  +  ++ I  IPT+I+FKDGK +   + GA ++  +  ++ + +
Sbjct: 61  VDENQGVPAQFGIRGIPTMIVFKDGKNVANKV-GALAKPQLEAFLNASI 108


>gi|134093952|ref|YP_001099027.1| thioredoxin [Herminiimonas arsenicoxydans]
 gi|133737855|emb|CAL60900.1| thioredoxin [Herminiimonas arsenicoxydans]
          Length = 108

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SFD++VL+   PV+VDFWA WC PC  ++PI++D+A E A K++I K+D
Sbjct: 1   MSENITHITDASFDTDVLKSDTPVLVDFWAEWCGPCKMIAPILEDVAKEYAGKIRIAKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +  I  ++ I  IPTLILFK+G    + + GA ++  +  +I S +
Sbjct: 61  VDANQAIPAKFGIRGIPTLILFKNGVPAAQKV-GALAKGQLTAFIDSNI 108


>gi|294789511|ref|ZP_06754747.1| thioredoxin [Simonsiella muelleri ATCC 29453]
 gi|294482591|gb|EFG30282.1| thioredoxin [Simonsiella muelleri ATCC 29453]
          Length = 109

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   +F++EVL+   PV++DFWA WC PC  ++P++D++A ELA +VKI K++
Sbjct: 1   MSDNIVHVTDATFETEVLQSEIPVLLDFWAPWCGPCKMIAPVLDELATELAGQVKIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  +  ++ +  IPTLI+FKDG+ +   + GA +++ +  ++ + +
Sbjct: 61  VDDNQAVPAQFGVRGIPTLIIFKDGQALATKV-GALAKNQLAAFVNASI 108


>gi|222147039|ref|YP_002547996.1| thioredoxin [Agrobacterium vitis S4]
 gi|221734029|gb|ACM34992.1| thioredoxin [Agrobacterium vitis S4]
          Length = 106

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/103 (46%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F++EVL+   PVVVDFWA WC PC  ++P +D+I+ E+A KVKI KL+I+
Sbjct: 1   MATVKVDASNFEAEVLQSVEPVVVDFWAEWCGPCKMIAPSLDEISTEMAGKVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA+ ++ +  WI
Sbjct: 61  ENPELAAKFGVRSIPTLAMFKGGEVADIKV-GAAPKTALSSWI 102


>gi|88797353|ref|ZP_01112943.1| thioredoxin [Reinekea sp. MED297]
 gi|88780222|gb|EAR11407.1| thioredoxin [Reinekea sp. MED297]
          Length = 108

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 72/108 (66%), Gaps = 3/108 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L V   SF+++VL   +PV+VD+WA WC PC  ++P+++++ADE A K+ + KL+
Sbjct: 1   MSENILNVTDDSFETDVLRNEHPVLVDYWAEWCGPCKMIAPVLEEVADEYAGKMVVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           I+++     +Y I  IPTL++FK G+V    + GA S+S ++E+I S 
Sbjct: 61  IDDNPNTPPKYGIRGIPTLMIFKGGEVAATKV-GALSKSQLLEFIQSN 107


>gi|253997392|ref|YP_003049456.1| thioredoxin [Methylotenera mobilis JLW8]
 gi|253984071|gb|ACT48929.1| thioredoxin [Methylotenera mobilis JLW8]
          Length = 108

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +VL+   PV+VD+WA WC PC  ++PI+D+I+ E A ++K+ KL+
Sbjct: 1   MSEHITHLSDASFEQDVLQSQIPVLVDYWAEWCGPCKMIAPILDEISKEYAGRIKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ +   +Y I  IPTL+LFK+G V    + GA S+S +  +I S +
Sbjct: 61  IDDNQQTPPKYGIRGIPTLMLFKNGNVEATKV-GALSKSQLTAFIDSNI 108


>gi|159045979|ref|YP_001534773.1| thioredoxin [Dinoroseobacter shibae DFL 12]
 gi|157913739|gb|ABV95172.1| thioredoxin [Dinoroseobacter shibae DFL 12]
          Length = 106

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  ++FD+EV +   PVVVDFWA WC PC ++ P +++++     KVKI K++++
Sbjct: 1   MATVAVTDETFDTEVTKSDIPVVVDFWAEWCGPCKQIGPALEELSVTFDGKVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L LFK+G+V+   + GA+ ++ +  WI   +
Sbjct: 61  ENPNAPAQMGVRGIPALFLFKNGEVVSNKV-GAAPKAALQSWIEESL 106


>gi|300310194|ref|YP_003774286.1| thioredoxin 1 [Herbaspirillum seropedicae SmR1]
 gi|300072979|gb|ADJ62378.1| thioredoxin 1 (redox factor) protein [Herbaspirillum seropedicae
           SmR1]
          Length = 108

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MSAL--KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS +   +   SF+++VL+   PV+VDFWA WC PC  ++PI++++A E   K++I KLD
Sbjct: 1   MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +  I  ++ I  IPTLILFK+G    + + GA ++  ++ +I S +
Sbjct: 61  VDANQAIPAKFGIRGIPTLILFKNGAAAAQKV-GALAKGQLVSFIDSNI 108


>gi|296167153|ref|ZP_06849560.1| thioredoxin [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295897475|gb|EFG77074.1| thioredoxin [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 117

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF +EVL  + PV+VDFWA+WC PC  ++P++++IA E A ++ + KLD++ 
Sbjct: 9   ATIEVSDASFSNEVLSSNKPVLVDFWATWCGPCKMVAPVLEEIASERAGQLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++  +   V
Sbjct: 69  NPVTARDFQVVSIPTMILFKDGQPVKRIV-GAKGKAALLRELSDAV 113


>gi|261250045|ref|ZP_05942622.1| thioredoxin reductase [Vibrio orientalis CIP 102891]
 gi|260939549|gb|EEX95534.1| thioredoxin reductase [Vibrio orientalis CIP 102891]
          Length = 108

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFDADVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 108


>gi|221133952|ref|ZP_03560257.1| thioredoxin [Glaciecola sp. HTCC2999]
          Length = 108

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +    F+++VL    PV+VDFWA WC PC  ++PI+ +IAD    KVKI KL+
Sbjct: 1   MSDKIITLSDDKFEADVLNAEGPVLVDFWAEWCGPCKMIAPILSEIADTYEGKVKIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E SE   ++ I  IPTL+LFKDG V    + GA S++ + E++   +
Sbjct: 61  VDEFSETPKKFGIRGIPTLLLFKDGNVAGTKV-GALSKAQLEEFLQENL 108


>gi|303241857|ref|ZP_07328352.1| thioredoxin [Acetivibrio cellulolyticus CD2]
 gi|302590632|gb|EFL60385.1| thioredoxin [Acetivibrio cellulolyticus CD2]
          Length = 109

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 74/110 (67%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   +F+ EVL+    V+VDFWA WC PC  + PI+D++A E   K KI+KL
Sbjct: 1   MASENVTVITKDNFEQEVLKSEKAVLVDFWAPWCGPCRAVGPIVDELASEYNGKAKISKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++ +E++ ++++ SIPT+++FK+G V+++++ GA S+S++   I   +
Sbjct: 61  NVQDENELAAKFRVMSIPTIMIFKNGDVVEKVV-GARSKSELSSLIDKHI 109


>gi|255530779|ref|YP_003091151.1| thioredoxin [Pedobacter heparinus DSM 2366]
 gi|255343763|gb|ACU03089.1| thioredoxin [Pedobacter heparinus DSM 2366]
          Length = 105

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+   PV+VDFWA WC PC  + P++D+I+ E   K  + K++++
Sbjct: 1   MA-LEITDANFEEVVLKSDKPVLVDFWAEWCGPCRMVGPVVDEISKEYEGKALVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +IST++ I +IP L+ FK+G+V+D+ + GA  +S + + +  ++
Sbjct: 60  NNPQISTQFGIRNIPALLYFKNGEVVDKQV-GAVPKSVLAQKLDKQL 105


>gi|209883634|ref|YP_002287491.1| thioredoxin [Oligotropha carboxidovorans OM5]
 gi|209871830|gb|ACI91626.1| thioredoxin [Oligotropha carboxidovorans OM5]
          Length = 106

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  KV    F++EVL+   PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MSVGKVSDADFEAEVLKAEGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ESPKTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKQKLQQWITAAV 106


>gi|158428383|pdb|2EIR|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
 gi|158428384|pdb|2EIR|B Chain B, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
 gi|158428385|pdb|2EIR|C Chain C, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
 gi|158428386|pdb|2EIR|D Chain D, Design Of Disulfide-Linked Thioredoxin Dimers And
           Multimers Through Analysis Of Crystal Contacts
          Length = 108

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   SFD++VL+    ++VDFWA WC PC  ++PI+D+IADE   K+ + KL+I+++
Sbjct: 4   IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQN 63

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
              + +Y I  IPTL+LFK+G+V    + GA S+  +  ++ 
Sbjct: 64  PGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKCFLD 104


>gi|307942843|ref|ZP_07658188.1| thioredoxin [Roseibium sp. TrichSKD4]
 gi|307773639|gb|EFO32855.1| thioredoxin [Roseibium sp. TrichSKD4]
          Length = 106

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   +   SF+ +VL+ S PVVVDFWA WC PC  ++P +++I++ELA +VKI KL+I+
Sbjct: 1   MATNTITDASFEEDVLKSSEPVVVDFWAEWCGPCKMIAPALEEISEELAGQVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ + + +Y + SIP LI+FKDG+ + + + GA+ ++ + +WI S +
Sbjct: 61  ENQDAAMKYGVRSIPMLIMFKDGEPMAQQV-GAAPKNKLADWIKSSI 106


>gi|325982323|ref|YP_004294725.1| thioredoxin [Nitrosomonas sp. AL212]
 gi|325531842|gb|ADZ26563.1| thioredoxin [Nitrosomonas sp. AL212]
          Length = 108

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F++EVL+ + PV+VD+WA WC PC  ++PI+D+IA+E ++++K+ KL+I+E+   
Sbjct: 8   VTDANFETEVLQSTTPVLVDYWAEWCGPCKMIAPILDEIANEYSERLKVAKLNIDENQLT 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y I  IPTL+LFK+G +    + GA S+S +  +I S +
Sbjct: 68  PPKYGIRGIPTLMLFKNGNIEATKV-GALSKSQLTAFIDSHI 108


>gi|254449285|ref|ZP_05062731.1| thioredoxin [gamma proteobacterium HTCC5015]
 gi|198261094|gb|EDY85393.1| thioredoxin [gamma proteobacterium HTCC5015]
          Length = 108

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S   +   +FDSEVLE   PV+VD+WA WC PC  ++PI+D++A+E   ++K+ KL+I+E
Sbjct: 4   SITYLTDATFDSEVLESDLPVLVDYWAEWCGPCKMIAPILDEVAEEYKGRLKVAKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +   +Y I  IPTL++FK G V    + GA S+S +I ++ + +
Sbjct: 64  NGDTPPKYGIRGIPTLMIFKGGNVDATKV-GALSKSQLIAFVDANL 108


>gi|307292808|ref|ZP_07572654.1| thioredoxin [Sphingobium chlorophenolicum L-1]
 gi|306880874|gb|EFN12090.1| thioredoxin [Sphingobium chlorophenolicum L-1]
          Length = 106

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF  +V++   PV+VDFWA WC PC  + P +++I+DELADKV I K++I+
Sbjct: 1   MATKAVTDLSFKQDVIDADKPVLVDFWAEWCGPCKMIGPALEEISDELADKVVIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ +   RY +  IPT+ILFK+G+     + GA+ +S +  WI S
Sbjct: 61  ENPDAPGRYGVRGIPTMILFKNGEAAATKV-GAAPKSALKGWIES 104


>gi|258406028|ref|YP_003198770.1| thioredoxin [Desulfohalobium retbaense DSM 5692]
 gi|257798255|gb|ACV69192.1| thioredoxin [Desulfohalobium retbaense DSM 5692]
          Length = 106

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   +F+SEVL+C  PV+VDFWA WC PC  ++P+I+++A E   +VKI K++++
Sbjct: 1   MAN-QVTDANFESEVLQCDLPVLVDFWAPWCGPCRAIAPVIEELAKEYTGRVKIMKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+     +Y I +IPTLILFK+G+V++++  GA S++ I + +  +
Sbjct: 60  ENPTSPNKYGIRAIPTLILFKNGEVVEQL-TGAVSKASIKDLLSEK 104


>gi|115447527|ref|NP_001047543.1| Os02g0639900 [Oryza sativa Japonica Group]
 gi|75323566|sp|Q6H7E4|TRXM1_ORYSJ RecName: Full=Thioredoxin M1, chloroplastic; Short=OsTrxm1;
           AltName: Full=OsTrx08; Flags: Precursor
 gi|49388235|dbj|BAD25355.1| putative Thioredoxin M-type, chloroplast precursor [Oryza sativa
           Japonica Group]
 gi|113537074|dbj|BAF09457.1| Os02g0639900 [Oryza sativa Japonica Group]
 gi|215704537|dbj|BAG94170.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218191250|gb|EEC73677.1| hypothetical protein OsI_08226 [Oryza sativa Indica Group]
 gi|222623322|gb|EEE57454.1| hypothetical protein OsJ_07676 [Oryza sativa Japonica Group]
          Length = 173

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S V+E   PV+V+FWASWC PC  + P+I  ++ E   K+   KL+ +E+
Sbjct: 68  VPDVTKSTWQSLVVESELPVLVEFWASWCGPCKMIDPVIGKLSKEYEGKLNCYKLNTDEN 127

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I+T++ I SIPT+++FK+G+  D ++ GA  +S ++  I   +
Sbjct: 128 PDIATQFGIRSIPTMMIFKNGEKKDAVI-GAVPESTLVSSIDKYI 171


>gi|257469080|ref|ZP_05633174.1| thioredoxin [Fusobacterium ulcerans ATCC 49185]
 gi|317063326|ref|ZP_07927811.1| thioredoxin [Fusobacterium ulcerans ATCC 49185]
 gi|313689002|gb|EFS25837.1| thioredoxin [Fusobacterium ulcerans ATCC 49185]
          Length = 104

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/101 (41%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +  ++F+ EVL+   PV+VDFWA+WC PC  L PI+++   ELA  VKI K++I+
Sbjct: 1   MAILHITKENFEQEVLKSDVPVLVDFWAAWCGPCKALGPILEEAESELAPGVKIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E  +++ ++++ SIPTLILFK+G+ +++ + G  S+  ++E
Sbjct: 61  EQEDLAGQFRVMSIPTLILFKNGQPVEKSV-GLVSKDKVLE 100


>gi|86747756|ref|YP_484252.1| thioredoxin [Rhodopseudomonas palustris HaA2]
 gi|86570784|gb|ABD05341.1| thioredoxin [Rhodopseudomonas palustris HaA2]
          Length = 106

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F++EVL+   PVVVDFWA WC PC  ++P +D+I+  + D VKI KL+++
Sbjct: 1   MAVGKVSDADFEAEVLKAQGPVVVDFWAEWCGPCRMIAPALDEISGAMGDTVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  ESPVTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWISSAV 106


>gi|323495930|ref|ZP_08100997.1| thioredoxin [Vibrio sinaloensis DSM 21326]
 gi|323319013|gb|EGA71957.1| thioredoxin [Vibrio sinaloensis DSM 21326]
          Length = 108

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 108


>gi|162461925|ref|NP_001105759.1| protein disulfide isomerase7 [Zea mays]
 gi|59861271|gb|AAX09965.1| protein disulfide isomerase [Zea mays]
          Length = 366

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 53/107 (49%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + + +++FDS VL+ +  V+V+F+A WC  C  L+PI + +A        +   +I+ 
Sbjct: 149 SVVVLTSETFDSIVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASVFKQDDGVVIANIDA 208

Query: 62  SS--EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               +++ +Y +S  PTL  F  G        G     D +++I  +
Sbjct: 209 DKHTDLAEKYGVSGFPTLKFFPKGNKAGEDYDGGRDLDDFVKFINEK 255



 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +    F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 32  VVALTEADFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 90

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   G  S   + E++ S 
Sbjct: 91  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSVEALAEFVNSE 136


>gi|311772203|pdb|3NOF|A Chain A, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant
 gi|311772204|pdb|3NOF|B Chain B, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant
 gi|311772217|pdb|3O6T|A Chain A, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant In
           Complex With Quinol Inhibitor Pmx464
 gi|311772218|pdb|3O6T|B Chain B, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant In
           Complex With Quinol Inhibitor Pmx464
 gi|311772219|pdb|3O6T|C Chain C, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant In
           Complex With Quinol Inhibitor Pmx464
 gi|311772220|pdb|3O6T|D Chain D, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant In
           Complex With Quinol Inhibitor Pmx464
          Length = 118

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC P   ++P++++IA E A  + + KLD++ 
Sbjct: 10  ATIKVTDASFATDVLSSNKPVLVDFWATWCGPSKMVAPVLEEIATERATDLTVAKLDVDT 69

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++  +
Sbjct: 70  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLREL 110


>gi|124266476|ref|YP_001020480.1| thioredoxin 1 [Methylibium petroleiphilum PM1]
 gi|124259251|gb|ABM94245.1| thioredoxin 1 [Methylibium petroleiphilum PM1]
          Length = 109

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      V   SFD +VL+   PV+VD+WA WC PC  ++PI+D++A +   K++I K+
Sbjct: 1   MASELIKHVSDASFDDDVLKSGTPVLVDYWAEWCGPCKMIAPILDEVAKDYGSKLQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ ++  ++ I  IPTL+LFK G++    + GA ++S +  ++   +
Sbjct: 61  NVDENRDVPAKFGIRGIPTLMLFKGGQLAATKV-GALNKSQLTAFLDGHL 109


>gi|291613479|ref|YP_003523636.1| thioredoxin [Sideroxydans lithotrophicus ES-1]
 gi|291583591|gb|ADE11249.1| thioredoxin [Sideroxydans lithotrophicus ES-1]
          Length = 108

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F +EVL+   PV+VD+WA WC PC  ++PI+D+++ E A ++ + KL+++E+ + 
Sbjct: 8   VTDGTFTAEVLQSPLPVLVDYWAEWCGPCRMIAPILDEVSKEYAGRLNVAKLNVDENQQT 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y +  IPTL+LFK+G +    + GA S+S +  +I S +
Sbjct: 68  PQKYGVRGIPTLMLFKNGNIEATKV-GALSKSQLTAFIDSHI 108


>gi|163745128|ref|ZP_02152488.1| thioredoxin [Oceanibulbus indolifex HEL-45]
 gi|161381946|gb|EDQ06355.1| thioredoxin [Oceanibulbus indolifex HEL-45]
          Length = 106

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV     PV+VDFWA WC PC ++ P +++++DE+  +VKI K++++
Sbjct: 1   MATVAVTDDTFDAEVKNSDIPVLVDFWAEWCGPCKQIGPSLEELSDEMNGRVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L +FKDG+V+  +  GA  ++ +  WI   +
Sbjct: 61  ENPNSPAQVGVRGIPALFIFKDGQVVSNL-AGARPKAALQSWIEESI 106


>gi|126724544|ref|ZP_01740387.1| thioredoxin [Rhodobacterales bacterium HTCC2150]
 gi|126705708|gb|EBA04798.1| thioredoxin [Rhodobacterales bacterium HTCC2150]
          Length = 106

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +F++EV   S PV+VDFWA WC PC ++ P +++++ E  + +KI K+D++
Sbjct: 1   MATIAVTDATFEAEVKNSSTPVLVDFWAEWCGPCKQIGPALEELSAEYGETIKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    I  IP L +FKDG+V+   M GA+ ++ + +WI   +
Sbjct: 61  SNPNSAAAMGIRGIPALFIFKDGEVV-SNMAGAAPKASLKKWIDESI 106


>gi|167648809|ref|YP_001686472.1| thioredoxin [Caulobacter sp. K31]
 gi|167351239|gb|ABZ73974.1| thioredoxin [Caulobacter sp. K31]
          Length = 111

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V  +SF+ +VL+   PV+VDFWA WC PC +++P ++ I++ELAD V + K++IE
Sbjct: 1   MSTVAVTDESFERDVLQAEKPVLVDFWAEWCGPCKQIAPALEQISEELADHVTVAKVNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +S    +RY +  IPT++LF+ G++    + GA  ++ I+EW+   
Sbjct: 61  DSPTTPSRYGVRGIPTMMLFRGGQMASMKV-GAMPKAKILEWLNEA 105


>gi|332798119|ref|YP_004459618.1| thioredoxin [Tepidanaerobacter sp. Re1]
 gi|332695854|gb|AEE90311.1| thioredoxin [Tepidanaerobacter sp. Re1]
          Length = 104

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  L +   +F  EVL+    V+VDFWA WC PC  + P+ID+IA E +D +K+ KL+++
Sbjct: 1   MKPLTITDDNFAQEVLQAEGKVLVDFWAPWCGPCRMMGPVIDEIAAEYSDSLKVGKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ + ++ Y + SIPTLILF++GK + + + G   + +++  I
Sbjct: 61  ENPKTASNYGVMSIPTLILFENGK-VAKKLVGFRPKQELVAEI 102


>gi|323494190|ref|ZP_08099305.1| thioredoxin [Vibrio brasiliensis LMG 20546]
 gi|323311584|gb|EGA64733.1| thioredoxin [Vibrio brasiliensis LMG 20546]
          Length = 108

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFEADVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 108


>gi|255631161|gb|ACU15946.1| unknown [Glycine max]
          Length = 182

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           +   ++ S VLE  +PV+V+FWA WC PC  + PIID++A E   ++K  KL+ +ES   
Sbjct: 82  ITDANWQSLVLESESPVLVEFWAPWCGPCRMIHPIIDELAKEYVGRLKCYKLNTDESPST 141

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +TRY I SIPT+I+FK+G+  D ++ GA  ++ +   I   +
Sbjct: 142 ATRYGIRSIPTVIIFKNGEKKDTVI-GAVPKTTLTSSIEKFL 182


>gi|326403649|ref|YP_004283731.1| thioredoxin [Acidiphilium multivorum AIU301]
 gi|325050511|dbj|BAJ80849.1| thioredoxin [Acidiphilium multivorum AIU301]
          Length = 108

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 62/106 (58%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V    F + VL    PV+VDFWA WC PC  + P ++++  E A +V I K++I+E
Sbjct: 4   ATKAVSDAEFSTSVLNSKEPVLVDFWAEWCGPCKIIGPSLEELGSEYAGRVTIAKVNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +    T+Y +  IPTLILFKDGK   + + GA+ +S +  W+   +
Sbjct: 64  NPMTPTQYGVRGIPTLILFKDGKPAAQHV-GAAPKSVLKAWLDKNI 108


>gi|270158327|ref|ZP_06186984.1| thioredoxin [Legionella longbeachae D-4968]
 gi|289163427|ref|YP_003453565.1| thioredoxin [Legionella longbeachae NSW150]
 gi|269990352|gb|EEZ96606.1| thioredoxin [Legionella longbeachae D-4968]
 gi|288856600|emb|CBJ10407.1| putative thioredoxin [Legionella longbeachae NSW150]
          Length = 108

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ EV++ + PV+VDFWA WC PC  L+PI++++A   +++V   K++
Sbjct: 1   MSDLIKTVTDASFEQEVMQSNKPVLVDFWAEWCGPCRALTPILEEVAGTHSEQVTFAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   +Y + SIPTLILFK+G+ ++ +  G  S+S +  ++ S V
Sbjct: 61  IDENPQTPAKYGVMSIPTLILFKNGQ-VEAVKMGLLSKSQLSAFVESHV 108


>gi|172038901|ref|YP_001805402.1| thioredoxin [Cyanothece sp. ATCC 51142]
 gi|171700355|gb|ACB53336.1| thioredoxin [Cyanothece sp. ATCC 51142]
          Length = 107

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A +V   SF ++VLE   PV+VDFWA WC PC  ++P++D+IA++ A +VK+ KL+ +E
Sbjct: 3   AAAQVTDSSFKADVLESDVPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQVKVVKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 63  NPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLASTLEKYL 107


>gi|94265669|ref|ZP_01289409.1| Thioredoxin [delta proteobacterium MLMS-1]
 gi|93453796|gb|EAT04165.1| Thioredoxin [delta proteobacterium MLMS-1]
          Length = 109

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 70/108 (64%), Gaps = 4/108 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    ++V    FDS+VL+ + PV+VDFWA WC PC  + P+++++ADE A K KI K+
Sbjct: 1   MASDKLVQVSDADFDSQVLQSAEPVLVDFWAPWCGPCKAIGPVVEELADEYAGKAKIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +++++     +Y I +IPTLILFK G+V+D+ + GA  +  +   I  
Sbjct: 61  NVDDNPATPGKYGIRAIPTLILFKGGEVVDQ-VTGAVGKPQLTALIDK 107


>gi|332284682|ref|YP_004416593.1| thioredoxin [Pusillimonas sp. T7-7]
 gi|330428635|gb|AEC19969.1| thioredoxin [Pusillimonas sp. T7-7]
          Length = 108

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 66/106 (62%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S   V   SF+++V+    PV+VD+WA+WC PC  ++P++D+ A +   +V I K+D++ 
Sbjct: 4   SIKHVSDASFEADVINSDVPVLVDYWAAWCGPCKMIAPLLDEAAKQYEGRVIIAKVDVDA 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E + ++ +  IPTL+LFKDGK     + GA S+S +  ++   +
Sbjct: 64  NPETAAKFGVRGIPTLMLFKDGKAAATKV-GALSKSQLNAFLDESL 108


>gi|256828930|ref|YP_003157658.1| thioredoxin [Desulfomicrobium baculatum DSM 4028]
 gi|256578106|gb|ACU89242.1| thioredoxin [Desulfomicrobium baculatum DSM 4028]
          Length = 106

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A +V+   F++EVL+   PV+VDFWA WC PC  ++P+I+++  E   KVKI K++++
Sbjct: 1   MAA-QVNDAGFEAEVLKGDLPVLVDFWAPWCGPCRAIAPVIEELTQEFEGKVKIVKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+    ++Y I +IPTLILFK+G+V+++ + GA S++ + + +  +V
Sbjct: 60  ENPGTPSKYGIRAIPTLILFKNGEVVEQ-VTGAVSKASLKQMLSDKV 105


>gi|15611050|ref|NP_218431.1| thioredoxin trxC (TRX) (MPT46) [Mycobacterium tuberculosis H37Rv]
 gi|15843547|ref|NP_338584.1| thioredoxin [Mycobacterium tuberculosis CDC1551]
 gi|31795087|ref|NP_857580.1| thioredoxin trxC (TRX) (MPT46) [Mycobacterium bovis AF2122/97]
 gi|121635900|ref|YP_976123.1| thioredoxin trxC (TRX) (MPT46) [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|121639825|ref|YP_980049.1| thioredoxin trxC [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148663781|ref|YP_001285304.1| thioredoxin TrxC [Mycobacterium tuberculosis H37Ra]
 gi|148825122|ref|YP_001289876.1| thioredoxin trxC [Mycobacterium tuberculosis F11]
 gi|167969451|ref|ZP_02551728.1| thioredoxin trxC [Mycobacterium tuberculosis H37Ra]
 gi|215405972|ref|ZP_03418153.1| thioredoxin trxC [Mycobacterium tuberculosis 02_1987]
 gi|215413842|ref|ZP_03422507.1| thioredoxin trxC [Mycobacterium tuberculosis 94_M4241A]
 gi|215425176|ref|ZP_03423095.1| thioredoxin trxC [Mycobacterium tuberculosis T92]
 gi|215432895|ref|ZP_03430814.1| thioredoxin trxC [Mycobacterium tuberculosis EAS054]
 gi|215448261|ref|ZP_03435013.1| thioredoxin trxC [Mycobacterium tuberculosis T85]
 gi|218755706|ref|ZP_03534502.1| thioredoxin trxC [Mycobacterium tuberculosis GM 1503]
 gi|224992320|ref|YP_002647010.1| thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253800964|ref|YP_003033966.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 1435]
 gi|254366450|ref|ZP_04982494.1| thioredoxin trxC [Mycobacterium tuberculosis str. Haarlem]
 gi|254548918|ref|ZP_05139365.1| thioredoxin trxC [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|260184844|ref|ZP_05762318.1| thioredoxin trxC [Mycobacterium tuberculosis CPHL_A]
 gi|260198974|ref|ZP_05766465.1| thioredoxin trxC [Mycobacterium tuberculosis T46]
 gi|260203127|ref|ZP_05770618.1| thioredoxin trxC [Mycobacterium tuberculosis K85]
 gi|289441357|ref|ZP_06431101.1| thioredoxin [Mycobacterium tuberculosis T46]
 gi|289445515|ref|ZP_06435259.1| thioredoxin trxC [Mycobacterium tuberculosis CPHL_A]
 gi|289556182|ref|ZP_06445392.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 605]
 gi|289572566|ref|ZP_06452793.1| thioredoxin trxC [Mycobacterium tuberculosis K85]
 gi|289747758|ref|ZP_06507136.1| thioredoxin trxC [Mycobacterium tuberculosis 02_1987]
 gi|289748452|ref|ZP_06507830.1| thioredoxin trxC [Mycobacterium tuberculosis T92]
 gi|289756049|ref|ZP_06515427.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           tuberculosis EAS054]
 gi|289760087|ref|ZP_06519465.1| thioredoxin/thioredoxin reductase hybrid protein [Mycobacterium
           tuberculosis T85]
 gi|289764105|ref|ZP_06523483.1| thioredoxin trxC [Mycobacterium tuberculosis GM 1503]
 gi|294995597|ref|ZP_06801288.1| thioredoxin TrxC [Mycobacterium tuberculosis 210]
 gi|297636601|ref|ZP_06954381.1| thioredoxin TrxC [Mycobacterium tuberculosis KZN 4207]
 gi|297733596|ref|ZP_06962714.1| thioredoxin TrxC [Mycobacterium tuberculosis KZN R506]
 gi|298527386|ref|ZP_07014795.1| thioredoxin/thioredoxin reductase hybrid protein [Mycobacterium
           tuberculosis 94_M4241A]
 gi|306778278|ref|ZP_07416615.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu001]
 gi|306778808|ref|ZP_07417145.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu002]
 gi|306786835|ref|ZP_07425157.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu003]
 gi|306786964|ref|ZP_07425286.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu004]
 gi|306791519|ref|ZP_07429821.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu005]
 gi|306795584|ref|ZP_07433886.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu006]
 gi|306801559|ref|ZP_07438227.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu008]
 gi|306805768|ref|ZP_07442436.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu007]
 gi|306970165|ref|ZP_07482826.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu009]
 gi|306974397|ref|ZP_07487058.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu010]
 gi|307082105|ref|ZP_07491275.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu011]
 gi|307086716|ref|ZP_07495829.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu012]
 gi|313660927|ref|ZP_07817807.1| thioredoxin TrxC [Mycobacterium tuberculosis KZN V2475]
 gi|61248338|sp|P0A616|THIO_MYCTU RecName: Full=Thioredoxin; Short=Trx; AltName: Full=MPT46
 gi|61248339|sp|P0A617|THIO_MYCBO RecName: Full=Thioredoxin; Short=Trx; AltName: Full=MPT46
 gi|1213065|emb|CAA65071.1| thioredoxin reductase [Mycobacterium tuberculosis]
 gi|2808699|emb|CAA16227.1| THIOREDOXIN TRXC (TRX) (MPT46) [Mycobacterium tuberculosis H37Rv]
 gi|13883925|gb|AAK48398.1| thioredoxin [Mycobacterium tuberculosis CDC1551]
 gi|31620685|emb|CAD96131.1| THIOREDOXIN TRXC (TRX) (MPT46) [Mycobacterium bovis AF2122/97]
 gi|121491547|emb|CAL70004.1| Thioredoxin trxC (TRX) (MPT46) [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|121495473|emb|CAL73962.1| Thioredoxin trxC [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|134151962|gb|EBA44007.1| thioredoxin trxC [Mycobacterium tuberculosis str. Haarlem]
 gi|148507933|gb|ABQ75742.1| thioredoxin TrxC [Mycobacterium tuberculosis H37Ra]
 gi|148723649|gb|ABR08274.1| thioredoxin trxC [Mycobacterium tuberculosis F11]
 gi|224775436|dbj|BAH28242.1| thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253322468|gb|ACT27071.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 1435]
 gi|289414276|gb|EFD11516.1| thioredoxin [Mycobacterium tuberculosis T46]
 gi|289418473|gb|EFD15674.1| thioredoxin trxC [Mycobacterium tuberculosis CPHL_A]
 gi|289440814|gb|EFD23307.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 605]
 gi|289536997|gb|EFD41575.1| thioredoxin trxC [Mycobacterium tuberculosis K85]
 gi|289688286|gb|EFD55774.1| thioredoxin trxC [Mycobacterium tuberculosis 02_1987]
 gi|289689039|gb|EFD56468.1| thioredoxin trxC [Mycobacterium tuberculosis T92]
 gi|289696636|gb|EFD64065.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           tuberculosis EAS054]
 gi|289711611|gb|EFD75627.1| thioredoxin trxC [Mycobacterium tuberculosis GM 1503]
 gi|289715651|gb|EFD79663.1| thioredoxin/thioredoxin reductase hybrid protein [Mycobacterium
           tuberculosis T85]
 gi|298497180|gb|EFI32474.1| thioredoxin/thioredoxin reductase hybrid protein [Mycobacterium
           tuberculosis 94_M4241A]
 gi|308213428|gb|EFO72827.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu001]
 gi|308328145|gb|EFP16996.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu002]
 gi|308328607|gb|EFP17458.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu003]
 gi|308336262|gb|EFP25113.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu004]
 gi|308339868|gb|EFP28719.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu005]
 gi|308343880|gb|EFP32731.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu006]
 gi|308347664|gb|EFP36515.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu007]
 gi|308351582|gb|EFP40433.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu008]
 gi|308352289|gb|EFP41140.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu009]
 gi|308356292|gb|EFP45143.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu010]
 gi|308360179|gb|EFP49030.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu011]
 gi|308363866|gb|EFP52717.1| thioredoxin trxC [Mycobacterium tuberculosis SUMu012]
 gi|323717330|gb|EGB26535.1| thioredoxin trxC [Mycobacterium tuberculosis CDC1551A]
 gi|326905747|gb|EGE52680.1| thioredoxin trxC [Mycobacterium tuberculosis W-148]
 gi|328460692|gb|AEB06115.1| thioredoxin trxC [Mycobacterium tuberculosis KZN 4207]
          Length = 116

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 8   ATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDT 67

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++  +
Sbjct: 68  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLREL 108


>gi|77462067|ref|YP_351571.1| thioredoxin [Rhodobacter sphaeroides 2.4.1]
 gi|126460956|ref|YP_001042070.1| thioredoxin [Rhodobacter sphaeroides ATCC 17029]
 gi|221641020|ref|YP_002527282.1| Thioredoxin [Rhodobacter sphaeroides KD131]
 gi|332559994|ref|ZP_08414316.1| thioredoxin [Rhodobacter sphaeroides WS8N]
 gi|135778|sp|P08058|THIO_RHOSH RecName: Full=Thioredoxin; Short=Trx
 gi|152045|gb|AAA26182.1| thioredoxin (trxA) [Rhodobacter sphaeroides]
 gi|77386485|gb|ABA77670.1| Thioredoxin [Rhodobacter sphaeroides 2.4.1]
 gi|126102620|gb|ABN75298.1| thioredoxin [Rhodobacter sphaeroides ATCC 17029]
 gi|221161801|gb|ACM02781.1| Thioredoxin [Rhodobacter sphaeroides KD131]
 gi|332277706|gb|EGJ23021.1| thioredoxin [Rhodobacter sphaeroides WS8N]
          Length = 106

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV +   PVVVDFWA WC PC ++ P +++++ E A KVKI K++++
Sbjct: 1   MSTVPVTDATFDTEVRKSDVPVVVDFWAEWCGPCRQIGPALEELSKEYAGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E      +  IP L LFK+G+V+   + GA+ ++ +  WI S +
Sbjct: 61  ENPESPAMLGVRGIPALFLFKNGQVVSNKV-GAAPKAALATWIASAL 106


>gi|148978451|ref|ZP_01814925.1| thioredoxin [Vibrionales bacterium SWAT-3]
 gi|145962358|gb|EDK27638.1| thioredoxin [Vibrionales bacterium SWAT-3]
          Length = 108

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|312888889|ref|ZP_07748451.1| thioredoxin [Mucilaginibacter paludis DSM 18603]
 gi|311298630|gb|EFQ75737.1| thioredoxin [Mucilaginibacter paludis DSM 18603]
          Length = 106

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+   PV+VDFWA WC PC  + P++++IA E   +  + K++++
Sbjct: 1   MA-LEITDANFEELVLKSDKPVLVDFWAEWCGPCRMVGPVVEEIAKEYDGQAVVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  IS ++ I +IP L+ FK+G+++D+ + GA  +S + + +  ++
Sbjct: 60  NNPGISMKFGIRNIPALLYFKNGEIVDKQI-GAVPKSVLADKLKKQL 105


>gi|240168394|ref|ZP_04747053.1| thioredoxin TrxC [Mycobacterium kansasii ATCC 12478]
          Length = 117

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF + VL  + PV+VDFWA+WC PC  ++P++++IA E +  + + KLD++ 
Sbjct: 9   ATIEVSDASFSTTVLSSNKPVLVDFWATWCGPCKMVAPVLEEIAAERSGSLTVAKLDVDA 68

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + + +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++  I
Sbjct: 69  NPQTARDFQVISIPTMILFKDGQPVKRIV-GAKGKAALLREI 109


>gi|46580248|ref|YP_011056.1| thioredoxin [Desulfovibrio vulgaris str. Hildenborough]
 gi|120602368|ref|YP_966768.1| thioredoxin [Desulfovibrio vulgaris DP4]
 gi|46449665|gb|AAS96315.1| thioredoxin [Desulfovibrio vulgaris str. Hildenborough]
 gi|120562597|gb|ABM28341.1| thioredoxin [Desulfovibrio vulgaris DP4]
 gi|311233767|gb|ADP86621.1| thioredoxin [Desulfovibrio vulgaris RCH1]
          Length = 107

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A ++   +F++ VL+ + PV++DFWA WC PC  + P+ID++A E   KV I K++++
Sbjct: 1   MAA-QITDATFEASVLKSAIPVLIDFWAPWCGPCRAMGPVIDELAAEYEGKVLIVKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++    ++Y I +IPTLILFK+G+V+++ + GA S+S I + I  +
Sbjct: 60  DNPATPSKYGIRAIPTLILFKNGEVVEQ-VTGAVSKSSIKDMIAQK 104


>gi|317131602|ref|YP_004090916.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
 gi|315469581|gb|ADU26185.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
          Length = 107

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS L ++  +F    L    PV++DFWASWC PC   SPII+++A+EL     I KL+++
Sbjct: 1   MSVLTLNNSNFKDAALNADKPVLIDFWASWCGPCRAQSPIIEELAEELEGSAVIAKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEW 102
           E+ E++ ++ + SIPTL+  K GKV+ R   G +S+++++  
Sbjct: 61  ENPELAAQFSVMSIPTLVFLKGGKVVGRR-TGVTSKAELLSM 101


>gi|167036263|ref|YP_001671494.1| thioredoxin [Pseudomonas putida GB-1]
 gi|166862751|gb|ABZ01159.1| thioredoxin [Pseudomonas putida GB-1]
          Length = 108

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+++VL+   PV+VD+WA WC PC  ++P++DDIA     K+ + KL+
Sbjct: 1   MSDKIKHVTDASFEADVLQAQGPVLVDYWAEWCGPCKMIAPVLDDIAATYEGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  IDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDAHL 108


>gi|57234511|ref|YP_181437.1| thioredoxin [Dehalococcoides ethenogenes 195]
 gi|57234585|ref|YP_181403.1| thioredoxin [Dehalococcoides ethenogenes 195]
 gi|57224959|gb|AAW40016.1| thioredoxin [Dehalococcoides ethenogenes 195]
 gi|57225033|gb|AAW40090.1| thioredoxin [Dehalococcoides ethenogenes 195]
          Length = 107

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++  +SF +EVL+   PV+VDFWA WC PC  ++PIID ++ +   K K  KL+++E+
Sbjct: 2   VMEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYEGKFKFCKLNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + +Y++ SIPTL+ FK G+V D M+ GA  +S + + I   +
Sbjct: 62  KTTAAQYRVMSIPTLLFFKSGQVAD-MVVGAVPESALSQKIDQLL 105


>gi|260774367|ref|ZP_05883281.1| thioredoxin [Vibrio metschnikovii CIP 69.14]
 gi|260610494|gb|EEX35699.1| thioredoxin [Vibrio metschnikovii CIP 69.14]
          Length = 108

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++  +SF+++V++ + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+
Sbjct: 1   MSDKILQLSDESFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDHNAGTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 108


>gi|163856282|ref|YP_001630580.1| thioredoxin [Bordetella petrii DSM 12804]
 gi|163260010|emb|CAP42311.1| thioredoxin [Bordetella petrii]
          Length = 173

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SFD++V++ S PV+VD+WA+WC PC  ++PI++++A E + ++ + KL+
Sbjct: 66  MSEQIKNVSDASFDADVIKSSQPVLVDYWAAWCGPCKMIAPILEEVASEYSGRLTVAKLN 125

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+   + +Y I  IPTL+LFKDG+     + GA S+S +  ++   +
Sbjct: 126 VDENQGTAAKYGIRGIPTLMLFKDGQAAATKV-GALSKSQLTAFLDGAL 173


>gi|122920507|pdb|2I1U|A Chain A, Mycobacterium Tuberculosis Thioredoxin C
          Length = 121

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 13  ATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDT 72

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++  +
Sbjct: 73  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLREL 113


>gi|126666617|ref|ZP_01737595.1| thioredoxin [Marinobacter sp. ELB17]
 gi|126629005|gb|EAZ99624.1| thioredoxin [Marinobacter sp. ELB17]
          Length = 108

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   SF+ +VL+   PV+VD+WA WC PC  ++P++++IA+E A K+K+ KL+
Sbjct: 1   MSANIVNVTDVSFEQDVLQSDVPVLVDYWAEWCGPCKMIAPVLEEIAEEYAGKLKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   ++ I  IPTL+LFK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDENEQTPPKFNIRGIPTLMLFKNGNVDATKV-GALSKSQLAAFLDSNL 108


>gi|56698685|ref|YP_169062.1| thioredoxin [Ruegeria pomeroyi DSS-3]
 gi|56680422|gb|AAV97088.1| thioredoxin [Ruegeria pomeroyi DSS-3]
          Length = 106

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A E A KVKI K+D++
Sbjct: 1   MSTVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELATEYAGKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI S +
Sbjct: 61  SNPNAAAAMGVRGIPALFIFKDGQVVSNR-AGAAPKAALQNWIDSSI 106


>gi|139438801|ref|ZP_01772285.1| Hypothetical protein COLAER_01289 [Collinsella aerofaciens ATCC
           25986]
 gi|133775881|gb|EBA39701.1| Hypothetical protein COLAER_01289 [Collinsella aerofaciens ATCC
           25986]
          Length = 110

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 75/108 (69%), Gaps = 3/108 (2%)

Query: 1   MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+ + ++  ++FDS V +   PV+VDFWA WC PC  LSPI+D++ADELA K+ + K ++
Sbjct: 5   MADINQITPENFDSIVNDS-LPVLVDFWAPWCGPCRSLSPIVDEVADELAGKLAVAKCNV 63

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++ +++ +Y + SIPTL++FK+G+ IDR + GA  ++ +   +   +
Sbjct: 64  DDNQDLAMKYGVMSIPTLVVFKNGEEIDRSV-GALPKARLQALLEKYL 110


>gi|297539611|ref|YP_003675380.1| thioredoxin [Methylotenera sp. 301]
 gi|297258958|gb|ADI30803.1| thioredoxin [Methylotenera sp. 301]
          Length = 108

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     ++  SF+ +VL+   PV+VD+WA WC PC  ++PI+D+I+ E A ++K+ KL+
Sbjct: 1   MSEHITHLNDASFEQDVLQSQLPVLVDYWAEWCGPCKMIAPILDEISKEYAGRLKVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++     +Y I  IPTL+LFK+G V    + GA S+S +  +I S +
Sbjct: 61  IDDNQLTPPKYGIRGIPTLMLFKNGNVEATKV-GALSKSQLTAFIDSNI 108


>gi|325982415|ref|YP_004294817.1| thioredoxin [Nitrosomonas sp. AL212]
 gi|325531934|gb|ADZ26655.1| thioredoxin [Nitrosomonas sp. AL212]
          Length = 143

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++    F+  +     PV++DFWA WC PC  ++P     A  L   +++ K++ EE  
Sbjct: 40  VELTKDHFNRYISNSDIPVLIDFWAPWCGPCRMMAPAFAKAAATLEPGMRLAKVNTEEEQ 99

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++ RYQI SIPTL LFK+GK I R   GA S+ DII W  S +
Sbjct: 100 SLAARYQIRSIPTLALFKNGKEIAR-QSGAMSEQDIIRWAKSTI 142


>gi|289567870|ref|ZP_06448097.1| LOW QUALITY PROTEIN: thioredoxin trxC [Mycobacterium tuberculosis
           T17]
 gi|289541623|gb|EFD45272.1| LOW QUALITY PROTEIN: thioredoxin trxC [Mycobacterium tuberculosis
           T17]
          Length = 114

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 8   ATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDT 67

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E +  +Q+ SIPTLILFKDG+ + R++ GA  ++ ++  +
Sbjct: 68  NPETARNFQVVSIPTLILFKDGQPVKRIV-GAKGKAALLREL 108


>gi|284928733|ref|YP_003421255.1| thioredoxin [cyanobacterium UCYN-A]
 gi|284809192|gb|ADB94897.1| thioredoxin [cyanobacterium UCYN-A]
          Length = 107

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +  +V   SF ++VLE   PV+VDFWA WC PC  ++P++D+IA++ A ++K+ KL+ +E
Sbjct: 3   ATAQVTDSSFKTDVLESEVPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQIKVVKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 63  NPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLASTLEKYL 107


>gi|258543652|ref|YP_003189085.1| thioredoxin [Acetobacter pasteurianus IFO 3283-01]
 gi|256634730|dbj|BAI00706.1| thioredoxin [Acetobacter pasteurianus IFO 3283-01]
 gi|256637786|dbj|BAI03755.1| thioredoxin [Acetobacter pasteurianus IFO 3283-03]
 gi|256640840|dbj|BAI06802.1| thioredoxin [Acetobacter pasteurianus IFO 3283-07]
 gi|256643895|dbj|BAI09850.1| thioredoxin [Acetobacter pasteurianus IFO 3283-22]
 gi|256646950|dbj|BAI12898.1| thioredoxin [Acetobacter pasteurianus IFO 3283-26]
 gi|256650003|dbj|BAI15944.1| thioredoxin [Acetobacter pasteurianus IFO 3283-32]
 gi|256652993|dbj|BAI18927.1| thioredoxin [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256656047|dbj|BAI21974.1| thioredoxin [Acetobacter pasteurianus IFO 3283-12]
          Length = 108

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L V   SFD +VL+ S  V+VDFWA WC PC  + P +++I  E A KV + K++
Sbjct: 1   MSEHTLAVSDSSFDKDVLKASGLVLVDFWAEWCGPCKMIGPALEEIGKEFAGKVTVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ E    YQ+ SIPTL+L +DGKV+D+ + GA  +S +  W+   +
Sbjct: 61  IDDNPETPNAYQVRSIPTLMLVRDGKVVDKKV-GALPKSQLKAWVEGAL 108


>gi|327399192|ref|YP_004340061.1| thioredoxin [Hippea maritima DSM 10411]
 gi|327181821|gb|AEA34002.1| thioredoxin [Hippea maritima DSM 10411]
          Length = 106

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++   +++ EVL    PV+VDFWA WC PC  ++P++ +IADE A K+K+ KL+ +
Sbjct: 1   MAEIQLTQANWEDEVLGSDIPVLVDFWAPWCGPCRMVAPVVAEIADEYAGKLKVGKLNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E  EI+ RY I SIPTL++FK+G+V D+++ GA  +  I+E +  
Sbjct: 61  EEPEIAVRYGIMSIPTLMIFKNGEVADQII-GAVPKEYIVEKLQQ 104


>gi|294675593|ref|YP_003576208.1| thioredoxin [Rhodobacter capsulatus SB 1003]
 gi|294474413|gb|ADE83801.1| thioredoxin-1 [Rhodobacter capsulatus SB 1003]
          Length = 106

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV +   PVVVDFWA WC PC  + P ++D++ ELA KVKI K++++
Sbjct: 1   MATVAVTDATFDAEVRQSDLPVVVDFWAEWCGPCKMIGPSLEDLSTELAGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +      +  IP L LFKDG+V+   + GA+ ++ +  WI + +
Sbjct: 61  ENPDSPAALGVRGIPALFLFKDGQVVSNKV-GAAPKAALQAWIEASL 106


>gi|315657678|ref|ZP_07910560.1| thioredoxin [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|315492150|gb|EFU81759.1| thioredoxin [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 108

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A++V   +F +EVL+   PV+VDFWA WC PC +++PI+D IA +  D++K+ K D+++
Sbjct: 3   AAIEVTDSNFAAEVLDSDVPVLVDFWAVWCGPCRQMAPIVDQIAADFGDRLKVAKCDVDK 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  +  +Y +S+IPT  +FK GKV+ +++ G   +S   E I + +
Sbjct: 63  NPSLQAQYGVSAIPTFNIFKGGKVVHQIIGG-RPRSQFKEEIEAAL 107


>gi|312963770|ref|ZP_07778241.1| thioredoxin [Pseudomonas fluorescens WH6]
 gi|311281805|gb|EFQ60415.1| thioredoxin [Pseudomonas fluorescens WH6]
          Length = 109

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+ + PV+VD+WA WC PC  ++P++DDIA     K+ I KL
Sbjct: 1   MSNDLIKHVTDATFEAEVLKATGPVLVDYWAEWCGPCKMIAPVLDDIATTYEGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDDNQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLQAFLDANI 109


>gi|295687597|ref|YP_003591290.1| thioredoxin [Caulobacter segnis ATCC 21756]
 gi|295429500|gb|ADG08672.1| thioredoxin [Caulobacter segnis ATCC 21756]
          Length = 110

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +F+S+VL+ S PV+VDFWA WC PC +++P ++ I++ELAD V + K++IE
Sbjct: 1   MSTVVVTDATFESDVLKASKPVLVDFWAEWCGPCKQIAPALEQISEELADVVTVAKVNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +S    +RY +  IPT++LF+DG++    + GA  +  I+EW+   
Sbjct: 61  DSPTTPSRYGVRGIPTMMLFRDGQMTSMKV-GAMPKQKILEWLNEA 105


>gi|126661310|ref|ZP_01732379.1| thioredoxin [Cyanothece sp. CCY0110]
 gi|126617406|gb|EAZ88206.1| thioredoxin [Cyanothece sp. CCY0110]
          Length = 107

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A +V   SF ++VLE   PV+VDFWA WC PC  ++P++D+IA++ A ++K+ KL+ +E
Sbjct: 3   AAAQVTDSSFKADVLESEVPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQIKVVKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 63  NPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLASTLEKYL 107


>gi|149191364|ref|ZP_01869616.1| thioredoxin [Vibrio shilonii AK1]
 gi|148834781|gb|EDL51766.1| thioredoxin [Vibrio shilonii AK1]
          Length = 108

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSEKILQLTDDGFETDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|99082687|ref|YP_614841.1| thioredoxin [Ruegeria sp. TM1040]
 gi|259417496|ref|ZP_05741415.1| thioredoxin [Silicibacter sp. TrichCH4B]
 gi|99038967|gb|ABF65579.1| thioredoxin [Ruegeria sp. TM1040]
 gi|259346402|gb|EEW58216.1| thioredoxin [Silicibacter sp. TrichCH4B]
          Length = 106

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A E  DKVKI K+D++
Sbjct: 1   MSTVAVTDATFDAEVKNSDVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNAAAAMGVRGIPALFVFKDGQVVSNR-AGAAPKAALKSWIDESI 106


>gi|300087814|ref|YP_003758336.1| thioredoxin [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299527547|gb|ADJ26015.1| thioredoxin [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 105

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  +++   +F+SEV++   PV+VDFWA WC PC  ++P++D + ++   K K  K++++
Sbjct: 1   MP-IEISDDTFESEVIKSELPVLVDFWAPWCGPCRMVAPVVDKLEEKHQGKFKFCKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + + ++++ SIPTL+ FKDG  +   + GA  +S + E I   +
Sbjct: 60  DNQKTAGQFRVMSIPTLMFFKDG-EVQETVVGAVPESSLQEKIDKLI 105


>gi|312113145|ref|YP_004010741.1| thioredoxin [Rhodomicrobium vannielii ATCC 17100]
 gi|311218274|gb|ADP69642.1| thioredoxin [Rhodomicrobium vannielii ATCC 17100]
          Length = 109

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF+ +V     PV+VDFWA WC PC  + PI++++++E A ++K+ KLD+E
Sbjct: 1   MATTAVSDASFEQDVKNAELPVLVDFWAEWCGPCRTVGPILEELSEEFAGQLKVVKLDVE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +  I+  Y I  IP L+LFK+G+V  + + GA  +  +  WI
Sbjct: 61  SNPGIAQAYNIRGIPALLLFKNGEVAGQQI-GALPKQQLRAWI 102


>gi|148260456|ref|YP_001234583.1| thioredoxin [Acidiphilium cryptum JF-5]
 gi|146402137|gb|ABQ30664.1| thioredoxin [Acidiphilium cryptum JF-5]
          Length = 108

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 63/106 (59%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V    F + VL+   PV+VDFWA WC PC  + P ++++  E A +V I K++I+E
Sbjct: 4   ATKAVSDAEFSTSVLDSKEPVLVDFWAEWCGPCKIIGPSLEELGSEYAGRVTIAKVNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +    T+Y +  IPTLILFKDGK   + + GA+ +S +  W+   +
Sbjct: 64  NPMTPTQYGVRGIPTLILFKDGKPAAQHV-GAAPKSVLKAWLDKNI 108


>gi|301630305|ref|XP_002944262.1| PREDICTED: thioredoxin-like [Xenopus (Silurana) tropicalis]
          Length = 127

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   SF ++VL+ S PV+VD+WA WC PC  ++PI+DD+A     K+ I K++++++
Sbjct: 23  IKHVSDTSFQADVLQSSTPVLVDYWAEWCGPCKMIAPILDDVAGAYQGKLTIAKMNMDDN 82

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            EI  ++ I  IPTL+LFK+G++    + GA  ++ +  +I  ++
Sbjct: 83  QEIPAKFGIRGIPTLMLFKNGQLAATHV-GALGRAQLTAFIDQQL 126


>gi|329113819|ref|ZP_08242590.1| Thioredoxin [Acetobacter pomorum DM001]
 gi|326696829|gb|EGE48499.1| Thioredoxin [Acetobacter pomorum DM001]
          Length = 117

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L V   SFD +VL+ S  V+VDFWA WC PC  + P +++I  ELA KV + K++
Sbjct: 10  MSEHTLAVSDSSFDKDVLKASGLVLVDFWAEWCGPCKMIGPALEEIGKELAGKVTVAKVN 69

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ E    YQ+ SIPTL+L +DGKV+D+ + GA  +S +  W+   +
Sbjct: 70  IDDNPETPNAYQVRSIPTLMLVRDGKVVDKKV-GALPKSQLKAWVEGAL 117


>gi|302809585|ref|XP_002986485.1| hypothetical protein SELMODRAFT_124140 [Selaginella moellendorffii]
 gi|300145668|gb|EFJ12342.1| hypothetical protein SELMODRAFT_124140 [Selaginella moellendorffii]
          Length = 109

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  +F   VLE   PV+VDFWA WC PC  ++P+ID++A + A K++  KL+ +E   +
Sbjct: 8   VNDSTFQKLVLESDIPVLVDFWAPWCGPCRMIAPLIDELARQYAGKLRCLKLNTDECPNL 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT+I+F  G+  D ++ GA  +S +   I   +
Sbjct: 68  ATEYGIRSIPTVIIFVGGEKKDTVI-GAVPKSSLTSMIDKYL 108


>gi|90415272|ref|ZP_01223206.1| Thioredoxin [marine gamma proteobacterium HTCC2207]
 gi|90332595|gb|EAS47765.1| Thioredoxin [marine gamma proteobacterium HTCC2207]
          Length = 108

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +     SF+S+VL+   P +VDFWA+WC PC  ++P++D+++ E A +VKI K+D++ 
Sbjct: 4   AIVHTTDSSFESDVLQSDIPALVDFWAAWCGPCKMIAPLLDELSTEYAGRVKICKVDVDA 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           S E + ++ +  IPTL++FK+G V    + GA S++ ++E++ S
Sbjct: 64  SPETAAKFNVRGIPTLLVFKNGTVEATKV-GALSKAQLVEFVDS 106


>gi|302762963|ref|XP_002964903.1| hypothetical protein SELMODRAFT_82527 [Selaginella moellendorffii]
 gi|300167136|gb|EFJ33741.1| hypothetical protein SELMODRAFT_82527 [Selaginella moellendorffii]
          Length = 109

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  +F   VLE   PV+VDFWA WC PC  ++P+ID++A + A K++  KL+ +E   +
Sbjct: 8   VNDSTFQKLVLESDIPVLVDFWAPWCGPCRMIAPLIDELARQYAGKLRCLKLNTDECPNL 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT+I+F  G+  D ++ GA  +S +   I   +
Sbjct: 68  ATEYGIRSIPTVIIFVGGEKKDTVI-GAVPKSSLTSMIDKYL 108


>gi|73541805|ref|YP_296325.1| thioredoxin [Ralstonia eutropha JMP134]
 gi|113868368|ref|YP_726857.1| thioredoxin [Ralstonia eutropha H16]
 gi|194290037|ref|YP_002005944.1| thioredoxin 1 [Cupriavidus taiwanensis LMG 19424]
 gi|72119218|gb|AAZ61481.1| thioredoxin [Ralstonia eutropha JMP134]
 gi|113527144|emb|CAJ93489.1| Thioredoxin [Ralstonia eutropha H16]
 gi|193223872|emb|CAQ69881.1| thioredoxin 1 [Cupriavidus taiwanensis LMG 19424]
          Length = 108

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SFD++VL+   PV++DFWA WC PC  ++PI+D++A +  DK++I K++
Sbjct: 1   MSEQIKYVSDASFDADVLQSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+ ++  ++ I  IPTLILFK+G V  + + GA S+S +  ++   +
Sbjct: 61  VDENQQVPAKFGIRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDGNL 108


>gi|227540115|ref|ZP_03970164.1| thioredoxin [Sphingobacterium spiritivorum ATCC 33300]
 gi|300771840|ref|ZP_07081711.1| thioredoxin [Sphingobacterium spiritivorum ATCC 33861]
 gi|227239976|gb|EEI89991.1| thioredoxin [Sphingobacterium spiritivorum ATCC 33300]
 gi|300761226|gb|EFK58051.1| thioredoxin [Sphingobacterium spiritivorum ATCC 33861]
          Length = 105

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 69/106 (65%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+   PV+VDFWA WC PC  + P++++IA E   K  + K+D++
Sbjct: 1   MA-LEITDSNFEELVLKSDKPVLVDFWAEWCGPCRMVGPVVEEIAKEYEGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
            + EIS R+ I +IP L+ FK+G+++D+ + GA  +S + E +  +
Sbjct: 60  SNPEISVRFGIRNIPALLFFKNGEIVDKQV-GAVPKSVLTEKLNKQ 104


>gi|163738013|ref|ZP_02145429.1| thioredoxin [Phaeobacter gallaeciensis BS107]
 gi|163742591|ref|ZP_02149977.1| thioredoxin [Phaeobacter gallaeciensis 2.10]
 gi|161384176|gb|EDQ08559.1| thioredoxin [Phaeobacter gallaeciensis 2.10]
 gi|161388629|gb|EDQ12982.1| thioredoxin [Phaeobacter gallaeciensis BS107]
          Length = 106

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A E  DKVKI K+D++
Sbjct: 1   MSTVAVTDATFDAEVKNSEVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   ++   +  IP L +FK+G+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNAASAMGVRGIPALFIFKNGEVVSNR-SGAAPKAALQSWIDESI 106


>gi|282901325|ref|ZP_06309251.1| Thioredoxin [Cylindrospermopsis raciborskii CS-505]
 gi|281193820|gb|EFA68791.1| Thioredoxin [Cylindrospermopsis raciborskii CS-505]
          Length = 112

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +AL+V   SF+ EV++   PV+VDFWA WC PC  ++P++++IA + A K+K+ K++ +E
Sbjct: 3   AALEVTDASFEQEVIDSPIPVLVDFWAPWCGPCRMVAPVVEEIATQYAGKLKVVKINTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +  ++++Y I SIPTLI+FK+G  +   + GA  +S + + +  
Sbjct: 63  NPGVASKYGIRSIPTLIVFKEGVKVGLHV-GAVPKSTLSKTVEE 105


>gi|253575342|ref|ZP_04852680.1| thioredoxin [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845339|gb|EES73349.1| thioredoxin [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 105

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  +SF++E+ E   PV+VDFWA WC PC  ++PI++++  E+ D VKI KL+++
Sbjct: 1   MAIVNVSDQSFNAEI-EGQGPVLVDFWAPWCGPCKMIAPILEELDAEVGDSVKIAKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ E ++R+ + SIPTLILFKDG+ +D+++ G +S+  +   I   
Sbjct: 60  DNPETASRFGVMSIPTLILFKDGQPVDKIV-GLNSKDTLKNLIAKH 104


>gi|302879645|ref|YP_003848209.1| thioredoxin [Gallionella capsiferriformans ES-2]
 gi|302582434|gb|ADL56445.1| thioredoxin [Gallionella capsiferriformans ES-2]
          Length = 108

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +FD+EV++ + PV+VD+WA WC PC  ++PI+D+IA E A ++ I KL+++E+ + 
Sbjct: 8   VTDATFDAEVIQAALPVLVDYWAEWCGPCRMIAPILDEIAKEYAGRLTIAKLNVDENQQT 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ +  IPTL+LFK+G +    + GA S+S +  +I S +
Sbjct: 68  PQKFGVRGIPTLMLFKNGNIEATKV-GALSKSQLTAFIDSHI 108


>gi|71735462|ref|YP_272592.1| thioredoxin [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289624461|ref|ZP_06457415.1| thioredoxin [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289651578|ref|ZP_06482921.1| thioredoxin [Pseudomonas syringae pv. aesculi str. 2250]
 gi|71556015|gb|AAZ35226.1| thioredoxin [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320322168|gb|EFW78264.1| thioredoxin [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331819|gb|EFW87757.1| thioredoxin [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330866611|gb|EGH01320.1| thioredoxin [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330872822|gb|EGH06971.1| thioredoxin [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330886068|gb|EGH19969.1| thioredoxin [Pseudomonas syringae pv. mori str. 301020]
          Length = 109

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+    V+VD+WA WC PC  ++P++D+IAD  A K+ I KL
Sbjct: 1   MSNEKIKHVTDANFEAEVLKAEGAVLVDYWAEWCGPCKMIAPVLDEIADTYAGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 109


>gi|741034|prf||2006292A thioredoxin
          Length = 106

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   +F S+VLE   PV+V F   WC PC  ++P++D+IA+E   KVK+ K++ +E
Sbjct: 2   ATVKVTNATFKSDVLESDKPVLVHFEGPWCGPCKMVAPVLDEIANEYEGKVKVAKVNTDE 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +++++Y + SIPTL++FK G+V   M+ GA+ ++ +  ++ + +
Sbjct: 62  NPQLASQYGVRSIPTLLMFKGGEVAANMV-GAAPKTRLAAFLDASL 106


>gi|91974683|ref|YP_567342.1| thioredoxin [Rhodopseudomonas palustris BisB5]
 gi|91681139|gb|ABE37441.1| thioredoxin [Rhodopseudomonas palustris BisB5]
          Length = 106

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  KV    F++EVL+   PVVVDFWA WC PC  ++P +D+I+  + DKVKI KL+++
Sbjct: 1   MSVGKVSDADFETEVLKAQGPVVVDFWAEWCGPCRMIAPALDEISGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ ++ + +WI S V
Sbjct: 61  ESPVTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWISSAV 106


>gi|328954742|ref|YP_004372075.1| thioredoxin [Coriobacterium glomerans PW2]
 gi|328455066|gb|AEB06260.1| thioredoxin [Coriobacterium glomerans PW2]
          Length = 107

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 69/103 (66%), Gaps = 2/103 (1%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           ++   +FD  V++   PV+VDFWA WC PC  LSPI++ +A+E+++++ + K +++E+ +
Sbjct: 7   ELTLDNFD-LVMQSKLPVLVDFWAPWCGPCRTLSPIVEQVAEEMSERITVAKCNVDENQD 65

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +Y + SIPTL+LF+DG  + R + GA  +  ++  I   +
Sbjct: 66  LAMKYGVMSIPTLVLFRDGAEVSRTV-GAMPKPKLVAEIEKNL 107


>gi|317131130|ref|YP_004090444.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
 gi|315469109|gb|ADU25713.1| thioredoxin [Ethanoligenens harbinense YUAN-3]
          Length = 107

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F+  VL    PV++DFWASWC PC   SP+I+++A++L     + KL+++
Sbjct: 1   MSAISLNRSNFEDVVLNTDKPVLIDFWASWCGPCRMQSPVIEELAEKLEGAAVVAKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E+ E++ ++ + SIPTL+  KDG+++ R   G +S ++++  + 
Sbjct: 61  ENPELAAQFSVMSIPTLVFVKDGRIVGRR-TGVTSGAELLSILR 103


>gi|154721452|gb|ABS84825.1| thioredoxin [Limonium bicolor]
          Length = 187

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   S+ S VLE  +PV+V+FWA WC PC  + PIID++A +   K+K  K++ +ES
Sbjct: 84  VQSVTDSSWQSLVLESDSPVLVEFWAPWCGPCRMIHPIIDELAKQYTGKLKCFKVNTDES 143

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+TRY I SIPT+++FK+G+  D ++ GA  +S +   I   +
Sbjct: 144 PSIATRYGIRSIPTVMIFKNGEKKDAVI-GAVPKSTLTTSIEKFL 187


>gi|300864796|ref|ZP_07109646.1| thioredoxin [Oscillatoria sp. PCC 6506]
 gi|300337200|emb|CBN54794.1| thioredoxin [Oscillatoria sp. PCC 6506]
          Length = 107

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A +V   +F  EVLE   PV+VDFWA WC PC  ++P++D+IA +   +VK+ K++ +E
Sbjct: 3   AAAQVTDSTFKQEVLESEVPVLVDFWAPWCGPCRMVAPVVDEIAQQYDGQVKVVKVNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  ++++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 63  NPNVASQYGIRSIPTLMIFKAGQRVD-MVVGAVPKTTLSNTLEKYL 107


>gi|51893542|ref|YP_076233.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
 gi|51857231|dbj|BAD41389.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
          Length = 112

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 74/110 (67%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + +   ++ +EV + S PV+VDFWA WC PC  ++P++++IA +   ++K+ KL
Sbjct: 1   MAGDKVVTLSASNWAAEVEQSSLPVLVDFWAVWCGPCRMIAPVVEEIAADYEGRMKVGKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+++++ RY + SIPTLILFK+G+ ++R++ G   + ++   I   +
Sbjct: 61  NVDENNDLAARYGVMSIPTLILFKNGEPVERIV-GFQPKKELAAKIDRAL 109


>gi|192910920|gb|ACF06568.1| disulfide-isomerase precursor-like protein [Elaeis guineensis]
          Length = 363

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + +   +F+  VL+ +  V+V+F+A WC  C  L+P  + +A     +  +   +I+ 
Sbjct: 146 SVVVLTADNFNEVVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAYKLEEDVVIANIDA 205

Query: 62  SS--EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               +++ +Y +S  PTL  F  G        G     + +++I  +
Sbjct: 206 DKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLDEFVKFINEK 252



 Score = 84.5 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 51/106 (48%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
              +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  + I K+D +
Sbjct: 29  VFVLTEANFEEEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGSSYKKAKSILIGKVDCD 87

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ + 
Sbjct: 88  EHKSLCSKYGVSGYPTIQWFAKGSLEPKKYEGPRTAEALAEFVNNE 133


>gi|116249791|ref|YP_765629.1| thioredoxin [Rhizobium leguminosarum bv. viciae 3841]
 gi|241206968|ref|YP_002978064.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|115254439|emb|CAK05513.1| putative thioredoxin [Rhizobium leguminosarum bv. viciae 3841]
 gi|240860858|gb|ACS58525.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 106

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 74/106 (69%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++IA E+  KVK+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEIAVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E++ ++ + SIPTL +FK G+V D  + GA  ++ +  WI S 
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADISV-GAKPKTALSNWISSA 105


>gi|237797986|ref|ZP_04586447.1| thioredoxin [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331020837|gb|EGI00894.1| thioredoxin [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 109

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 67/110 (60%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+    V+VD+WA WC PC  ++P++D+IA     K+ + KL
Sbjct: 1   MSNDLIKNVTDATFEAEVLKADGAVLVDYWAEWCGPCKMIAPVLDEIATTYQGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ +   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQDTPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 109


>gi|329847173|ref|ZP_08262201.1| thioredoxin [Asticcacaulis biprosthecum C19]
 gi|328842236|gb|EGF91805.1| thioredoxin [Asticcacaulis biprosthecum C19]
          Length = 108

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/105 (41%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  K+   SF+++VL+ S PV+VDFWA WC PC +++PI++++++ L DK+KI KL+IE
Sbjct: 1   MATHKITDDSFEADVLKSSTPVLVDFWAEWCGPCKQIAPILEELSEGLGDKIKIAKLNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +S    +R+ +  IPT+ILFKDG++    + GA  ++ ++EW+  
Sbjct: 61  DSPMTPSRFGVRGIPTMILFKDGQMTSMKV-GALPKAKLLEWLNE 104


>gi|51891385|ref|YP_074076.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
 gi|51855074|dbj|BAD39232.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
          Length = 114

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + +   +F++EVL+   PV+VDFWA WC PC  + P++++ A +   ++KI KL+
Sbjct: 1   MAQYTVPITDATFEAEVLQSELPVLVDFWAPWCGPCRMIGPVLEEYARDNGHRIKIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E  E + R+ + SIPT+ILF  GK + +++ G   + ++ + + S +
Sbjct: 61  VDEEQEWAGRFGVMSIPTMILFHKGKPVGQLV-GFRPKHEMYQILDSAL 108


>gi|84685772|ref|ZP_01013668.1| thioredoxin [Maritimibacter alkaliphilus HTCC2654]
 gi|84665865|gb|EAQ12339.1| thioredoxin [Rhodobacterales bacterium HTCC2654]
          Length = 106

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +F+ EVL+   PVVVDFWA WC PC  + P +++++ E  DKVKI K++++
Sbjct: 1   MATVAVTDATFEEEVLKSDVPVVVDFWAEWCGPCKMIGPALEELSTEYGDKVKIAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L +FK G+ I   + GA+ ++ +  WI   +
Sbjct: 61  ENPNSPAQLGVRGIPALFMFKGGQPISNKV-GAAPKAALQSWIDESI 106


>gi|257481842|ref|ZP_05635883.1| thioredoxin [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|330986781|gb|EGH84884.1| thioredoxin [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331009477|gb|EGH89533.1| thioredoxin [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 109

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+    V+VD+WA WC PC  ++P++D+IAD  A K+ I KL
Sbjct: 1   MSNEKIKHVTDANFEAEVLKAEGAVLVDYWAEWCGPCKMIAPVLDEIADTYAGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFKDG V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQETPAKHGVRGIPTLMLFKDGNVEATKV-GALSKSQLAAFLDANI 109


>gi|229593268|ref|YP_002875387.1| thioredoxin [Pseudomonas fluorescens SBW25]
 gi|229365134|emb|CAY53370.1| thioredoxin [Pseudomonas fluorescens SBW25]
          Length = 109

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+ + PV+VD+WA WC PC  ++P++DDIA     K+ I KL
Sbjct: 1   MSNDLIKHVTDATFEAEVLKAAGPVLVDYWAEWCGPCKMIAPVLDDIATTYEGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDDNQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLQAFLDANI 109


>gi|77745442|gb|ABB02620.1| disulfide-isomerase precursor-like protein [Solanum tuberosum]
          Length = 359

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVK--ITKLDI 59
           S + + + +FD  VL+ +  V+V+F+A WC  C  L+PI + +A     +    I  LD 
Sbjct: 143 SVVVLSSDNFDEIVLDETKDVLVEFYAPWCGHCKSLAPIYEKVATAFRQEEDVVIANLDA 202

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +   +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 203 DNHKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDTDDFVNFINEK 249



 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +  ++FD E+       +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 26  VVVLTEENFDKEI-GHDRAALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKIDCD 84

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   I ++Y +   PT+  F  G +  +   GA S   + E++ S 
Sbjct: 85  EHKSICSKYGVQGYPTIQWFPKGSLEPKKYEGARSAEGLAEYVNSE 130


>gi|298345827|ref|YP_003718514.1| thioredoxin [Mobiluncus curtisii ATCC 43063]
 gi|304390470|ref|ZP_07372423.1| thioredoxin [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|298235888|gb|ADI67020.1| thioredoxin [Mobiluncus curtisii ATCC 43063]
 gi|304326226|gb|EFL93471.1| thioredoxin [Mobiluncus curtisii subsp. curtisii ATCC 35241]
          Length = 108

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A++V   +F +EVLE   PV+VDFWA WC PC +++PI+D IA +  D++K+ K D+++
Sbjct: 3   AAIEVTESNFAAEVLESDVPVLVDFWAVWCGPCRQMAPIVDQIAADFGDRLKVAKCDVDK 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  +  +Y +S+IPT  +FK GKV+ +++ G   +S   E I + +
Sbjct: 63  NPSLQAQYGVSAIPTFNIFKGGKVVHQIIGG-RPRSQFKEEIEAAL 107


>gi|126738526|ref|ZP_01754231.1| thioredoxin [Roseobacter sp. SK209-2-6]
 gi|126720325|gb|EBA17031.1| thioredoxin [Roseobacter sp. SK209-2-6]
          Length = 106

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V  ++FD+EV   S PVVVDFWA WC PC ++ P ++++A E  DKVKI K+D++
Sbjct: 1   MSTVAVTDETFDAEVKNSSVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGQVVSNR-AGAAPKAALQSWIDESI 106


>gi|42523902|ref|NP_969282.1| thioredoxin [Bdellovibrio bacteriovorus HD100]
 gi|39576109|emb|CAE80275.1| thioredoxin [Bdellovibrio bacteriovorus HD100]
          Length = 108

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SFD+EVL  S PV+VDFWA WC PC  L+P ++++A EL  KVKI K++++E+  +
Sbjct: 8   VTDTSFDAEVLNSSTPVLVDFWAEWCGPCRALAPKLEEVAQELGAKVKIVKVNVDENPSV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y I  IP ++LFK G  + +++ G   +  I+E++   V
Sbjct: 68  PGKYGIRGIPAMLLFKGGSEVGQLV-GNHPKDAILEFLNKNV 108


>gi|159040578|ref|YP_001539831.1| thioredoxin [Salinispora arenicola CNS-205]
 gi|157919413|gb|ABW00841.1| thioredoxin [Salinispora arenicola CNS-205]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 73/102 (71%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF ++VL+   PV+VDFWA WC PC K+SP++++IA E+AD+V I KL+I+E+ E 
Sbjct: 7   VTDASFTTDVLKSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMADQVTIVKLNIDENPET 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  Y++ S+PTL +FK+G+ + + + GA  + ++I+ I S +
Sbjct: 67  ARNYRVMSVPTLTVFKNGEPV-QSIAGAKPKGELIKLIQSAL 107


>gi|260463225|ref|ZP_05811427.1| thioredoxin [Mesorhizobium opportunistum WSM2075]
 gi|259031075|gb|EEW32349.1| thioredoxin [Mesorhizobium opportunistum WSM2075]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 74/104 (71%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F ++VL  + PVVVDFWA WC PC  ++P ++DIA EL  KVKI KL+I+
Sbjct: 1   MTTVKVDKSNFQADVLNANVPVVVDFWAEWCGPCKMIAPALEDIATELGAKVKIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E+ E++ ++ + SIPTL++FK G+V D  + GA+ ++ +  WI 
Sbjct: 61  ENPELAAQFGVRSIPTLMIFKGGEVADMKV-GAAPKTALSHWIN 103


>gi|197103665|ref|YP_002129042.1| thioredoxin [Phenylobacterium zucineum HLK1]
 gi|196477085|gb|ACG76613.1| thioredoxin [Phenylobacterium zucineum HLK1]
          Length = 109

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS +KV  +SF+++VL+   PV+VDFWA WC PC +++P ++ ++DELADKV I KL+IE
Sbjct: 1   MSTVKVTDESFETDVLQAERPVLVDFWAEWCGPCKQIAPALEQLSDELADKVTIAKLNIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ES    +RY +  IPT++LFK G++    + GA  +  I+EW+   
Sbjct: 61  ESPTTPSRYGVRGIPTMMLFKGGQMASMKV-GAMPKQKILEWLTEA 105


>gi|103485652|ref|YP_615213.1| thioredoxin [Sphingopyxis alaskensis RB2256]
 gi|98975729|gb|ABF51880.1| thioredoxin [Sphingopyxis alaskensis RB2256]
          Length = 106

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    +   SF ++VL+   PV+VDFWA WC PC  + P +++I+DELA KV I KL+I+
Sbjct: 1   MGTKAITDASFQADVLDSETPVLVDFWAEWCGPCKMIGPALEEISDELAGKVVIAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  +  ++Y +  IPT+ILFK+G++ D  + GA+ +S +  W+   +
Sbjct: 61  DHPDAPSKYGVRGIPTMILFKNGEIADTKV-GAAPKSALKGWLEGAL 106


>gi|258655498|ref|YP_003204654.1| thioredoxin [Nakamurella multipartita DSM 44233]
 gi|258558723|gb|ACV81665.1| thioredoxin [Nakamurella multipartita DSM 44233]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/101 (40%), Positives = 71/101 (70%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SF ++VL+   PV+VDFWA WC PC  ++PI+++IA +   KV + KLDI+
Sbjct: 1   MATVKVTDDSFTTDVLQSDKPVIVDFWAEWCGPCRMVAPILEEIATKHEGKVTVAKLDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
            + +I+ +YQI SIPT+++F+ GK + +++ GA  ++ ++ 
Sbjct: 61  ANPQIAQQYQILSIPTMLVFQGGKPVKQVV-GAKPKAALLA 100


>gi|237653741|ref|YP_002890055.1| thioredoxin [Thauera sp. MZ1T]
 gi|237624988|gb|ACR01678.1| thioredoxin [Thauera sp. MZ1T]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   +FD EVL+   PV+VD+WA WC PC  ++PI+DD+A + A K+K+ KL+
Sbjct: 1   MSEHIHHVTDGNFDDEVLQSQTPVLVDYWAEWCGPCKMIAPILDDVAKDYAGKLKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ E   +Y I  IPTL+LFK G V    + GA S+S +  +I S +
Sbjct: 61  IDDNQETPAKYGIRGIPTLMLFKGGNVEATKV-GALSKSQLTAFIDSNI 108


>gi|260431947|ref|ZP_05785918.1| thioredoxin [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415775|gb|EEX09034.1| thioredoxin [Silicibacter lacuscaerulensis ITI-1157]
          Length = 106

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V  ++FD+EV     PVVVDFWA WC PC ++ P ++++A E  DK+KI K+D++
Sbjct: 1   MSTVAVTDETFDAEVRNSDVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKIKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGQVVSNR-AGAAPKAALQSWIEESI 106


>gi|160900337|ref|YP_001565919.1| thioredoxin [Delftia acidovorans SPH-1]
 gi|160365921|gb|ABX37534.1| thioredoxin [Delftia acidovorans SPH-1]
          Length = 110

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   SF+++VL+    V+VD+WA WC PC  ++PI+D+ A    +K+ I K+
Sbjct: 1   MASELIKHISDASFEADVLQPGTTVLVDYWAEWCGPCKMIAPILDEAAQTYKEKLSIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ EI  ++ I  IPTL+LFKDG++    + GA +++ +  ++   +
Sbjct: 61  NVDENREIPAKFGIRGIPTLMLFKDGQLAATKV-GALNKAQLSAFLEQHL 109


>gi|288553652|ref|YP_003425587.1| thioredoxin [Bacillus pseudofirmus OF4]
 gi|288544812|gb|ADC48695.1| thioredoxin [Bacillus pseudofirmus OF4]
          Length = 104

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  ++F SE       V+ DFWA WC PC  ++P+++++  E+ DKVKI KLD++
Sbjct: 1   MAIVNVTDQTFASET--SEGVVLADFWAPWCGPCKMIAPVLEELDTEMGDKVKIAKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E + +Y + SIPTL++FKDG V+D+++ G   +  + E +   +
Sbjct: 59  ENQETAGKYSVMSIPTLLVFKDGDVVDQVV-GFQPKEALAELLNKHL 104


>gi|149176738|ref|ZP_01855349.1| thioredoxin [Planctomyces maris DSM 8797]
 gi|148844379|gb|EDL58731.1| thioredoxin [Planctomyces maris DSM 8797]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   L+    +F SEVLE S PV+VDFWA WC PC  + P I++IA + + +V++ KL+
Sbjct: 1   MAENVLEFTDANFQSEVLEASEPVLVDFWAPWCGPCKMMMPTIEEIASDYSGRVRVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +E+  I++   I++IPT++L+K+G+V+++ + G + +      + S++
Sbjct: 61  TDENPGIASASSINAIPTVMLYKNGEVVEKFV-GVTPKERFAASLDSQL 108


>gi|94986811|ref|YP_594744.1| Thiol-disulfide isomerase and thioredoxins [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731060|emb|CAJ54423.1| Thiol-disulfide isomerase and thioredoxins [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A +V   +FD+ VL+ + PV+VDFWA WC PC  + PIID+IA E A  + + KL+++
Sbjct: 1   MAA-QVTDTNFDTIVLKSNKPVLVDFWAPWCGPCRAIGPIIDEIALEYASDIHVVKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E++    +Y I +IPTLILFK+G+V++++  GA S++ II  +  +
Sbjct: 60  ENTITPGQYGIKAIPTLILFKNGEVVEQL-TGAVSKTSIITMLKEK 104


>gi|332712300|ref|ZP_08432228.1| thioredoxin [Lyngbya majuscula 3L]
 gi|332349106|gb|EGJ28718.1| thioredoxin [Lyngbya majuscula 3L]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF  EVLE   PV+VDFWA WC PC  +SP++D+IAD+   +VK+ KL+ +E+ ++
Sbjct: 7   VTDSSFQKEVLESDIPVLVDFWAPWCGPCRMVSPVVDEIADQYEGQVKVVKLNTDENPKV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 67  AGDYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLGNTLEKHL 107


>gi|258592171|emb|CBE68480.1| thioredoxin 1, redox factor [NC10 bacterium 'Dutch sediment']
          Length = 109

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + +    FD +V++    ++VDFWA WC PC  ++PI+D++A E   +V I KL
Sbjct: 1   MASDKVVHITDHDFDEQVIKGKGLILVDFWAEWCGPCRMVAPILDELATEYEGQVTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ + + R+ I SIPT++LFKDG  +++++ GA  +S I   +   +
Sbjct: 61  NVDENRQSAARFGIRSIPTILLFKDGAQVEQII-GALPKSAIKAKVQQHL 109


>gi|90023295|ref|YP_529122.1| thioredoxin [Saccharophagus degradans 2-40]
 gi|89952895|gb|ABD82910.1| thioredoxin [Saccharophagus degradans 2-40]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 68/106 (64%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++V   SF+ +VL    PV+VD+WA+WC PC  ++P++D++A E   K+KI K+D++ 
Sbjct: 4   AIVQVSDASFEQDVLSSDIPVLVDYWAAWCGPCKMIAPVLDELAKEYEGKIKICKMDVDA 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E   +Y I  IPTLI+FK G      + GA S++ + E+I + +
Sbjct: 64  NKETPAKYNIRGIPTLIMFKGGNAEGTKV-GALSKAQLKEFIDASL 108


>gi|323702212|ref|ZP_08113879.1| thioredoxin [Desulfotomaculum nigrificans DSM 574]
 gi|323532899|gb|EGB22771.1| thioredoxin [Desulfotomaculum nigrificans DSM 574]
          Length = 105

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 81/107 (75%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ ++++  +F++EVL+   PV+VDFWA+WC PC  ++PI++ ++ E A KVKI K++++
Sbjct: 1   MA-MELNAANFETEVLKADIPVLVDFWAAWCGPCRAIAPIVEQLSTEFAGKVKIGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++ ++ + SIPTLI FK+G+ +D+++ G +S++D+ + + + +
Sbjct: 60  ENRDLAQQFGVMSIPTLIFFKNGEKVDQVI-GFTSKADLEKKLNALL 105


>gi|325104968|ref|YP_004274622.1| thioredoxin [Pedobacter saltans DSM 12145]
 gi|324973816|gb|ADY52800.1| thioredoxin [Pedobacter saltans DSM 12145]
          Length = 106

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 73/107 (68%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+   PV+VDFWA WC PC  + P+++++A E   K  + K++++
Sbjct: 1   MA-LEITDANFEELVLKSDKPVLVDFWAEWCGPCRMVGPVVEELAKEYEGKAVVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +SEIS ++ I +IPTL++FK+G+++D+ + GA  +S +   + +++
Sbjct: 60  HNSEISAKFGIRNIPTLLVFKNGEIVDKQV-GAVPKSILAGKLDNQL 105


>gi|254000026|ref|YP_003052089.1| thioredoxin [Methylovorus sp. SIP3-4]
 gi|313202002|ref|YP_004040660.1| thioredoxin [Methylovorus sp. MP688]
 gi|253986705|gb|ACT51562.1| thioredoxin [Methylovorus sp. SIP3-4]
 gi|312441318|gb|ADQ85424.1| thioredoxin [Methylovorus sp. MP688]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   +F+ EVL+   PV+VD+WA WC PC  ++PI+D++A E   ++K+ KL+
Sbjct: 1   MSDHITHISDSAFEQEVLQSQVPVLVDYWAEWCGPCKMIAPILDEVAKEYEGRLKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   +Y I  IPTL+LFK+G V    + GA S+S +  +I S +
Sbjct: 61  IDENQQTPPKYGIRGIPTLMLFKNGNVEATKV-GALSKSQLTAFIDSNI 108


>gi|315654400|ref|ZP_07907308.1| thioredoxin [Mobiluncus curtisii ATCC 51333]
 gi|315491435|gb|EFU81052.1| thioredoxin [Mobiluncus curtisii ATCC 51333]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A++V   +F +EVL+   PV+VDFWA WC PC +++PI+D IA +  D++K+ K D+++
Sbjct: 3   AAIEVTESNFAAEVLDSDVPVLVDFWAVWCGPCRQMAPIVDQIAADFGDRLKVAKCDVDK 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  +  +Y +S+IPT  +FK GKV+ +++ G   +S   E I + +
Sbjct: 63  NPSLQAQYGVSAIPTFNIFKGGKVVHQIIGG-RPRSQFKEEIEAAL 107


>gi|315497133|ref|YP_004085937.1| thioredoxin [Asticcacaulis excentricus CB 48]
 gi|315415145|gb|ADU11786.1| thioredoxin [Asticcacaulis excentricus CB 48]
          Length = 110

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV  ++F+++VL+   PV+VDFWA WC PC +++PI+D++A+   DK+ ++K++I++
Sbjct: 4   ATVKVTDETFENDVLKSDKPVLVDFWAEWCGPCKQIAPILDEVAEAYGDKLTVSKINIDD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           S    +++ +  IPT++LFKDGK+    + GA  +S ++EW+   
Sbjct: 64  SPLTPSKFGVRGIPTMMLFKDGKMTSMKV-GAMPKSKLVEWLTEA 107


>gi|313114720|ref|ZP_07800222.1| thioredoxin [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310622945|gb|EFQ06398.1| thioredoxin [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 102

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F+ EVL+ + PV++DFWASWC PC  LSP++D++A+E    VK+ K++++
Sbjct: 1   MAVVTITKENFEQEVLQSAKPVLLDFWASWCGPCRMLSPVVDEVAEE-RTDVKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ + SIPTL++F+ GK++ + + GA  ++ +++ +
Sbjct: 60  EQPELAGQFGVMSIPTLLVFEQGKLVRQAV-GARPKASVLDLL 101


>gi|237745454|ref|ZP_04575934.1| thioredoxin [Oxalobacter formigenes HOxBLS]
 gi|229376805|gb|EEO26896.1| thioredoxin [Oxalobacter formigenes HOxBLS]
          Length = 132

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   +   SF+++VL+   PV+VDFWA WC PC  ++PIID++A E A K+   K+D++ 
Sbjct: 28  TIKTISDASFETDVLKSDKPVLVDFWAEWCGPCKMVAPIIDEVAKEYAGKLNFAKMDVDS 87

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     ++ I  IPTLILFK+G ++ + + GA S++ ++ +I S +
Sbjct: 88  NQVTPAKFGIRGIPTLILFKNGAIVSQKV-GALSKNQLMAFIDSNI 132


>gi|218437805|ref|YP_002376134.1| thioredoxin [Cyanothece sp. PCC 7424]
 gi|218170533|gb|ACK69266.1| thioredoxin [Cyanothece sp. PCC 7424]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF  EVL+   PV+VDFWA WC PC  ++P++D+IA++ A +VK+ KL+ +E+  +
Sbjct: 7   VTDDSFKQEVLDSEIPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQVKVVKLNTDENPSV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 67  ASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLSNTLEKYL 107


>gi|91228020|ref|ZP_01262105.1| thioredoxin [Vibrio alginolyticus 12G01]
 gi|153834681|ref|ZP_01987348.1| thioredoxin [Vibrio harveyi HY01]
 gi|156972679|ref|YP_001443586.1| thioredoxin [Vibrio harveyi ATCC BAA-1116]
 gi|262392871|ref|YP_003284725.1| thioredoxin [Vibrio sp. Ex25]
 gi|269962285|ref|ZP_06176637.1| thioredoxin [Vibrio harveyi 1DA3]
 gi|269964530|ref|ZP_06178769.1| thioredoxin [Vibrio alginolyticus 40B]
 gi|91188249|gb|EAS74548.1| thioredoxin [Vibrio alginolyticus 12G01]
 gi|148868877|gb|EDL67937.1| thioredoxin [Vibrio harveyi HY01]
 gi|156524273|gb|ABU69359.1| hypothetical protein VIBHAR_00337 [Vibrio harveyi ATCC BAA-1116]
 gi|262336465|gb|ACY50260.1| thioredoxin [Vibrio sp. Ex25]
 gi|269830657|gb|EEZ84877.1| thioredoxin [Vibrio alginolyticus 40B]
 gi|269832988|gb|EEZ87095.1| thioredoxin [Vibrio harveyi 1DA3]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDHNAGTPPKFGIRGIPTLLLFKDGNVAATKV-GALSKTQLKEFLDANL 108


>gi|193215618|ref|YP_001996817.1| thioredoxin [Chloroherpeton thalassium ATCC 35110]
 gi|193089095|gb|ACF14370.1| thioredoxin [Chloroherpeton thalassium ATCC 35110]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/101 (43%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F SEVL+   PV+VDFWA WC PC  ++P+I+++A E   K KI KL+++E+ +IS
Sbjct: 8   TDQNFQSEVLQSDVPVLVDFWAVWCGPCRMIAPVIEELASEYEGKAKIAKLNVDENPQIS 67

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             Y I SIPTL++FK+G+V+D+++ GA  ++ I   + S++
Sbjct: 68  MAYGIRSIPTLLIFKNGEVVDQLV-GAVPKNVIAGKLNSQL 107


>gi|303273358|ref|XP_003056040.1| thioredoxin [Micromonas pusilla CCMP1545]
 gi|226462124|gb|EEH59416.1| thioredoxin [Micromonas pusilla CCMP1545]
          Length = 163

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F+SEVL+   PV+VDFWA WC PC  ++P+ID +A+E A K+K  KL+ +ES  +
Sbjct: 63  VTDATFESEVLQSEVPVLVDFWAPWCGPCRMIAPLIDQLAEEYAGKLKAVKLNTDESPSV 122

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT+++FK G+ +D ++ GA  +S +   I   +
Sbjct: 123 ATEYGIRSIPTVMIFKGGQKLDTVI-GAVPKSTLTGTIEKYL 163


>gi|261856914|ref|YP_003264197.1| thioredoxin [Halothiobacillus neapolitanus c2]
 gi|261837383|gb|ACX97150.1| thioredoxin [Halothiobacillus neapolitanus c2]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  +FD EVL+   PV+VD+WA WC PC  ++PI+D+IAD+   KVK+ KL+I+E+ E 
Sbjct: 8   VNDSNFDQEVLKSDLPVLVDYWAEWCGPCRMIAPILDEIADQYDGKVKVAKLNIDENPET 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ I  IPTL+LFK+GKV    + GA S+S +  +I   +
Sbjct: 68  PRQHAIRGIPTLMLFKNGKVEGTKV-GAVSKSQLTAFIDGAL 108


>gi|15828461|ref|NP_302724.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           leprae TN]
 gi|221230938|ref|YP_002504354.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           leprae Br4923]
 gi|1174807|sp|P46843|TRXB_MYCLE RecName: Full=Bifunctional thioredoxin reductase/thioredoxin;
           Includes: RecName: Full=Thioredoxin reductase;
           Short=TRXR; Includes: RecName: Full=Thioredoxin
 gi|871419|emb|CAA61150.1| thioredoxin /thioredoxin reductase hybrid protein [Mycobacterium
           leprae]
 gi|886315|gb|AAB53131.1| thioredoxin reductase/thioredoxin [Mycobacterium leprae]
 gi|13093891|emb|CAC32235.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           leprae]
 gi|219934045|emb|CAR72803.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium
           leprae Br4923]
          Length = 458

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/98 (36%), Positives = 70/98 (71%), Gaps = 1/98 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            ++V   SF ++VL  + PV+VDFWA+WC PC  ++P++++IA E  +++ + KLD++ +
Sbjct: 351 TIEVTDASFFADVLSSNKPVLVDFWATWCGPCKMVAPVLEEIASEQRNQLTVAKLDVDTN 410

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
            E++  +Q+ SIPT+ILF+ G+ + R++ GA  ++ ++
Sbjct: 411 PEMAREFQVVSIPTMILFQGGQPVKRIV-GAKGKAALL 447


>gi|28899775|ref|NP_799380.1| thioredoxin [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839100|ref|ZP_01991767.1| thioredoxin [Vibrio parahaemolyticus AQ3810]
 gi|260362508|ref|ZP_05775434.1| thioredoxin [Vibrio parahaemolyticus K5030]
 gi|260877188|ref|ZP_05889543.1| thioredoxin [Vibrio parahaemolyticus AN-5034]
 gi|260897232|ref|ZP_05905728.1| thioredoxin [Vibrio parahaemolyticus Peru-466]
 gi|260901364|ref|ZP_05909759.1| thioredoxin [Vibrio parahaemolyticus AQ4037]
 gi|28808027|dbj|BAC61264.1| thioredoxin [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747396|gb|EDM58360.1| thioredoxin [Vibrio parahaemolyticus AQ3810]
 gi|308088940|gb|EFO38635.1| thioredoxin [Vibrio parahaemolyticus Peru-466]
 gi|308094140|gb|EFO43835.1| thioredoxin [Vibrio parahaemolyticus AN-5034]
 gi|308107210|gb|EFO44750.1| thioredoxin [Vibrio parahaemolyticus AQ4037]
 gi|308112668|gb|EFO50208.1| thioredoxin [Vibrio parahaemolyticus K5030]
 gi|328471327|gb|EGF42226.1| thioredoxin [Vibrio parahaemolyticus 10329]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDHNAGTPPKFGIRGIPTLLLFKDGNVAATKV-GALSKTQLKEFLDANL 108


>gi|83950791|ref|ZP_00959524.1| thioredoxin [Roseovarius nubinhibens ISM]
 gi|83838690|gb|EAP77986.1| thioredoxin [Roseovarius nubinhibens ISM]
          Length = 106

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV     PVVVDFWA WC PC ++ P +++IA E+  KVKI K+D++
Sbjct: 1   MATVAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEEIAAEMGGKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   + +  +  IP L +FK+G+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNSAAQMGVRGIPALFIFKNGEVVSNR-AGAAPKAALQSWIEESI 106


>gi|169632014|ref|YP_001705663.1| thioredoxin (Trx) [Mycobacterium abscessus ATCC 19977]
 gi|169243981|emb|CAM65009.1| Thioredoxin (Trx) [Mycobacterium abscessus]
          Length = 109

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   SF  +V+  + PV+VDFWA+WC PC  ++P++++IA +  + + I KLD++ 
Sbjct: 5   ATVTVTDDSFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDA 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           + E +  +Q++SIPTLILF++G+   R++ GA S+S ++  + 
Sbjct: 65  NPETARAFQVTSIPTLILFQNGEATKRIV-GAKSKSALLRELD 106


>gi|156743275|ref|YP_001433404.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
 gi|156234603|gb|ABU59386.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
          Length = 259

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +   +FD  V     PV+VDFWA WC PC  ++P+++ +A E A +  + KL+++E+ 
Sbjct: 152 ITLTDATFDQVVGASHQPVLVDFWAPWCGPCRAVAPVVERLAQEFAGRAVVAKLNVDENP 211

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
             + R+ I SIP+L +FKDG+V++R++ GA     + + +   
Sbjct: 212 RTAQRFGIRSIPSLHIFKDGRVVERLI-GAQPYPVLRQALERH 253



 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           VL    PV++ F    C  C +L P ++ +A   A +  + ++D +++  ++ +Y I+++
Sbjct: 17  VLRAGLPVLLIFDRKECPTCQRLDPTLERLASIFAGRALLARVDADDNPALAQQYGITAL 76

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           P LI  K+G  I R   G  ++  +  W+
Sbjct: 77  PGLIFVKNGAPIAR-TSGVVAEEALRAWL 104


>gi|146328748|ref|YP_001209642.1| thioredoxin I [Dichelobacter nodosus VCS1703A]
 gi|146232218|gb|ABQ13196.1| thioredoxin I [Dichelobacter nodosus VCS1703A]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 73/102 (71%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+   F S+VL+ + PV+VDFWA WC PC  L+P++++ A E A K+ + K++++++ +I
Sbjct: 7   VNEADFQSQVLDANVPVLVDFWAEWCGPCRALAPVLEEFAAEQAGKLAVAKVNVDDNGDI 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + ++ I SIPTLILFK+G+ +DR++ G +S++ +  ++   +
Sbjct: 67  AAQFGIRSIPTLILFKNGQQVDRIV-GLASKAQLSNFVAPHL 107


>gi|319407898|emb|CBI81552.1| thioredoxin [Bartonella schoenbuchensis R1]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 50/105 (47%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K D  +F +EVL  S PVVVDFWA WC PC  ++PI+D+I+ E+  +VKI K++I+
Sbjct: 1   MTCIKADNSNFKNEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQGQVKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++T+Y + SIPTL++FK+G  I   M GA S+  + EWI  
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGN-ISSHMVGAVSKGRLCEWIKE 104


>gi|251793110|ref|YP_003007836.1| thioredoxin [Aggregatibacter aphrophilus NJ8700]
 gi|247534503|gb|ACS97749.1| thioredoxin [Aggregatibacter aphrophilus NJ8700]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L     +F ++V+    PV++DFWA WC PC  ++PI+DD+A E A KVKI K++I
Sbjct: 1   MSEVLHSSDATFVADVVNSDVPVLLDFWAPWCGPCKMIAPILDDLAVEFAGKVKIVKINI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+LFKDGK +   + GA  ++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLFKDGKPVATQV-GALPKNQLAAFINQNI 107


>gi|16331825|ref|NP_442553.1| thioredoxin [Synechocystis sp. PCC 6803]
 gi|1729952|sp|P52231|THIO_SYNY3 RecName: Full=Thioredoxin; Short=Trx
 gi|515940|emb|CAA56653.1| thioredoxin [Synechocystis sp. PCC 6803]
 gi|1208455|dbj|BAA10623.1| thioredoxin [Synechocystis sp. PCC 6803]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 1   MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MSA  +V   SF  +VL+   PV+VDFWA WC PC  ++P++D+I+ +   KVK+ KL+ 
Sbjct: 1   MSATPQVSDASFKEDVLDSELPVLVDFWAPWCGPCRMVAPVVDEISQQYEGKVKVVKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+   +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 61  DENPNTASQYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLASTLEKYL 107


>gi|113476827|ref|YP_722888.1| thioredoxin [Trichodesmium erythraeum IMS101]
 gi|110167875|gb|ABG52415.1| thioredoxin [Trichodesmium erythraeum IMS101]
          Length = 125

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
             +V   SFD +VL    PV+VDFWA WC PC  ++P++ +IA +  DKVK+ KL+ +E+
Sbjct: 13  VPQVTDSSFDKDVLHSDIPVLVDFWAPWCGPCKMVAPVVSEIAQQFKDKVKVVKLNTDEN 72

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 73  PNTASKYGIRSIPTLMIFKGGQRVD-MVVGAVPKTTLASTLEKHL 116


>gi|297569606|ref|YP_003690950.1| thioredoxin [Desulfurivibrio alkaliphilus AHT2]
 gi|296925521|gb|ADH86331.1| thioredoxin [Desulfurivibrio alkaliphilus AHT2]
          Length = 109

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L++    FD++VL+ S PV+VDFWA WC PC  + P+I+ +A+E A KV I K+
Sbjct: 1   MASDKLLEISDADFDAQVLKNSLPVLVDFWAPWCGPCKAIGPVIEQLAEEYAGKVAIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++S     +Y I +IPTLI+FK+G+V+D+ + GA  +  +   I   +
Sbjct: 61  NVDDSPSTPGKYGIRAIPTLIMFKNGEVVDQ-ITGAVGKPQLAALIDKAL 109


>gi|91203303|emb|CAJ72942.1| strongly similar to thioredoxin [Candidatus Kuenenia
           stuttgartiensis]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   +++   +FD+EV     PV+VDFWASWC PC +L+P+I+++A E + K KI KL+
Sbjct: 1   MAEGLVEITDANFDAEVTNAKIPVLVDFWASWCGPCRQLAPVIEELAKEYSGKAKIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            EE++    ++ I+SIPT+ILFK+GK ++R++ G  S++D+   + +++
Sbjct: 61  TEENNSTPAKFGITSIPTIILFKNGKAVNRIV-GVKSKNDLKTALDAQL 108


>gi|91783454|ref|YP_558660.1| thioredoxin [Burkholderia xenovorans LB400]
 gi|170692332|ref|ZP_02883495.1| thioredoxin [Burkholderia graminis C4D1M]
 gi|187923815|ref|YP_001895457.1| thioredoxin [Burkholderia phytofirmans PsJN]
 gi|209519557|ref|ZP_03268350.1| thioredoxin [Burkholderia sp. H160]
 gi|296157764|ref|ZP_06840598.1| thioredoxin [Burkholderia sp. Ch1-1]
 gi|307729575|ref|YP_003906799.1| thioredoxin [Burkholderia sp. CCGE1003]
 gi|323526150|ref|YP_004228303.1| thioredoxin [Burkholderia sp. CCGE1001]
 gi|91687408|gb|ABE30608.1| Thioredoxin [Burkholderia xenovorans LB400]
 gi|170142762|gb|EDT10927.1| thioredoxin [Burkholderia graminis C4D1M]
 gi|187715009|gb|ACD16233.1| thioredoxin [Burkholderia phytofirmans PsJN]
 gi|209500036|gb|EEA00099.1| thioredoxin [Burkholderia sp. H160]
 gi|295892010|gb|EFG71794.1| thioredoxin [Burkholderia sp. Ch1-1]
 gi|307584110|gb|ADN57508.1| thioredoxin [Burkholderia sp. CCGE1003]
 gi|323383152|gb|ADX55243.1| thioredoxin [Burkholderia sp. CCGE1001]
          Length = 108

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV++DFWA WC PC  ++PI+D++A + AD+++I K++
Sbjct: 1   MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E      ++ +  IPTLILFK+G V  + + GA S+S +  ++   +
Sbjct: 61  VDEHQSTPVKFGVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDGNL 108


>gi|83942011|ref|ZP_00954473.1| thioredoxin [Sulfitobacter sp. EE-36]
 gi|83953060|ref|ZP_00961782.1| thioredoxin [Sulfitobacter sp. NAS-14.1]
 gi|83842028|gb|EAP81196.1| thioredoxin [Sulfitobacter sp. NAS-14.1]
 gi|83847831|gb|EAP85706.1| thioredoxin [Sulfitobacter sp. EE-36]
          Length = 106

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV     PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELSSEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L +FK+G+V+  +  GA  ++ +  WI   +
Sbjct: 61  ENPNSPAQMGVRGIPALFIFKNGEVVSNL-AGARPKAALQGWIEESI 106


>gi|26991891|ref|NP_747316.1| thioredoxin [Pseudomonas putida KT2440]
 gi|148550324|ref|YP_001270426.1| thioredoxin [Pseudomonas putida F1]
 gi|24987013|gb|AAN70780.1|AE016722_1 thioredoxin [Pseudomonas putida KT2440]
 gi|148514382|gb|ABQ81242.1| thioredoxin [Pseudomonas putida F1]
 gi|313501193|gb|ADR62559.1| Trx [Pseudomonas putida BIRD-1]
          Length = 109

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 67/110 (60%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   SF+++VL+    V+VD+WA WC PC  ++P++DDIA     K+ + KL
Sbjct: 1   MSSDLIKHVTDASFEADVLKAEGAVLVDYWAEWCGPCKMIAPVLDDIASTYEGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDAHL 109


>gi|86355693|ref|YP_467585.1| thioredoxin protein [Rhizobium etli CFN 42]
 gi|190889665|ref|YP_001976207.1| thioredoxin protein [Rhizobium etli CIAT 652]
 gi|218510667|ref|ZP_03508545.1| thioredoxin protein [Rhizobium etli Brasil 5]
 gi|45505285|gb|AAS67015.1| TrxA [Rhizobium etli]
 gi|86279795|gb|ABC88858.1| thioredoxin protein [Rhizobium etli CFN 42]
 gi|190694944|gb|ACE89029.1| thioredoxin protein [Rhizobium etli CIAT 652]
 gi|327192793|gb|EGE59721.1| thioredoxin protein [Rhizobium etli CNPAF512]
          Length = 106

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/103 (45%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  KVK+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA  ++ +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADISV-GAKPKTALSNWI 102


>gi|224825638|ref|ZP_03698742.1| thioredoxin [Lutiella nitroferrum 2002]
 gi|224601862|gb|EEG08041.1| thioredoxin [Lutiella nitroferrum 2002]
          Length = 108

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ +VL+   PV+VD+WA WC PC  ++PI+D+++ E   ++K+ KL+
Sbjct: 1   MSDLIQHVTDDSFEQDVLKAQGPVLVDYWAEWCGPCKMIAPILDEVSKEYDGRLKVVKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ +   ++ I  IPTL++FKDG V+   + GA ++S +  +I S +
Sbjct: 61  IDQNEQTPPKFGIRGIPTLMIFKDGNVVATKV-GALAKSQLTAFIDSHI 108


>gi|167772537|ref|ZP_02444590.1| hypothetical protein ANACOL_03915 [Anaerotruncus colihominis DSM
           17241]
 gi|167665015|gb|EDS09145.1| hypothetical protein ANACOL_03915 [Anaerotruncus colihominis DSM
           17241]
          Length = 103

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 65/103 (63%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V + +F++EVL    PV+VDFWA WC PC  +SP+  D   E    VK+ K++++
Sbjct: 1   MATVTVTSNNFEAEVLNADRPVLVDFWAPWCGPCRMVSPV-LDTIAEETPSVKVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++  +++ SIPTL  F+DGK+    + G  S++ I++ +
Sbjct: 60  EQPELAQTFKVMSIPTLAAFRDGKLTGTSV-GVRSKAQILQML 101


>gi|302388339|ref|YP_003824161.1| thioredoxin [Clostridium saccharolyticum WM1]
 gi|302198967|gb|ADL06538.1| thioredoxin [Clostridium saccharolyticum WM1]
          Length = 106

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 71/105 (67%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F+SEV++ S   +VDFWA+WC PC   +P+I++IA+     VK+ K+D++
Sbjct: 1   MAVITLTQENFESEVVKSSGIALVDFWATWCGPCKMFAPVIEEIAEGNFPDVKVGKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +  +++ ++++ SIPTL+LFKDGK     + G  S+ +++E I  
Sbjct: 61  QQPDLAGQFKVMSIPTLVLFKDGKAAATSV-GVKSKKEVLEMIEK 104


>gi|295676457|ref|YP_003604981.1| thioredoxin [Burkholderia sp. CCGE1002]
 gi|295436300|gb|ADG15470.1| thioredoxin [Burkholderia sp. CCGE1002]
          Length = 108

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV++DFWA WC PC  ++PI+D++A + AD++++ K++
Sbjct: 1   MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQVAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E      ++ +  IPTLILFK+G V  + + GA S+S +  ++   +
Sbjct: 61  VDEHQSTPVKFGVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDGNL 108


>gi|186475715|ref|YP_001857185.1| thioredoxin [Burkholderia phymatum STM815]
 gi|184192174|gb|ACC70139.1| thioredoxin [Burkholderia phymatum STM815]
          Length = 108

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +V++   PV++DFWA WC PC  ++PI+D++A + AD+++I K++
Sbjct: 1   MSEHIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQIAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E      ++ +  IPTLILFK+G V  + + GA S+S +  ++   +
Sbjct: 61  VDEHQSTPVKFGVRGIPTLILFKNGAVAAQKV-GALSKSQLTAFLDGNL 108


>gi|32477354|ref|NP_870348.1| thioredoxin 1 [Rhodopirellula baltica SH 1]
 gi|32447905|emb|CAD77425.1| thioredoxin 1 [Rhodopirellula baltica SH 1]
 gi|327537346|gb|EGF24079.1| Thioredoxin [Rhodopirellula baltica WH47]
          Length = 108

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +  + +  +FDSEVL+  +PV+VDFWA WC PC +++P+ID++A E    VKI K++I++
Sbjct: 5   AVKEFNDDNFDSEVLKSDSPVLVDFWAPWCGPCRQIAPMIDELASE-NPGVKIGKVNIDD 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +   + ++ I+SIPTL+LFK+G++ D  + G   ++ + + + S
Sbjct: 64  NPGAAQKFGINSIPTLLLFKNGEIADTFV-GVRPKAALQDALTS 106


>gi|134298769|ref|YP_001112265.1| thioredoxin [Desulfotomaculum reducens MI-1]
 gi|134051469|gb|ABO49440.1| thioredoxin [Desulfotomaculum reducens MI-1]
          Length = 105

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 78/105 (74%), Gaps = 2/105 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L+++  +F++EVL+   PV+VDFWA+WC PC  ++P+++ ++ E A KVK+ K++++
Sbjct: 1   MA-LELNAANFEAEVLKSDIPVLVDFWAAWCGPCRAIAPVVEQLSTEYAGKVKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+ E++ ++ + SIPTLI  K+G+ +D+++ G + ++D+ + + +
Sbjct: 60  ENRELAQQFGVMSIPTLIFLKNGEKVDQVI-GFTGKADLEKKLNA 103


>gi|332291995|ref|YP_004430604.1| thioredoxin [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170081|gb|AEE19336.1| thioredoxin [Krokinobacter diaphorus 4H-3-7-5]
          Length = 105

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/104 (36%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+ +VL    PV+VDFWA+WC PC  + P+I++IA E   K  I K+D++
Sbjct: 1   MA-LEITDATFEEQVLNSDKPVLVDFWAAWCGPCRMVGPVIEEIAGEYEGKAVIGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            + E + +Y + +IPT+++FK+G+V+ R + G + ++   E I 
Sbjct: 60  ANQEFAAKYGVRNIPTVLMFKNGEVVGRQV-GVAPKATYTEAID 102


>gi|307154247|ref|YP_003889631.1| thioredoxin [Cyanothece sp. PCC 7822]
 gi|306984475|gb|ADN16356.1| thioredoxin [Cyanothece sp. PCC 7822]
          Length = 107

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF  EVLE   PV+VDFWA WC PC  ++P++D+IA++ A ++K+ KL+ +++  I
Sbjct: 7   VTDDSFKQEVLESEIPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQIKVVKLNTDDNPNI 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G  +D M+ GA  ++ +   +   +
Sbjct: 67  ASQYGIRSIPTLMIFKGGNKVD-MVVGAVPKTTLSNTLEKYL 107


>gi|28872355|ref|NP_794974.1| thioredoxin [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213971838|ref|ZP_03399940.1| thioredoxin [Pseudomonas syringae pv. tomato T1]
 gi|301383375|ref|ZP_07231793.1| thioredoxin [Pseudomonas syringae pv. tomato Max13]
 gi|302064068|ref|ZP_07255609.1| thioredoxin [Pseudomonas syringae pv. tomato K40]
 gi|302134964|ref|ZP_07260954.1| thioredoxin [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28855610|gb|AAO58669.1| thioredoxin [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213923384|gb|EEB56977.1| thioredoxin [Pseudomonas syringae pv. tomato T1]
 gi|330874079|gb|EGH08228.1| thioredoxin [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330965549|gb|EGH65809.1| thioredoxin [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331017857|gb|EGH97913.1| thioredoxin [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 109

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   SF+++VL+    V+VD+WA WC PC  ++P++D+IA   A K+ I KL
Sbjct: 1   MSNDLIKHVTDASFEADVLKADGAVLVDYWAEWCGPCKMIAPVLDEIATTYAGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 109


>gi|218670427|ref|ZP_03520098.1| thioredoxin protein [Rhizobium etli GR56]
          Length = 106

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/103 (46%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++IA E+  KVK+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEIAVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ ++ + SIPTL +FK G+V D  + GA  ++ +  WI
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADISV-GAKPKTALSNWI 102


>gi|217071282|gb|ACJ84001.1| unknown [Medicago truncatula]
          Length = 175

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   S++  VL    PV+VDFWA WC PC  ++PIID++A E A K+   KL+ +E+  I
Sbjct: 73  VTDSSWNELVLASDTPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKISCYKLNTDENPNI 132

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T+Y I SIPT++ FK+G+     + GA  +S +       +
Sbjct: 133 ATKYGIRSIPTVLFFKNGEK-KESVIGAVPKSTLSTTAEKYI 173


>gi|39933153|ref|NP_945429.1| thioredoxin [Rhodopseudomonas palustris CGA009]
 gi|192288509|ref|YP_001989114.1| thioredoxin [Rhodopseudomonas palustris TIE-1]
 gi|316931470|ref|YP_004106452.1| thioredoxin [Rhodopseudomonas palustris DX-1]
 gi|39652778|emb|CAE25517.1| thioredoxin [Rhodopseudomonas palustris CGA009]
 gi|192282258|gb|ACE98638.1| thioredoxin [Rhodopseudomonas palustris TIE-1]
 gi|315599184|gb|ADU41719.1| thioredoxin [Rhodopseudomonas palustris DX-1]
          Length = 106

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  KV    F++EVL    PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MAVGKVSDADFENEVLNAQGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES   +++Y + SIPTL++FK G++  R + GA+ ++ + +WI + V
Sbjct: 61  ESPVTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKAKLQQWISAAV 106


>gi|54310594|ref|YP_131614.1| putative thioredoxin [Photobacterium profundum SS9]
 gi|46915037|emb|CAG21812.1| putative thioredoxin [Photobacterium profundum SS9]
          Length = 112

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 71/105 (67%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++   +FDS+V+  + PV+VDFWA WC PC  ++PI+D+IA+E   KV I KL+I+++
Sbjct: 9   IVQLTDATFDSDVVNAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGKVTIGKLNIDQN 68

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 69  AATPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 112


>gi|163748719|ref|ZP_02155972.1| thioredoxin 1 [Shewanella benthica KT99]
 gi|161331829|gb|EDQ02633.1| thioredoxin 1 [Shewanella benthica KT99]
          Length = 108

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 76/109 (69%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++V++ + PVVVDFWA WC PC  ++P +DD+A++ A KV I KL+
Sbjct: 1   MSDKIVHLSDDSFENDVIKSALPVVVDFWAEWCGPCKMIAPFLDDVAEDYAGKVTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++S I  +Y +  IPTL++FK+G++    + GA S++ + E+I +++
Sbjct: 61  VDQNSVIPAKYGVRGIPTLLIFKNGELAGTKV-GALSKTQLKEFIDAQL 108


>gi|304320181|ref|YP_003853824.1| thioredoxin [Parvularcula bermudensis HTCC2503]
 gi|303299084|gb|ADM08683.1| thioredoxin [Parvularcula bermudensis HTCC2503]
          Length = 109

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   SF+ +VL+ +  V+VDFWA+WC PC +++P +++IADE+ D + + KLDI+
Sbjct: 1   MATKTVTDASFEQDVLKGTGLVLVDFWATWCGPCRQIAPALEEIADEMGDDLTVAKLDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+     +Y +  +PTL+LFK+G+++   + GA ++  I+ W+  
Sbjct: 61  ENPTTMMQYGVRGVPTLMLFKEGQLVSTKV-GADAKGAILAWVKE 104


>gi|218710958|ref|YP_002418579.1| thioredoxin [Vibrio splendidus LGP32]
 gi|218323977|emb|CAV20339.1| Thioredoxin [Vibrio splendidus LGP32]
          Length = 112

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    FD++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   ++ I KL+
Sbjct: 5   MSDKILQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGQLTIGKLN 64

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 65  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 112


>gi|145301125|ref|YP_001143966.1| thioredoxin [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853897|gb|ABO92218.1| thioredoxin [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 108

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 71/106 (66%), Gaps = 3/106 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++   SF+++V++    V+VDFWA WC PC  ++PI++++A E A +V + KL+
Sbjct: 1   MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILNEVAQEYAGRVTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           I+ +++   +Y I  IPTL+LFK+G+V    + GA S++ + E++ 
Sbjct: 61  IDHNADTPPKYGIRGIPTLLLFKNGEVAATKV-GALSKTQLKEFLD 105


>gi|120611307|ref|YP_970985.1| thioredoxin [Acidovorax citrulli AAC00-1]
 gi|120589771|gb|ABM33211.1| thioredoxin [Acidovorax citrulli AAC00-1]
          Length = 110

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   SF+++VL+    V+VD+WA WC PC  ++PI+D++A     K+ + K+
Sbjct: 1   MASELIKHISDASFEADVLQPGTTVLVDYWAEWCGPCKMIAPILDEVAGSYQGKLTVAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ E+  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDENREVPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTSFIDQQL 109


>gi|158335030|ref|YP_001516202.1| thioredoxin [Acaryochloris marina MBIC11017]
 gi|158305271|gb|ABW26888.1| thioredoxin [Acaryochloris marina MBIC11017]
          Length = 107

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F  EV+E   PV+VDFWA WC PC  ++P++D+I+++   +VK+ K++ +E+  +
Sbjct: 7   VTDATFKEEVIESDVPVLVDFWAPWCGPCRMVAPVVDEISEQYKGQVKVVKINTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 67  ASQYGIRSIPTLMVFKGGQRVD-MVVGAVPKTTLASTLDKYL 107


>gi|159464168|ref|XP_001690314.1| thioredoxin m [Chlamydomonas reinhardtii]
 gi|1729935|sp|P23400|TRXM_CHLRE RecName: Full=Thioredoxin M-type, chloroplastic; Short=Trx-M;
           AltName: Full=Thioredoxin-CH2; Flags: Precursor
 gi|840747|emb|CAA56851.1| thioredoxin m [Chlamydomonas reinhardtii]
 gi|158284302|gb|EDP10052.1| thioredoxin m [Chlamydomonas reinhardtii]
          Length = 140

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  +F + VLE S PV+VDFWA WC PC  ++P++D+IA E  DK+K  KL+ +ES  +
Sbjct: 39  VNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNV 98

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ Y I SIPT+++FK GK  + ++ GA  ++ I++ +   +
Sbjct: 99  ASEYGIRSIPTIMVFKGGKKCETII-GAVPKATIVQTVEKYL 139


>gi|86131299|ref|ZP_01049898.1| thioredoxin [Dokdonia donghaensis MED134]
 gi|85818710|gb|EAQ39870.1| thioredoxin [Dokdonia donghaensis MED134]
          Length = 105

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+ +VL+   PV+VDFWA+WC PC  + P+I++IA E   K  + K+D++
Sbjct: 1   MA-LEITDATFEEQVLKSDKPVLVDFWAAWCGPCRMVGPVIEEIAGEYEGKAIVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            + E + +Y + +IPT+++FK+G+V+ R + G + ++   E I 
Sbjct: 60  ANQEFAAKYGVRNIPTVLMFKNGEVVGRQV-GVAPKATYTEAID 102


>gi|297580212|ref|ZP_06942139.1| thioredoxin 2 [Vibrio cholerae RC385]
 gi|297535858|gb|EFH74692.1| thioredoxin 2 [Vibrio cholerae RC385]
          Length = 144

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E 
Sbjct: 39  APIEGTEANF-SALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  +QI SIPT+++FK+G+ ID M+ GA  +S   +W+   +
Sbjct: 98  QQNLAAHFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWLNQAL 142


>gi|260574438|ref|ZP_05842442.1| thioredoxin [Rhodobacter sp. SW2]
 gi|259023334|gb|EEW26626.1| thioredoxin [Rhodobacter sp. SW2]
          Length = 106

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV + + PVVVDFWA WC PC ++ P ++++A + A +VKI K++++
Sbjct: 1   MTTVAVTDATFDAEVRKSALPVVVDFWAEWCGPCRQIGPALEELAAQYAGRVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E      +  IP L LFKDG+V+   + GA+ ++ +  WI + +
Sbjct: 61  ENPESPALLGVRGIPALFLFKDGQVVSNKI-GAAPKAALETWIKTAI 106


>gi|254510578|ref|ZP_05122645.1| thioredoxin [Rhodobacteraceae bacterium KLH11]
 gi|221534289|gb|EEE37277.1| thioredoxin [Rhodobacteraceae bacterium KLH11]
          Length = 106

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A+E  DKVKI K+D++
Sbjct: 1   MSTVAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELANEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGQVVSNR-AGAAPKAALQSWIDESI 106


>gi|116072779|ref|ZP_01470045.1| Thioredoxin [Synechococcus sp. BL107]
 gi|116064666|gb|EAU70426.1| Thioredoxin [Synechococcus sp. BL107]
          Length = 108

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +      F++EVL+ S  V+VDFWA WC PC  ++P++   A+   D++++ K++++ 
Sbjct: 4   SVVDFTDAGFETEVLKASGSVLVDFWAPWCGPCRLIAPLMTWAAETYGDQLRVGKIEVDG 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +      YQ+  IPTLILF+DG+++ R   GA ++  +  ++ + +
Sbjct: 64  NPSTRDAYQVQGIPTLILFRDGELVARH-EGAIAKPQLQAFLDANL 108


>gi|115378206|ref|ZP_01465378.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|310820646|ref|YP_003953004.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|115364794|gb|EAU63857.1| thioredoxin [Stigmatella aurantiaca DW4/3-1]
 gi|309393718|gb|ADO71177.1| Thioredoxin [Stigmatella aurantiaca DW4/3-1]
          Length = 110

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 67/110 (60%), Gaps = 3/110 (2%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L +    F  EVL+   PV+VDFWA+WC PC  ++PI+D +A E   +VK+ K+
Sbjct: 1   MAGADVLNIGDGDFTKEVLQSDTPVLVDFWATWCGPCRTIAPIVDALATEYKGRVKVAKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           D++ + +   +Y I SIPTL++FK GKV+D ++     +S I E +   +
Sbjct: 61  DVDANQDTPQQYGIRSIPTLLVFKGGKVVDTIIGAGGGKSKIEEALKKTL 110


>gi|222054402|ref|YP_002536764.1| thioredoxin [Geobacter sp. FRC-32]
 gi|221563691|gb|ACM19663.1| thioredoxin [Geobacter sp. FRC-32]
          Length = 109

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L     +F++ VL+   PV+VDFWA+WC PC  ++P+ID IA+E   K+K+ K+
Sbjct: 1   MASEKVLTFTDDNFEAAVLQSEIPVLVDFWATWCAPCKAIAPLIDGIAEEYEGKIKVGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++ES  +  +Y +  IPT+IL KDGKV+D+++ GA  ++ +   I   +
Sbjct: 61  NVDESPGMPGKYGVRGIPTVILIKDGKVVDQVV-GAVPKAQLEALIKKAL 109


>gi|182679139|ref|YP_001833285.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635022|gb|ACB95796.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 106

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +F ++V++   PVVVDFWA WC PC  + P +++IADELADKVKI KL+++
Sbjct: 1   MATVKVTDATFKNDVVDAKAPVVVDFWAEWCGPCKMIGPALEEIADELADKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+  +S  Y I +IPTL+LFKDGK+ +  + GA+ + ++ +WI   +
Sbjct: 61  ENPGVSGAYGIRTIPTLLLFKDGKIANTKI-GAAPKGELKKWISDAL 106


>gi|325282670|ref|YP_004255211.1| thioredoxin [Deinococcus proteolyticus MRP]
 gi|324314479|gb|ADY25594.1| thioredoxin [Deinococcus proteolyticus MRP]
          Length = 108

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  +++   +F  E+   S   +VDFWA WC PC  ++P+++++A +   KVKI K++++
Sbjct: 1   MKPVELTDGNFKDEL--SSGLTLVDFWAPWCGPCRIIAPVLEELAGDYDGKVKIGKVNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + ++++ SIPTLILFKDG+ +++M+ GA+ +      +   +
Sbjct: 59  ENPTTAAQFRVMSIPTLILFKDGEPVEQMV-GAAPKRSFETLLNKHL 104


>gi|20807685|ref|NP_622856.1| Thiol-disulfide isomerase and thioredoxins [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516233|gb|AAM24460.1| Thiol-disulfide isomerase and thioredoxins [Thermoanaerobacter
           tengcongensis MB4]
          Length = 223

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + + +K+++ EV+    PV++DFWA WC PC  ++PII+++A E   K+K+ K++++
Sbjct: 1   MAEVVITSKNWEEEVVNSDVPVLIDFWAEWCMPCRLVAPIIEELAKEYEGKIKVGKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E  E++ +++I SIPT+ LFK+GK++ +++ GA  ++D +++I   +
Sbjct: 61  EEDELAMKFRIMSIPTIGLFKNGKMVGKLI-GARPKADFVKFIEKYL 106



 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/104 (33%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   +++ EV+    PV++DFWA WC PC  ++PI++++A E   ++K+ K++++E  
Sbjct: 119 VEITYDNWEEEVVNSDVPVLIDFWAEWCAPCRLVAPIVEELAHEYKGRLKVGKVNVDEEQ 178

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++ +++I SIPT+ LFK GK++D+++ GA  ++D + +I   +
Sbjct: 179 ELAMKFRIMSIPTIGLFKKGKMVDKII-GARPKADFVRFIEKHL 221


>gi|145635481|ref|ZP_01791181.1| thioredoxin [Haemophilus influenzae PittAA]
 gi|145267246|gb|EDK07250.1| thioredoxin [Haemophilus influenzae PittAA]
          Length = 107

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L ++   F+S V+    PV++DFWA WC PC  ++P++D++A E A KVKI K+++
Sbjct: 1   MSEVLHINDVDFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + SIPTL+L K+G+V+   + GA +++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSIPTLLLIKNGQVVATQV-GALAKTQLANFINQHI 107


>gi|186686280|ref|YP_001869476.1| thioredoxin [Nostoc punctiforme PCC 73102]
 gi|186468732|gb|ACC84533.1| thioredoxin [Nostoc punctiforme PCC 73102]
          Length = 107

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 1   MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS++  V   +F  EVLE   PV+VDFWA WC PC  + P++D++A E   +VK  KL+ 
Sbjct: 1   MSSITNVTEATFKQEVLESEIPVLVDFWAPWCGPCRMVGPVVDEVAAEYEGQVKFVKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  +++ Y I SIPTL++FK G+ +D ++ GA  ++ + + +   +
Sbjct: 61  DQNPTVASHYGIRSIPTLMVFKGGRQVDTVV-GAVPKTTLNKTLAQHL 107


>gi|291614663|ref|YP_003524820.1| thioredoxin [Sideroxydans lithotrophicus ES-1]
 gi|291584775|gb|ADE12433.1| thioredoxin [Sideroxydans lithotrophicus ES-1]
          Length = 145

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/104 (33%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++++  +F   +     PV+VDFWA WC PC  ++P  +  A  L   +++ KL+ EE+ 
Sbjct: 42  VELNATNFMQHISRSDVPVLVDFWAPWCGPCRSMAPAYEQAAQRLEPGMRVAKLNTEEAQ 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++ +Y I SIPTL +FK G+ + R   GA   ++I+ W  S++
Sbjct: 102 QLAAQYNIRSIPTLAVFKGGRELAR-QAGAMDAANIVAWAKSKI 144


>gi|126176119|ref|YP_001052268.1| thioredoxin [Shewanella baltica OS155]
 gi|153002455|ref|YP_001368136.1| thioredoxin [Shewanella baltica OS185]
 gi|160877174|ref|YP_001556490.1| thioredoxin [Shewanella baltica OS195]
 gi|217975024|ref|YP_002359775.1| thioredoxin [Shewanella baltica OS223]
 gi|304412473|ref|ZP_07394079.1| thioredoxin [Shewanella baltica OS183]
 gi|307307132|ref|ZP_07586870.1| thioredoxin [Shewanella baltica BA175]
 gi|125999324|gb|ABN63399.1| thioredoxin [Shewanella baltica OS155]
 gi|151367073|gb|ABS10073.1| thioredoxin [Shewanella baltica OS185]
 gi|160862696|gb|ABX51230.1| thioredoxin [Shewanella baltica OS195]
 gi|217500159|gb|ACK48352.1| thioredoxin [Shewanella baltica OS223]
 gi|304349115|gb|EFM13527.1| thioredoxin [Shewanella baltica OS183]
 gi|306910371|gb|EFN40802.1| thioredoxin [Shewanella baltica BA175]
 gi|315269378|gb|ADT96231.1| thioredoxin [Shewanella baltica OS678]
          Length = 108

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+   PV+VDFWA WC PC  ++PI+DD+++E A +V I KL+
Sbjct: 1   MSDKIIYLSDDSFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVSEEYAGRVTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL+LFK+G++    + GA S++ + E+I +++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLLFKNGELAATKV-GALSKTQLKEFIDAQI 108


>gi|188584778|ref|YP_001916323.1| thioredoxin [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179349465|gb|ACB83735.1| thioredoxin [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 107

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L+V+  +F  +VLE   PV+V+FWA WC PC  ++P+++++A+E+  K+KI K+++
Sbjct: 1   MSKILEVNDTNFKEQVLEADKPVLVEFWAPWCGPCKMVAPVLEELAEEMDGKIKICKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+++ ++ Y + SIPT++L KDG  +   + G   + ++   I   +
Sbjct: 61  DENTDTASDYGVMSIPTMVLIKDG-EVQEQVVGYLPREELQNKIEENI 107


>gi|254431636|ref|ZP_05045339.1| thioredoxin [Cyanobium sp. PCC 7001]
 gi|197626089|gb|EDY38648.1| thioredoxin [Cyanobium sp. PCC 7001]
          Length = 106

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  ++   +F +EVLE S  V+VD WA WC PC  ++P++D  A   A ++ + KL+ +
Sbjct: 1   MSVAELTDANFQTEVLESSGAVLVDVWAQWCGPCRLMAPLMDWAATTYAGRLAVGKLEAD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +     R Q+  +PTL+LFKDG  + R   GA +Q+ +  ++ + +
Sbjct: 61  PNPSSRDRLQVQGLPTLVLFKDGSEVARH-EGAMAQAQLKAFLDAHL 106


>gi|298485181|ref|ZP_07003275.1| Thioredoxin [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298160293|gb|EFI01320.1| Thioredoxin [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 109

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +F++EVL+    V+VD+WA WC PC  ++P++D+IAD  A K+ I KL
Sbjct: 1   MSNEKIKHVTDANFEAEVLKAEGAVLVDYWAEWCGPCKMIAPVLDEIADTYAGKLTIAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +   + + +
Sbjct: 61  NIDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAALLDANI 109


>gi|319957219|ref|YP_004168482.1| thioredoxin [Nitratifractor salsuginis DSM 16511]
 gi|319419623|gb|ADV46733.1| thioredoxin [Nitratifractor salsuginis DSM 16511]
          Length = 143

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++ D ++F   + +   PVVVDFWA WC PC  ++P   + A ++  + +  K++ EE+ 
Sbjct: 41  IEADAQTFQYILEKSDLPVVVDFWAPWCGPCRMMAPAFAEAAAKMPLQAQFVKVNTEENP 100

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++S ++ I  IPT+ILFK+G+ +DR + GA     II+WI SR
Sbjct: 101 QVSAQFGIRGIPTMILFKNGREVDR-ISGALGADQIIQWIRSR 142


>gi|331700381|ref|YP_004336620.1| thioredoxin [Pseudonocardia dioxanivorans CB1190]
 gi|326955070|gb|AEA28767.1| thioredoxin [Pseudonocardia dioxanivorans CB1190]
          Length = 109

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + V   SF+++VL+    V+VDFWA+WC PC  ++P++D+IA E +DK+ + KLDI+ +
Sbjct: 5   TVDVTDASFEADVLKSDKTVLVDFWATWCGPCKMVAPVLDEIAGEHSDKLTVAKLDIDVN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           S+ +  YQ+ SIPT+ILFKDGK +  ++ GA  ++ ++ 
Sbjct: 65  SKTAAAYQVMSIPTMILFKDGKPVKTIV-GARPKAALLS 102


>gi|332704218|ref|ZP_08424306.1| thioredoxin [Desulfovibrio africanus str. Walvis Bay]
 gi|332554367|gb|EGJ51411.1| thioredoxin [Desulfovibrio africanus str. Walvis Bay]
          Length = 107

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/103 (45%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   +F+SEVL+C  PV+VDFWA WC PC  L P+I+++A+E   +VKI K++++E+  
Sbjct: 4   QVMDSNFESEVLKCDLPVLVDFWAPWCGPCRALGPVIEELANEYTGQVKIVKMNVDENPN 63

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++ I +IPTLILFK+G+V+D+ + GA S+S I + I  +V
Sbjct: 64  TPGKFGIRAIPTLILFKNGEVLDQ-VTGAVSKSSIKDMISKKV 105


>gi|296117286|ref|ZP_06835877.1| thioredoxin [Gluconacetobacter hansenii ATCC 23769]
 gi|295976179|gb|EFG82966.1| thioredoxin [Gluconacetobacter hansenii ATCC 23769]
          Length = 109

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V    F  +VLE S PV+VDFWA WC PC  ++P +++I  E   ++K+ K++
Sbjct: 1   MSENTVAVKDAEFQKQVLESSEPVLVDFWAEWCGPCKMVAPALEEIGAEFKGQLKVVKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +    Y +  IPT+++FKDGKV+   + GA+ ++ + EW+ + +
Sbjct: 61  IDENPDTPNTYGVRGIPTMLIFKDGKVVADKV-GAAPKTQLKEWVKASL 108


>gi|291549063|emb|CBL25325.1| thioredoxin [Ruminococcus torques L2-14]
          Length = 131

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 66/104 (63%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+ T +F+ EVL+   PV+VDF+A WC PC  ++PI  +   E    VK+  ++I+
Sbjct: 30  MAVVKLTTDNFEQEVLQAQQPVLVDFYADWCGPCKMMAPI-VEALSEELSDVKVCHINID 88

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E+ +I+ +Y++ SIPT I FK G+   R + GA  ++ +++ + 
Sbjct: 89  ENIDIAQKYRVMSIPTFIAFKGGEESGRQI-GAIPKTALVDLVK 131


>gi|59710664|ref|YP_203440.1| thioredoxin [Vibrio fischeri ES114]
 gi|197334006|ref|YP_002154826.1| thioredoxin [Vibrio fischeri MJ11]
 gi|59478765|gb|AAW84552.1| thioredoxin [Vibrio fischeri ES114]
 gi|197315496|gb|ACH64943.1| thioredoxin [Vibrio fischeri MJ11]
          Length = 108

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+  V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDGGFEESVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDQNAGTPPKFGIRGIPTLLLFKDGGVAATKV-GALSKTQLKEFLDANL 108


>gi|42543180|pdb|1OAZ|A Chain A, Ige Fv Spe7 Complexed With A Recombinant Thioredoxin
 gi|42543181|pdb|1OAZ|B Chain B, Ige Fv Spe7 Complexed With A Recombinant Thioredoxin
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 71/123 (57%), Gaps = 17/123 (13%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWC--------------RPCVKLSPIIDDI 44
           MS   + +   SFD++VL+    ++VDFWA WC               PC  ++PI+D+I
Sbjct: 1   MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPIEESDDRRYDLVGPCKMIAPILDEI 60

Query: 45  ADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           ADE   K+ + KL+I+++   + +Y I  IPTL+LFK+G+V    + GA S+  + E++ 
Sbjct: 61  ADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV-GALSKGQLKEFLD 119

Query: 105 SRV 107
           + +
Sbjct: 120 ANL 122


>gi|326524866|dbj|BAK04369.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 177

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S V+E   PV+V+FWASWC PC  + P+I  ++ E   K+K  KL+ +E+
Sbjct: 72  VPDVTKATWQSLVVESEIPVLVEFWASWCGPCKMIDPVIGKLSKEYEGKLKCYKLNTDEN 131

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            +I+++Y + SIPT+++FK+G+  D ++ GA  +S +I  I  
Sbjct: 132 PDIASQYGVRSIPTMMIFKNGEKKDAVI-GAVPESTLITCIEK 173


>gi|163757509|ref|ZP_02164598.1| thioredoxin C-1 [Hoeflea phototrophica DFL-43]
 gi|162285011|gb|EDQ35293.1| thioredoxin C-1 [Hoeflea phototrophica DFL-43]
          Length = 107

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/103 (46%), Positives = 76/103 (73%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD+ +F SEVL+ S PVVVDFWA WC PC  ++P +++I++E+  KVK+ K++I+
Sbjct: 1   MATVKVDSANFQSEVLDSSVPVVVDFWAEWCGPCKMIAPSLEEISNEMEGKVKVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ EI++++ + SIPTL +FK G V D  + GAS ++ +  WI
Sbjct: 61  ENPEIASQFGVRSIPTLAMFKAGAVADIKV-GASPKTALSSWI 102


>gi|320537417|ref|ZP_08037367.1| thioredoxin [Treponema phagedenis F0421]
 gi|320145743|gb|EFW37409.1| thioredoxin [Treponema phagedenis F0421]
          Length = 105

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +   +F +E L    PV+VDF+A WC PC  L P+I+++  E+ +K  I K+D++
Sbjct: 1   MAVLHLTKDNF-NETLNTDVPVLVDFFAQWCGPCKMLGPVIEEVGKEIGNKGVIAKIDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y ++SIPT+++FK+GK +DR + G   +S I+  I   
Sbjct: 60  KQQDLAAQYGVASIPTIVVFKNGKEVDRSV-GFIDKSKIVSLIEKH 104


>gi|224068456|ref|XP_002302750.1| predicted protein [Populus trichocarpa]
 gi|222844476|gb|EEE82023.1| predicted protein [Populus trichocarpa]
          Length = 359

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD--I 59
           S + +   +F+  VL+ +  V+V+F+A WC  C  L+PI + +A     +  +   +   
Sbjct: 143 SVVVLTADNFNDIVLDENKDVLVEFYAPWCGHCKNLAPIYEKVATAFKSEEDVVVANLEA 202

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 203 DKYRDLAEKYGVSGFPTLKFFPKGNKAGEEYEGGRDLDDFVAFINEK 249



 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 26  VVVLTEDNFEKEVGQ-DKGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKAVLIGKVDCD 84

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PTL  F  G +  +   G  +   + E++ + 
Sbjct: 85  EHKGVCSKYGVSGYPTLQWFPKGSLEPKKYEGPRTAEALAEFVNNE 130


>gi|294142599|ref|YP_003558577.1| thioredoxin 1 [Shewanella violacea DSS12]
 gi|293329068|dbj|BAJ03799.1| thioredoxin 1 [Shewanella violacea DSS12]
          Length = 108

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++V++   PVVVDFWA WC PC  ++PI+DD+ADE A KV I KL+
Sbjct: 1   MSDKIVHLSDDSFENDVIKSELPVVVDFWAEWCGPCKMIAPILDDVADEYAGKVTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++S    +Y +  IPTL++FK+G++    + GA S++ + E+I +++
Sbjct: 61  VDQNSVSPAKYGVRGIPTLLIFKNGELAGTKV-GALSKTQLKEFIDAQL 108


>gi|78213462|ref|YP_382241.1| thioredoxin [Synechococcus sp. CC9605]
 gi|78197921|gb|ABB35686.1| thioredoxin [Synechococcus sp. CC9605]
          Length = 124

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+++IA E   ++K+ KL+ +E+  +
Sbjct: 24  VTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVEEIAKEFDGQIKVFKLNTDENPNV 83

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 84  ASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKATLSGTISKYL 124


>gi|303232577|ref|ZP_07319263.1| thioredoxin [Atopobium vaginae PB189-T1-4]
 gi|302481364|gb|EFL44438.1| thioredoxin [Atopobium vaginae PB189-T1-4]
          Length = 105

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           + +  FDS +     PV+VDFWA+WC PC  L P+I++I+DE+++ + + K +++E  E+
Sbjct: 5   ITSSDFDSIITSSDLPVLVDFWATWCGPCRALGPVIEEISDEMSNSLAVYKCNVDEEPEL 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + R+QI SIPT++LFK+G+V+  ++ G   + +++  I + +
Sbjct: 65  AQRFQIVSIPTVMLFKNGEVVHSLV-GNMPKDELVAEINAHL 105


>gi|81300602|ref|YP_400810.1| thioredoxin [Synechococcus elongatus PCC 7942]
 gi|81169483|gb|ABB57823.1| thioredoxin [Synechococcus elongatus PCC 7942]
          Length = 107

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A +++ + F+S VL+    V+VDFWA WC PC  ++P++D  A   AD++ + KL+++ 
Sbjct: 3   AATELNDQQFESAVLKAPGLVLVDFWAPWCGPCRLIAPLMDWAAQTYADQLTVYKLEVDP 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E   RYQ+  IPTL+LF++G++++R + GA  +  I   I + +
Sbjct: 63  NPETVARYQVQGIPTLLLFQNGELVER-VEGAIGRDRIQTLINAHL 107


>gi|56752309|ref|YP_173010.1| thioredoxin [Synechococcus elongatus PCC 6301]
 gi|56687268|dbj|BAD80490.1| thioredoxin [Synechococcus elongatus PCC 6301]
          Length = 115

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A +++ + F+S VL+    V+VDFWA WC PC  ++P++D  A   AD++ + KL+++ 
Sbjct: 11  AATELNDQQFESAVLKAPGLVLVDFWAPWCGPCRLIAPLMDWAAQTYADQLTVYKLEVDP 70

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E   RYQ+  IPTL+LF++G++++R + GA  +  I   I + +
Sbjct: 71  NPETVARYQVQGIPTLLLFQNGELVER-VEGAIGRDRIQTLINAHL 115


>gi|156630909|sp|P10472|THIO_CHLLT RecName: Full=Thioredoxin; Short=Trx
          Length = 108

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/103 (40%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +   K+F +E+L+    V+VDFWASWC PC+ L P+I+ +AD+   K  I KL+++E+  
Sbjct: 6   EATDKNFQTEILDSDKAVLVDFWASWCGPCMMLGPVIEQLADDYEGKAIIAKLNVDENPN 65

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ +Y I SIPT+++ K GKV+D+M+ GA  ++ I + I   +
Sbjct: 66  IAGQYGIRSIPTMLIIKGGKVVDQMV-GALPKNMIAKKIDEHI 107


>gi|298492062|ref|YP_003722239.1| thioredoxin ['Nostoc azollae' 0708]
 gi|298233980|gb|ADI65116.1| thioredoxin ['Nostoc azollae' 0708]
          Length = 107

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A  V    F+ EV+E   PV+VDFWA WC PC  ++P++++IA +   ++K+ K++ +E
Sbjct: 3   AAASVTDDLFEQEVIESPLPVLVDFWAPWCGPCRMVAPVVEEIAAQYEGQLKVVKVNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +++ +Y I SIPTL++FK G+ +D M+ GA  +S +   +   +
Sbjct: 63  NPQVAGKYGIRSIPTLMIFKGGQKVD-MVVGAVPKSTLSTTLEKYL 107


>gi|254476381|ref|ZP_05089767.1| thioredoxin [Ruegeria sp. R11]
 gi|214030624|gb|EEB71459.1| thioredoxin [Ruegeria sp. R11]
          Length = 106

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV   + PVVVDFWA WC PC ++ P ++++A E  DKVKI K+D++
Sbjct: 1   MSTVAVTDDTFDAEVKNSAVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGQVVSNR-SGAAPKAALQSWIDESI 106


>gi|108762690|ref|YP_630871.1| thioredoxin [Myxococcus xanthus DK 1622]
 gi|108466570|gb|ABF91755.1| thioredoxin [Myxococcus xanthus DK 1622]
          Length = 110

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 67/110 (60%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +    F  +VL+   PV+VDFWA+WC PC  ++P I+ +A +   +VK  KL
Sbjct: 1   MAGADVTNIGDGDFKQQVLDSQEPVLVDFWATWCAPCRAIAPSIEALASQYKGQVKFAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ +    Y I SIPTL+LFK G+V+++++ GA  ++ I E +   +
Sbjct: 61  NIDENQDTPQEYGIRSIPTLLLFKGGRVVEQIV-GAVPKARIEEAVKKAL 109


>gi|261212503|ref|ZP_05926788.1| thioredoxin 2 [Vibrio sp. RC341]
 gi|262189645|ref|ZP_06048028.1| thioredoxin 2 [Vibrio cholerae CT 5369-93]
 gi|260838434|gb|EEX65090.1| thioredoxin 2 [Vibrio sp. RC341]
 gi|262034473|gb|EEY52830.1| thioredoxin 2 [Vibrio cholerae CT 5369-93]
          Length = 144

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E 
Sbjct: 39  APIEGTEANF-SALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  +QI SIPT+++FK+G+ ID M+ GA  +S   +W+   +
Sbjct: 98  QQNLAAHFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWLNQAL 142


>gi|254226184|ref|ZP_04919779.1| thioredoxin 2 [Vibrio cholerae V51]
 gi|125621286|gb|EAZ49625.1| thioredoxin 2 [Vibrio cholerae V51]
          Length = 144

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E 
Sbjct: 39  APIEGTEANF-SALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQLRCVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  +QI SIPT+++FK+G+ ID M+ GA  +S   +W+   +
Sbjct: 98  QQNLAAHFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWLNQAL 142


>gi|1351239|sp|P48384|TRXM_PEA RecName: Full=Thioredoxin M-type, chloroplastic; Short=Trx-M;
           Flags: Precursor
 gi|431957|emb|CAA53900.1| thioredoxin m [Pisum sativum]
          Length = 172

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V+  S+D  V+    PV+VDFWA WC PC  ++PIID++A E A K+K  KL+ +ES
Sbjct: 69  VQVVNDSSWDELVIGSETPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNTDES 128

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +T+Y I SIPT++ FK+G+  D ++ GA  ++ + E +   +
Sbjct: 129 PNTATKYGIRSIPTVLFFKNGERKDSVI-GAVPKATLSEKVEKYI 172


>gi|326317371|ref|YP_004235043.1| thioredoxin [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374207|gb|ADX46476.1| thioredoxin [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 110

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   SF+++VL+    V+VD+WA WC PC  ++PI+D++AD    K+ + K+
Sbjct: 1   MASELIKHISDASFEADVLQPGTTVLVDYWAEWCGPCKMIAPILDEVADSYQGKLTVAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ E+  ++ I  IPTL+LFKDG++    + GA S++ +  +I  ++
Sbjct: 61  NVDENREVPAKFGIRGIPTLMLFKDGQLAATKV-GAMSKAQLTSFIDQQL 109


>gi|27364380|ref|NP_759908.1| thioredoxin [Vibrio vulnificus CMCP6]
 gi|320157763|ref|YP_004190142.1| thioredoxin [Vibrio vulnificus MO6-24/O]
 gi|27360499|gb|AAO09435.1| thioredoxin [Vibrio vulnificus CMCP6]
 gi|319933075|gb|ADV87939.1| thioredoxin [Vibrio vulnificus MO6-24/O]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++  + F+++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+
Sbjct: 1   MSDKILQLSDEGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    ++ I  IPTL+LFK+G V    + GA S++ + E++ + +
Sbjct: 61  IDHNAGTPPKFGIRGIPTLLLFKNGSVAATKV-GALSKTQLKEFLDANL 108


>gi|330795171|ref|XP_003285648.1| hypothetical protein DICPUDRAFT_76580 [Dictyostelium purpureum]
 gi|325084374|gb|EGC37803.1| hypothetical protein DICPUDRAFT_76580 [Dictyostelium purpureum]
          Length = 402

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + ++ K+F  +VLE    V+V+F+A WC  C  L P  +  A  +   VKI  ++ +E 
Sbjct: 30  VINLNKKNFKQQVLEGDGNVMVEFYAPWCGHCKSLKPEYEKAAKNVKGLVKIAAINCDEE 89

Query: 63  SEISTRYQISSIPTLILF---KDGKVIDRMMPGASSQSDIIEWILSRV 107
            E+  +YQI   PTL  F   K+GK       G  + S I+++ LS++
Sbjct: 90  KELCGQYQIQGFPTLKFFATQKNGKKQPEDYQGGRTASAIVKFALSKL 137


>gi|254487203|ref|ZP_05100408.1| thioredoxin [Roseobacter sp. GAI101]
 gi|214044072|gb|EEB84710.1| thioredoxin [Roseobacter sp. GAI101]
          Length = 106

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +F++EV     PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATVAVTDATFEAEVKNSDIPVVVDFWAEWCGPCKQIGPSLEELSAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L +FK G+V+   M GA  ++ +  WI   +
Sbjct: 61  ENPNSPAQMGVRGIPALFIFKGGEVV-SNMAGARPKAALQSWIEESI 106


>gi|330470819|ref|YP_004408562.1| thioredoxin [Verrucosispora maris AB-18-032]
 gi|328813790|gb|AEB47962.1| thioredoxin [Verrucosispora maris AB-18-032]
          Length = 107

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V   SF  +VL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I+E
Sbjct: 3   ATKSVTDASFVVDVLKSDKPVLVDFWAEWCGPCRKVSPLLEEIAREMGDQVSIVKLNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  Y++ S+PTL +FK+G+ + + + GA  + ++++ I S +
Sbjct: 63  NPETARAYRVMSVPTLTVFKNGEPV-QSIAGAKPKGELVKLIQSAL 107


>gi|52843129|ref|YP_096928.1| hypothetical protein lpg2935 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54295774|ref|YP_128189.1| hypothetical protein lpl2864 [Legionella pneumophila str. Lens]
 gi|54298936|ref|YP_125305.1| hypothetical protein lpp3003 [Legionella pneumophila str. Paris]
 gi|148361268|ref|YP_001252475.1| hypothetical protein LPC_3242 [Legionella pneumophila str. Corby]
 gi|296108606|ref|YP_003620307.1| hypothetical protein lpa_04292 [Legionella pneumophila 2300/99
           Alcoy]
 gi|52630240|gb|AAU28981.1| RSc1188; probable thioredoxin 1 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53752721|emb|CAH14156.1| hypothetical protein lpp3003 [Legionella pneumophila str. Paris]
 gi|53755606|emb|CAH17108.1| hypothetical protein lpl2864 [Legionella pneumophila str. Lens]
 gi|148283041|gb|ABQ57129.1| hypothetical protein LPC_3242 [Legionella pneumophila str. Corby]
 gi|295650508|gb|ADG26355.1| Hypothetical protein lpa_04292 [Legionella pneumophila 2300/99
           Alcoy]
 gi|307611824|emb|CBX01537.1| hypothetical protein LPW_32241 [Legionella pneumophila 130b]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+ +V+  S PV+VDFWA WC PC  L+PI++++A   +  +   K++
Sbjct: 1   MSDHIKTVTDASFEQDVINSSKPVLVDFWAEWCGPCRALTPILEEVAATHSKDMTFAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   ++ + SIPTLILFK+G+ ++ +  G  S+S +  ++ S +
Sbjct: 61  IDENPQAPAKFGVMSIPTLILFKNGQ-VEAVKMGLLSKSQLSAFVESNL 108


>gi|254418173|ref|ZP_05031897.1| thioredoxin [Brevundimonas sp. BAL3]
 gi|196184350|gb|EDX79326.1| thioredoxin [Brevundimonas sp. BAL3]
          Length = 111

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV  +SFD++VL+ S PV+VDFWA WC PC ++ P ++ IADEL  +V + K++I+
Sbjct: 1   MATVKVTDESFDADVLKSSTPVLVDFWAEWCGPCKQIGPALEQIADELGGQVTVAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +S    ++  +  IPTL+LFKDG++    + GA  +  I+EW+   
Sbjct: 61  DSPMTPSKLGVKGIPTLMLFKDGQMTSMKV-GAMPKGKIVEWLAEA 105


>gi|94985937|ref|YP_605301.1| thioredoxin [Deinococcus geothermalis DSM 11300]
 gi|94556218|gb|ABF46132.1| thioredoxin [Deinococcus geothermalis DSM 11300]
          Length = 110

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  +++   +F SE        +VDFWA WC PC  ++P+++++AD+   +VK+ KL+++
Sbjct: 1   MKPVELTDSNFQSET--AQGLTLVDFWAPWCGPCRIIAPVVEELADQYEGRVKVGKLNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++  IS +Y++ SIPTLILFKDG+ ++ M+ GA  +      +   V
Sbjct: 59  DNPGISGQYRVMSIPTLILFKDGQPVEGMV-GAQPKRAFEALLDKYV 104


>gi|325971856|ref|YP_004248047.1| thioredoxin [Spirochaeta sp. Buddy]
 gi|324027094|gb|ADY13853.1| thioredoxin [Spirochaeta sp. Buddy]
          Length = 106

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +F+ EVL+   PV+VDFWA WC PC  ++P I  +A   ADK+K+ K++++
Sbjct: 1   MSEIIVTEANFEQEVLKADKPVLVDFWAPWCGPCKMIAPAIAQLAQAHADKLKVAKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+  ++T Y ++SIPTL+LFK G+V+ + M GA+S S I  ++   +
Sbjct: 61  EAGSLATMYSVNSIPTLMLFKGGEVVGQRM-GAASLSVIEGFVAEFL 106


>gi|315925571|ref|ZP_07921781.1| thioredoxin [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315621112|gb|EFV01083.1| thioredoxin [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 102

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/101 (46%), Positives = 76/101 (75%), Gaps = 2/101 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + +   +F+SEVL+ + PV+VDFWASWC PC  +SP++D+IA+E  D+VK+ K++++
Sbjct: 1   MSVVTLTKDNFESEVLQSNKPVLVDFWASWCGPCKMVSPLVDEIAEE-HDEVKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E SE++ ++QI SIPTL++FKDG++  R + GA  +  I+ 
Sbjct: 60  EESELAQQFQIMSIPTLLVFKDGEIAQRQV-GAVPKEKIVA 99


>gi|33865258|ref|NP_896817.1| thioredoxin [Synechococcus sp. WH 8102]
 gi|260436036|ref|ZP_05790006.1| thioredoxin [Synechococcus sp. WH 8109]
 gi|33632427|emb|CAE07239.1| Thioredoxin [Synechococcus sp. WH 8102]
 gi|260413910|gb|EEX07206.1| thioredoxin [Synechococcus sp. WH 8109]
          Length = 107

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+++IA E   ++K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVEEIAKEFDGQIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKATLSGTISKYL 107


>gi|56478118|ref|YP_159707.1| thioredoxin [Aromatoleum aromaticum EbN1]
 gi|56314161|emb|CAI08806.1| Thioredoxin [Aromatoleum aromaticum EbN1]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F++EVL+   PV+VD+WA WC PC  ++PI+DD+A E A K+K+ KL+I+E+ E 
Sbjct: 8   VTDGNFEAEVLQSQTPVLVDYWAEWCGPCKMIAPILDDVAKEYAGKLKVAKLNIDENQET 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ +  IPTL+LFK G V    + GA S+S +  +I S +
Sbjct: 68  PAKFGVRGIPTLMLFKGGNVEATKV-GALSKSQLTAFIDSNL 108


>gi|254508580|ref|ZP_05120697.1| thioredoxin [Vibrio parahaemolyticus 16]
 gi|219548522|gb|EED25530.1| thioredoxin [Vibrio parahaemolyticus 16]
          Length = 120

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F+++V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 13  MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 72

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 73  IDQNAGTPPKFGIRGIPTLLLFKDGNVAATKV-GALSKTQLKEFLDANL 120


>gi|312881438|ref|ZP_07741233.1| thioredoxin [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370920|gb|EFP98377.1| thioredoxin [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++    F++ V+  + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLTDDGFENSVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDHNAGTPPKFGIRGIPTLLLFKDGNVAATKV-GALSKTQLKEFLDANL 108


>gi|78184297|ref|YP_376732.1| thioredoxin [Synechococcus sp. CC9902]
 gi|116071056|ref|ZP_01468325.1| Thioredoxin [Synechococcus sp. BL107]
 gi|78168591|gb|ABB25688.1| thioredoxin [Synechococcus sp. CC9902]
 gi|116066461|gb|EAU72218.1| Thioredoxin [Synechococcus sp. BL107]
          Length = 107

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+++IA E   ++K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVEEIAKEFEGQIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKATLSGTISKYL 107


>gi|118482960|gb|ABK93392.1| unknown [Populus trichocarpa]
          Length = 318

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD--I 59
           S + +   +F+  VL+ +  V+V+F+A WC  C  L+PI + +A        +   +   
Sbjct: 143 SVVVLTADNFNDIVLDENKDVLVEFYAPWCGHCKNLAPIYEKVATAFKSGEDVVVANLEA 202

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 203 DKYRDLAEKYGVSGFPTLKFFPKGNKAGEEYEGGRDLDDFVAFINEK 249



 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 26  VVVLTEDNFEKEVGQ-DKGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKAVLIGKVDCD 84

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PTL  F  G +  +   G  +   + E++ + 
Sbjct: 85  EHKGVCSKYGVSGYPTLQWFPKGSLEPKKYEGPRTAEALAEFVNNE 130


>gi|120437351|ref|YP_863037.1| thioredoxin [Gramella forsetii KT0803]
 gi|117579501|emb|CAL67970.1| thioredoxin [Gramella forsetii KT0803]
          Length = 105

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  ++   +F+ +VL+   PVVVDFWA+WC PC  + PIID+I+ E   K  + KLD++
Sbjct: 1   MAV-EITDANFEEQVLKSDKPVVVDFWAAWCGPCRMVGPIIDEISTEYEGKAVVGKLDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++F++G+V+ R + G + +    + I   +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFQNGEVVGRQV-GVAPKQTYADAIDQLL 105


>gi|15601507|ref|NP_233138.1| thioredoxin 2 [Vibrio cholerae O1 biovar eltor str. N16961]
 gi|121585544|ref|ZP_01675340.1| thioredoxin [Vibrio cholerae 2740-80]
 gi|147671803|ref|YP_001215529.1| thioredoxin 2 [Vibrio cholerae O395]
 gi|153215604|ref|ZP_01950049.1| thioredoxin 2 [Vibrio cholerae 1587]
 gi|153818647|ref|ZP_01971314.1| thioredoxin [Vibrio cholerae NCTC 8457]
 gi|153820684|ref|ZP_01973351.1| thioredoxin 2 [Vibrio cholerae B33]
 gi|153824349|ref|ZP_01977016.1| thioredoxin 2 [Vibrio cholerae MZO-2]
 gi|153829865|ref|ZP_01982532.1| thioredoxin 2 [Vibrio cholerae 623-39]
 gi|227812319|ref|YP_002812329.1| thioredoxin 2 [Vibrio cholerae M66-2]
 gi|229506091|ref|ZP_04395600.1| thioredoxin 2 [Vibrio cholerae BX 330286]
 gi|229510052|ref|ZP_04399532.1| thioredoxin 2 [Vibrio cholerae B33]
 gi|229514200|ref|ZP_04403661.1| thioredoxin 2 [Vibrio cholerae TMA 21]
 gi|229516387|ref|ZP_04405834.1| thioredoxin 2 [Vibrio cholerae RC9]
 gi|229522314|ref|ZP_04411730.1| thioredoxin 2 [Vibrio cholerae TM 11079-80]
 gi|229526725|ref|ZP_04416129.1| thioredoxin 2 [Vibrio cholerae bv. albensis VL426]
 gi|229605622|ref|YP_002876326.1| thioredoxin 2 [Vibrio cholerae MJ-1236]
 gi|254285774|ref|ZP_04960737.1| thioredoxin 2 [Vibrio cholerae AM-19226]
 gi|254849913|ref|ZP_05239263.1| thioredoxin 2 [Vibrio cholerae MO10]
 gi|255746487|ref|ZP_05420434.1| thioredoxin 2 [Vibrio cholera CIRS 101]
 gi|262152382|ref|ZP_06028515.1| thioredoxin 2 [Vibrio cholerae INDRE 91/1]
 gi|262168594|ref|ZP_06036290.1| thioredoxin 2 [Vibrio cholerae RC27]
 gi|298499548|ref|ZP_07009354.1| thioredoxin 2 [Vibrio cholerae MAK 757]
 gi|9658173|gb|AAF96650.1| thioredoxin 2 [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121550161|gb|EAX60175.1| thioredoxin [Vibrio cholerae 2740-80]
 gi|124114692|gb|EAY33512.1| thioredoxin 2 [Vibrio cholerae 1587]
 gi|126510800|gb|EAZ73394.1| thioredoxin [Vibrio cholerae NCTC 8457]
 gi|126521727|gb|EAZ78950.1| thioredoxin 2 [Vibrio cholerae B33]
 gi|146314186|gb|ABQ18726.1| thioredoxin 2 [Vibrio cholerae O395]
 gi|148874666|gb|EDL72801.1| thioredoxin 2 [Vibrio cholerae 623-39]
 gi|149741903|gb|EDM55932.1| thioredoxin 2 [Vibrio cholerae MZO-2]
 gi|150424271|gb|EDN16209.1| thioredoxin 2 [Vibrio cholerae AM-19226]
 gi|227011461|gb|ACP07672.1| thioredoxin 2 [Vibrio cholerae M66-2]
 gi|227015187|gb|ACP11396.1| thioredoxin 2 [Vibrio cholerae O395]
 gi|229336883|gb|EEO01901.1| thioredoxin 2 [Vibrio cholerae bv. albensis VL426]
 gi|229340299|gb|EEO05305.1| thioredoxin 2 [Vibrio cholerae TM 11079-80]
 gi|229346268|gb|EEO11239.1| thioredoxin 2 [Vibrio cholerae RC9]
 gi|229348180|gb|EEO13138.1| thioredoxin 2 [Vibrio cholerae TMA 21]
 gi|229352497|gb|EEO17437.1| thioredoxin 2 [Vibrio cholerae B33]
 gi|229356442|gb|EEO21360.1| thioredoxin 2 [Vibrio cholerae BX 330286]
 gi|229372108|gb|ACQ62530.1| thioredoxin 2 [Vibrio cholerae MJ-1236]
 gi|254845618|gb|EET24032.1| thioredoxin 2 [Vibrio cholerae MO10]
 gi|255736241|gb|EET91639.1| thioredoxin 2 [Vibrio cholera CIRS 101]
 gi|262023123|gb|EEY41828.1| thioredoxin 2 [Vibrio cholerae RC27]
 gi|262030833|gb|EEY49464.1| thioredoxin 2 [Vibrio cholerae INDRE 91/1]
 gi|297541529|gb|EFH77580.1| thioredoxin 2 [Vibrio cholerae MAK 757]
 gi|327485758|gb|AEA80164.1| Thioredoxin 2 [Vibrio cholerae LMA3894-4]
          Length = 144

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E 
Sbjct: 39  APIEGTEANF-SALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  +QI SIPT+++FK+G+ ID M+ GA  +S   +W+   +
Sbjct: 98  QQNLAAHFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWLNQAL 142


>gi|217969085|ref|YP_002354319.1| thioredoxin [Thauera sp. MZ1T]
 gi|217506412|gb|ACK53423.1| thioredoxin [Thauera sp. MZ1T]
          Length = 145

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++D  +FD  V     PV+VDFWA WC PC  ++P     A  L  ++++ KLD E   
Sbjct: 42  VELDAANFDRHVGRSDVPVLVDFWAPWCGPCRTMAPAFAQAAGMLEPQLRLAKLDTEAHQ 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++ R+ I SIPTL LF+ G+ I R   GA S +DI+ W+  ++
Sbjct: 102 ALAARFGIRSIPTLALFRGGREIAR-QAGAMSAADIVRWVRGQL 144


>gi|92114547|ref|YP_574475.1| thioredoxin [Chromohalobacter salexigens DSM 3043]
 gi|91797637|gb|ABE59776.1| thioredoxin [Chromohalobacter salexigens DSM 3043]
          Length = 107

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSA-LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + V + +F+ EV+    PV++ FWA WC PC  ++P++D++ADE A  +K+  +++
Sbjct: 1   MANNVDVTSANFEQEVINAEQPVLLKFWAPWCGPCKMMAPVVDEVADEKAGGLKVVSVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +++ EI+    +  +PT++LFK G  +  ++ GA S+S + ++I   
Sbjct: 61  DDAPEIAAEQGVRGVPTVMLFKSGAKVASLV-GAQSKSQLTQFIDQN 106


>gi|255558409|ref|XP_002520230.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis]
 gi|223540576|gb|EEF42142.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis]
          Length = 181

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L V  +++ S VLE   PV+V+FWA WC PC  + P+ID +A E   K+K  KL+ +ES
Sbjct: 78  VLAVTDQTWKSLVLESEFPVLVEFWAPWCGPCRMIHPVIDALAGEYVGKLKCYKLNTDES 137

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++T+Y I SIPT+++FKDG+  D ++ GA  ++ +   I   +
Sbjct: 138 PSVATQYGIRSIPTVMIFKDGEKKDAII-GAVPKTTLTASIEKFL 181


>gi|149912865|ref|ZP_01901399.1| thioredoxin [Roseobacter sp. AzwK-3b]
 gi|149813271|gb|EDM73097.1| thioredoxin [Roseobacter sp. AzwK-3b]
          Length = 106

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V  ++FD+EV     PVVVDFWA WC PC ++ P ++++++E+  KVKI K+D++
Sbjct: 1   MGTVAVTDETFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELSEEMGGKVKIAKIDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FK+G+VI     GA+ ++ +  WI S +
Sbjct: 61  SNPNTAAAMGVRGIPALFIFKNGEVISNR-AGAAPKAALQNWIESSI 106


>gi|229528375|ref|ZP_04417766.1| thioredoxin 2 [Vibrio cholerae 12129(1)]
 gi|229334737|gb|EEO00223.1| thioredoxin 2 [Vibrio cholerae 12129(1)]
          Length = 144

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E 
Sbjct: 39  APIEGTEANF-SALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  +QI SIPT+++FK+G+ ID M+ GA  +S   +W+   +
Sbjct: 98  QQNLAAHFQIRSIPTIMVFKNGQRID-MINGALPKSQFNQWLNQAL 142


>gi|116781777|gb|ABK22237.1| unknown [Picea sitchensis]
          Length = 194

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V+  ++ + VL+   PV+VDFWA WC PC  + P+ID++A + + K++  KL+ +ES
Sbjct: 89  VQDVNDGTWKTLVLDSDIPVLVDFWAPWCGPCRMIEPLIDELAKQYSGKIRCLKLNTDES 148

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T Y I SIPT++LFK+G+  D ++ GA  ++ +   I   V
Sbjct: 149 PRIATEYGIRSIPTVMLFKNGEKKDTVI-GAVPKTTLTASIEKYV 192


>gi|160942752|ref|ZP_02089993.1| hypothetical protein FAEPRAM212_00229 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445917|gb|EDP22920.1| hypothetical protein FAEPRAM212_00229 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103828|emb|CBL01372.1| thioredoxin [Faecalibacterium prausnitzii SL3/3]
          Length = 102

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F  EVL    PV++DFWASWC PC  LSP++D++A+E    VK+ K++++
Sbjct: 1   MAVINITKENFAQEVLHSEKPVLLDFWASWCGPCRMLSPVVDEVAEE-RTDVKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  +++ ++ + SIPTL++F+ GK++ + + GA  ++ ++E +
Sbjct: 60  EQPDLAAQFGVMSIPTLLVFEQGKLVRQAV-GARPKAGVLELL 101


>gi|215708806|dbj|BAG94075.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 367

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDI 59
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+PI +      +  + V I  LD 
Sbjct: 149 SVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASVYKQDEGVVIANLDA 208

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ + ++ +Y +S  PTL  F  G        G     D +++I  +
Sbjct: 209 DKHTALAEKYGVSGFPTLKFFPKGNKAGEDYDGGRELDDFVKFINEK 255



 Score = 83.7 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            L +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 32  VLALTESTFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 90

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ S 
Sbjct: 91  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYVNSE 136


>gi|71908610|ref|YP_286197.1| thioredoxin [Dechloromonas aromatica RCB]
 gi|71848231|gb|AAZ47727.1| Thioredoxin [Dechloromonas aromatica RCB]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F++EVL+   PV+VD+WA WC PC  ++PI+D++A E A K+K+ K++I+++   
Sbjct: 8   VTDDTFEAEVLQSQQPVLVDYWAEWCGPCKMIAPILDEVATEYAGKLKVAKVNIDDNQAT 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++ I  IPTL++FK+G V    + GA S+S +  +I S +
Sbjct: 68  PAKFGIRGIPTLMIFKNGNVEATKV-GALSKSQLAAFIDSNL 108


>gi|149201423|ref|ZP_01878398.1| thioredoxin [Roseovarius sp. TM1035]
 gi|149145756|gb|EDM33782.1| thioredoxin [Roseovarius sp. TM1035]
          Length = 106

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV     PVVVDFWA WC PC ++ P++++++ E++ +VKI K+D++
Sbjct: 1   MATVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPVLEELSSEMSGRVKIVKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNSAVAMGVRGIPALFIFKDGQVVSNR-AGAAPKAALQSWIEDSI 106


>gi|307823863|ref|ZP_07654091.1| thioredoxin [Methylobacter tundripaludum SV96]
 gi|307735157|gb|EFO06006.1| thioredoxin [Methylobacter tundripaludum SV96]
          Length = 143

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L++  ++F   +     PVVVDFWASWC PC  ++P     A  L  KV++ KL+ E+  
Sbjct: 41  LELTGRNFQQHIARNDIPVVVDFWASWCGPCKMMAPAYAQAAAALEPKVRLAKLNTEQEQ 100

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+ ++ I SIPTL++FK G+ I RM  GA S +DI+ W+ S V
Sbjct: 101 DIAGQFNIRSIPTLVIFKSGREIARM-SGAMSAADIVRWVNSNV 143


>gi|192360857|ref|YP_001980884.1| thioredoxin [Cellvibrio japonicus Ueda107]
 gi|190687022|gb|ACE84700.1| thioredoxin [Cellvibrio japonicus Ueda107]
          Length = 138

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + +   SF+ EV+    PV+VDFWA WC PC  ++PI+DD+A++   K+KITKL++++
Sbjct: 34  AIVHISDASFEQEVIAADIPVLVDFWAPWCGPCKMIAPILDDLAEQFEGKLKITKLNVDD 93

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E + ++ +  IPTLI+FK+G      + GA S+  ++++I   +
Sbjct: 94  NKESAAKFNVRGIPTLIIFKNGAAHATKV-GALSKPQLVDFINGAL 138


>gi|119776348|ref|YP_929088.1| thioredoxin [Shewanella amazonensis SB2B]
 gi|119768848|gb|ABM01419.1| thioredoxin [Shewanella amazonensis SB2B]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+   PV+VDFWA WC PC  ++PI+DD+A E   KV + KL+
Sbjct: 1   MSDKIVTLSDDSFENDVLKSELPVLVDFWAEWCGPCKMIAPILDDVAAEYEGKVTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ ++    +Y +  IPTL++FK G+++   + GA S++ + E+I +++
Sbjct: 61  VDHNNASPAKYGVRGIPTLLMFKGGELVATKV-GALSKTQLKEFIDAQL 108


>gi|114332429|ref|YP_748651.1| thioredoxin [Nitrosomonas eutropha C91]
 gi|114309443|gb|ABI60686.1| thioredoxin [Nitrosomonas eutropha C91]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F++EVL+C  PV+VD+WA WC PC  ++PI+D+IA+E   ++K+ KL+I+E+   
Sbjct: 8   VTDATFEAEVLQCPLPVLVDYWAEWCGPCRMIAPILDEIANEYNGRLKVAKLNIDENQST 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y I  IPTL+LFK+G +    + GA S+S +I ++   +
Sbjct: 68  PQKYGIRGIPTLMLFKNGNIEATKV-GALSKSQLIAFVDDHL 108


>gi|260770665|ref|ZP_05879596.1| thioredoxin [Vibrio furnissii CIP 102972]
 gi|260614391|gb|EEX39579.1| thioredoxin [Vibrio furnissii CIP 102972]
 gi|315178383|gb|ADT85297.1| thiol-disulfide isomerase and thioredoxin [Vibrio furnissii NCTC
           11218]
          Length = 108

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++  + F+++V++ + PV+VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSDKILQLSDEGFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    ++ I  IPTL+LFKDG V    + GA S++ + E++ + +
Sbjct: 61  IDHNAGTPPKFGIRGIPTLLLFKDGSVAATKV-GALSKTQLKEFLDANL 108


>gi|125972881|ref|YP_001036791.1| thioredoxin [Clostridium thermocellum ATCC 27405]
 gi|256006001|ref|ZP_05430940.1| thioredoxin [Clostridium thermocellum DSM 2360]
 gi|281417080|ref|ZP_06248100.1| thioredoxin [Clostridium thermocellum JW20]
 gi|125713106|gb|ABN51598.1| thioredoxin [Clostridium thermocellum ATCC 27405]
 gi|255990024|gb|EEU00167.1| thioredoxin [Clostridium thermocellum DSM 2360]
 gi|281408482|gb|EFB38740.1| thioredoxin [Clostridium thermocellum JW20]
 gi|316940881|gb|ADU74915.1| thioredoxin [Clostridium thermocellum DSM 1313]
          Length = 109

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 75/110 (68%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + +  ++F+ EVL     V+VDFWA WC PC  +SPIID++A+E   + K+ KL
Sbjct: 1   MAGEKVVILTKENFEQEVLNSDKVVMVDFWAPWCGPCRAVSPIIDELAEEYDGRAKVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++   E++ +++I +IPT+++FK+G+V+++++ GA S++++   I   +
Sbjct: 61  NVDSEGEVTEKFRIMNIPTIMVFKNGEVVEKLI-GARSKTELASAIDKHL 109


>gi|298531010|ref|ZP_07018411.1| thioredoxin [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509033|gb|EFI32938.1| thioredoxin [Desulfonatronospira thiodismutans ASO3-1]
          Length = 105

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F+ EVL+C  PV+VDFWA WC PC  + P+++++A E   ++K+ K++++E+   
Sbjct: 5   VTDNNFEEEVLKCELPVLVDFWAPWCGPCRAIGPVVEELAQEYTGRLKVLKMNVDENPGT 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y I +IPTLIL+K G V+++ + GA S++++ + I   V
Sbjct: 65  PGKYGIRAIPTLILYKGGDVMEQ-VTGAVSKANLKQMIDKAV 105


>gi|254452651|ref|ZP_05066088.1| thioredoxin [Octadecabacter antarcticus 238]
 gi|198267057|gb|EDY91327.1| thioredoxin [Octadecabacter antarcticus 238]
          Length = 106

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV + + PVVVDFWA WC PC ++ P +++++ E+  K+KI K++++
Sbjct: 1   MATVAVTDDTFDAEVRQSTIPVVVDFWAEWCGPCKQIGPALEELSAEMDGKIKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+     +  +  IP L LFKDG+V+     GA+ ++ +  WI  
Sbjct: 61  ENPNAPAQMGVRGIPALFLFKDGEVVSNK-TGAAPKAALKSWIEE 104


>gi|168032658|ref|XP_001768835.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162679947|gb|EDQ66388.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 190

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 64/102 (62%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  ++   VLE   PV+VDFWA WC PC  ++P+ID+IA   A KVK  KL+ +ES  I
Sbjct: 90  VNETTWKELVLESDIPVLVDFWAPWCGPCRMIAPLIDEIAKAYAGKVKCLKLNTDESPGI 149

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT+++FK G+  D ++ GA  +S +   +   +
Sbjct: 150 ATEYGIRSIPTVMVFKGGEKKDTVI-GAVPKSTLTSTLEKHL 190


>gi|116073100|ref|ZP_01470362.1| Thioredoxin [Synechococcus sp. RS9916]
 gi|116068405|gb|EAU74157.1| Thioredoxin [Synechococcus sp. RS9916]
          Length = 107

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKATLSGTISKYL 107


>gi|84501211|ref|ZP_00999416.1| thioredoxin [Oceanicola batsensis HTCC2597]
 gi|84390502|gb|EAQ02990.1| thioredoxin [Oceanicola batsensis HTCC2597]
          Length = 106

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FDSEV     PVVVDFWA WC PC ++ P ++++++E  +K+KI K+D++
Sbjct: 1   MTTVAVTDDTFDSEVKNSEVPVVVDFWAEWCGPCKQIGPALEELSEEFGEKLKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +     +  +  IP L +FKDG+VI     GA+ ++ +  WI   +
Sbjct: 61  SNPNTPMQLGVRGIPALFIFKDGEVISNR-AGAAPKASLKAWIEESI 106


>gi|114566014|ref|YP_753168.1| thioredoxin [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114336949|gb|ABI67797.1| thioredoxin [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 109

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 69/106 (65%), Gaps = 2/106 (1%)

Query: 1   MSALKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+ +K+ +  +++ EV++   PV+VDFWA WC PC  + P+++ +A E A K+ I K+++
Sbjct: 1   MADIKIFNQDNWEKEVMQSDLPVLVDFWAPWCGPCKMVGPVVESLAAENAGKINIGKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +E+ +++ R+ I  IPTL  F+ G  + R++ GA +++ + + I  
Sbjct: 61  DENQDLAARFGIRGIPTLAFFQGGSEVKRIV-GAQNKAQLQKAIDE 105


>gi|329911422|ref|ZP_08275522.1| Thioredoxin [Oxalobacteraceae bacterium IMCC9480]
 gi|327545899|gb|EGF31003.1| Thioredoxin [Oxalobacteraceae bacterium IMCC9480]
          Length = 108

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ +VL+   PV+VDFWA WC PC  ++PI+++IA E   K+ I K+D
Sbjct: 1   MSENIKHITDASFEIDVLKSDKPVLVDFWAEWCGPCKSIAPILEEIAKEYDGKLLIAKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +  +  ++ I  IPTLILFK+G    + + GA ++  +  +I S +
Sbjct: 61  VDSNQAVPAKFGIRGIPTLILFKNGVPAAQKV-GAMAKGQLTSFIDSNI 108


>gi|261368310|ref|ZP_05981193.1| thioredoxin [Subdoligranulum variabile DSM 15176]
 gi|282569683|gb|EFB75218.1| thioredoxin [Subdoligranulum variabile DSM 15176]
          Length = 104

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 72/105 (68%), Gaps = 2/105 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS L +  ++F +EV+    PV+VDFWASWC PC  +SP++D+IA E   ++K+ K++++
Sbjct: 1   MSVLHITKENFVNEVVNSDRPVLVDFWASWCGPCRMVSPLVDEIAAE-HPEIKVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E  E++ ++Q+ SIPTL++ K+G+V  R + GA  ++ I+  +  
Sbjct: 60  EQPELAGQFQVMSIPTLMVVKNGQVTQRTV-GARPKNQILALVQE 103


>gi|66043570|ref|YP_233411.1| thioredoxin [Pseudomonas syringae pv. syringae B728a]
 gi|63254277|gb|AAY35373.1| Thioredoxin [Pseudomonas syringae pv. syringae B728a]
 gi|330971842|gb|EGH71908.1| thioredoxin [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 116

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 65/107 (60%), Gaps = 4/107 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   +FD+EVLE   PV+VD+WA WC PC  ++P++D+IA     ++ + KL
Sbjct: 1   MSSDLIKHVTDGTFDAEVLEAQGPVLVDYWAEWCGPCKMIAPVLDEIASTYKGRLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           +I+++ +   ++ +  IPTL+LFK G V    + GA S+S +  ++ 
Sbjct: 61  NIDQNPDTPAKHGVRGIPTLMLFKGGNVEATKV-GALSKSQLTAFLE 106


>gi|115462193|ref|NP_001054696.1| Os05g0156300 [Oryza sativa Japonica Group]
 gi|75326516|sp|Q75M08|PDI21_ORYSJ RecName: Full=Protein disulfide isomerase-like 2-1;
           Short=OsPDIL2-1; AltName: Full=Protein disulfide
           isomerase-like 4-1; Short=OsPDIL4-1; Flags: Precursor
 gi|54291859|gb|AAV32227.1| putative disulfide-isomerase [Oryza sativa Japonica Group]
 gi|57863918|gb|AAS55771.2| putative disulfide-isomerase [Oryza sativa Japonica Group]
 gi|113578247|dbj|BAF16610.1| Os05g0156300 [Oryza sativa Japonica Group]
 gi|215678906|dbj|BAG96336.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215692773|dbj|BAG88199.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215704383|dbj|BAG93817.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218196130|gb|EEC78557.1| hypothetical protein OsI_18529 [Oryza sativa Indica Group]
 gi|222630259|gb|EEE62391.1| hypothetical protein OsJ_17181 [Oryza sativa Japonica Group]
          Length = 366

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDI 59
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+PI +      +  + V I  LD 
Sbjct: 149 SVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASVYKQDEGVVIANLDA 208

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ + ++ +Y +S  PTL  F  G        G     D +++I  +
Sbjct: 209 DKHTALAEKYGVSGFPTLKFFPKGNKAGEDYDGGRELDDFVKFINEK 255



 Score = 83.7 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            L +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 32  VLALTESTFEKEVGQ-DRAALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 90

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ S 
Sbjct: 91  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYVNSE 136


>gi|220904469|ref|YP_002479781.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868768|gb|ACL49103.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 107

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   +F+S VL+   PV++DFWA WC PC  + PIID++A E A KV+I K++++
Sbjct: 1   MAE-QVTDATFESVVLKSDLPVLLDFWAPWCGPCRAVGPIIDELATEYAGKVRIVKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+    T++ I +IPTL+LFK+G+ +++ + GA +++ + + + ++
Sbjct: 60  ENPATPTKFGIRAIPTLVLFKNGETVEQ-ITGAVTKAAMKDLLDTK 104


>gi|239918798|ref|YP_002958356.1| thioredoxin [Micrococcus luteus NCTC 2665]
 gi|281414975|ref|ZP_06246717.1| thioredoxin [Micrococcus luteus NCTC 2665]
 gi|239840005|gb|ACS31802.1| thioredoxin [Micrococcus luteus NCTC 2665]
          Length = 107

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/101 (37%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V    FD +VL+   PV+VDFWA WC PC  L P+++D+A E   K  I KL+++
Sbjct: 1   MSTITVTDADFDQKVLQSELPVLVDFWAEWCGPCRMLGPVLEDMAVEHEGKAVIAKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E+  I+ RY ++SIP ++ F++G+ +   + GA  ++ + +
Sbjct: 61  ENPAIAARYGVTSIPLVVGFQNGEKVAESV-GAKPKAALEK 100


>gi|15805968|ref|NP_294668.1| thioredoxin [Deinococcus radiodurans R1]
 gi|6458668|gb|AAF10520.1|AE001947_3 thioredoxin [Deinococcus radiodurans R1]
          Length = 141

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  +++   +F SE+       +VDFWA WC PC  ++P+I+++A +   +VK+ K++++
Sbjct: 33  MKPVELTDGNFTSEI--AQGLTLVDFWAPWCGPCRIIAPVIEELAGQYEGRVKVAKVNVD 90

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++   S ++++ SIPT+ILFKDG+ ++ M+ GA  +      +   +
Sbjct: 91  DNPATSGQFRVMSIPTMILFKDGQPVEGMV-GAQPKRAFESVLDKHL 136


>gi|302036920|ref|YP_003797242.1| thioredoxin [Candidatus Nitrospira defluvii]
 gi|300604984|emb|CBK41317.1| Thioredoxin [Candidatus Nitrospira defluvii]
          Length = 115

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+  ALK    ++D +V++ S  V+VDFWA WC PC  ++PI+D++A E A KVK+ KL+
Sbjct: 1   MAGDALKATDATWDEDVMKASELVMVDFWAVWCGPCQMVAPIVDELATEYAGKVKVRKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +E+ EI+ RYQ+ SIPT++ FK+G+ ++R++ GA  +    E I S +
Sbjct: 61  TDENPEIAGRYQVMSIPTILFFKNGQAVERLV-GARPKRQFKEIIDSLL 108


>gi|163785102|ref|ZP_02179811.1| thioredoxin [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879629|gb|EDP73424.1| thioredoxin [Hydrogenivirga sp. 128-5-R1-1]
          Length = 105

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+     ++ ++++ EVL    PV+VDFWA WC PC  ++P+I+++A+EL  K K+ KL+
Sbjct: 1   MAGKVCVLNEQNWEQEVLNSDVPVLVDFWAPWCGPCRLIAPVIEELAEELEGKAKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
            +E+  I+ +Y I +IPT+++FK+G+V+D  + G   +  +   +
Sbjct: 61  TDENPNIAMKYGIRAIPTIMVFKNGQVVDTKV-GVQPKEVLKSLL 104


>gi|37520449|ref|NP_923826.1| thioredoxin [Gloeobacter violaceus PCC 7421]
 gi|35211443|dbj|BAC88821.1| thioredoxin [Gloeobacter violaceus PCC 7421]
          Length = 110

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +A+ V   +F +EVL+   PV+VDFWA WC PC  ++P++D+IA + + K+K+ K++ +E
Sbjct: 3   AAVPVGDSNFKTEVLDSELPVLVDFWAPWCGPCRMVAPVVDEIAQQYSGKLKVVKVNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +++++Y I SIPTL++FK G  +D M+ GA  ++ +   +   +
Sbjct: 63  NPQVASQYGIRSIPTLMVFKSGSKVD-MVVGAVPKTTLATTLEKHI 107


>gi|22298354|ref|NP_681601.1| thioredoxin [Thermosynechococcus elongatus BP-1]
 gi|22294533|dbj|BAC08363.1| thioredoxin [Thermosynechococcus elongatus BP-1]
          Length = 107

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SAL V   +F+ EVL    PV+VDFWA WC PC  ++P++D+IA+E   +VK+ K++ +E
Sbjct: 3   SALSVTDATFEEEVLNSDIPVLVDFWAPWCGPCRMVAPVVDEIANEYQGRVKVVKVNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +S+++T + I SIPTL++FK G+ +D ++ GA  ++ I   +   +
Sbjct: 63  NSKVATDFGIRSIPTLMIFKGGQKVDILV-GAVPKTKIEATLAQFL 107


>gi|315506954|ref|YP_004085841.1| thioredoxin [Micromonospora sp. L5]
 gi|315413573|gb|ADU11690.1| thioredoxin [Micromonospora sp. L5]
          Length = 107

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V   SF  +VL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I+E
Sbjct: 3   ATKAVTDASFVIDVLQSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMKDQVTIVKLNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  Y++ S+PTL +FK+G+ + + + GA  + ++++ I S +
Sbjct: 63  NPETARAYRVMSVPTLTIFKNGQPV-QSIAGAKPKGELVKLIESAL 107


>gi|116073500|ref|ZP_01470762.1| Thioredoxin [Synechococcus sp. RS9916]
 gi|116068805|gb|EAU74557.1| Thioredoxin [Synechococcus sp. RS9916]
          Length = 108

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +       +F++EVL+ +  V+VDFWA WC PC  ++P +D  A+  A K+++ KL+++ 
Sbjct: 4   AVSDYTDATFEAEVLKATTTVLVDFWAPWCGPCRLIAPFMDWAAETYAGKLQVGKLEVDG 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +      YQ+  IPTLILF+DGK I R   GA ++  +  ++ + +
Sbjct: 64  NPATRDAYQVQGIPTLILFRDGKEIGR-QEGAIAKPQLQAFLDAHL 108


>gi|157835496|pdb|2O7K|A Chain A, S. Aureus Thioredoxin
          Length = 107

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV    FDS+V   S   +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 4   MAIVKVTDADFDSKV--ESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVD 61

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 62  ENPSTAAKYEVMSIPTLIVFKDGQPVDKVV-GFQPKENLAEVLDKHL 107


>gi|114568641|ref|YP_755321.1| thioredoxin [Maricaulis maris MCS10]
 gi|114339103|gb|ABI64383.1| thioredoxin [Maricaulis maris MCS10]
          Length = 106

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V  +SF+S+V+  S PV+VDFWA WC PC ++SP +++IA+E++  + + K++I+
Sbjct: 1   MATKAVSDESFESDVINASGPVLVDFWAEWCGPCKQISPALEEIAEEMSGSLTVAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +      +Y +  IPTL++FKDG+V+   + GA ++  I EW+   +
Sbjct: 61  DHPMTPGKYGVRGIPTLMIFKDGQVVSTKI-GAMAKGKISEWVQETL 106


>gi|156742496|ref|YP_001432625.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
 gi|156233824|gb|ABU58607.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
          Length = 293

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           + + V+ ++F +EVLE S   PVVVDFWA WC PC  L PI++ +A E      + KL++
Sbjct: 11  AVIDVNERTFRAEVLERSRTVPVVVDFWAPWCGPCRVLGPILEKLAIEAKGAWILAKLNV 70

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           +E+  ++  +Q+  IP +  F+DG+V+D    GA  +S +  W+ 
Sbjct: 71  DENPRLAQMFQVQGIPAVKAFRDGRVVDEF-TGALPESQVRAWLK 114


>gi|217974982|ref|YP_002359733.1| thioredoxin [Shewanella baltica OS223]
 gi|217500117|gb|ACK48310.1| thioredoxin [Shewanella baltica OS223]
          Length = 170

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++ + +F +   +   P+VVDFWASWC PC   +P+    A     + +  K++ EE
Sbjct: 66  ATIELTSANFANHANKSELPLVVDFWASWCGPCKSFAPVFSAAAKTWEPQFRFGKINTEE 125

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
              ++ ++ I SIPTL++FK GK++ +   GA  QS + +W+ S 
Sbjct: 126 QQALAAQFNIRSIPTLMIFKQGKILAQ-QAGALPQSALNQWLKSH 169


>gi|298368387|ref|ZP_06979705.1| thioredoxin [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282390|gb|EFI23877.1| thioredoxin [Neisseria sp. oral taxon 014 str. F0314]
          Length = 110

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL+   PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 1   MSSELIIHTTDANFEQDVLKSGVPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++     ++ +  IPTL++FK+G+ +   + GA ++  +  ++ + +
Sbjct: 61  NIDDNEATPAKFGVRGIPTLMVFKNGENVATKV-GALAKGQLTAFVNASI 109


>gi|254467229|ref|ZP_05080640.1| thioredoxin [Rhodobacterales bacterium Y4I]
 gi|206688137|gb|EDZ48619.1| thioredoxin [Rhodobacterales bacterium Y4I]
          Length = 106

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V   +FD+EV     PVVVDFWA WC PC ++ P ++++A E   KVKI K+D++
Sbjct: 1   MSTVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELAVEFDGKVKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+VI     GA+ ++ +  WI   +
Sbjct: 61  SNPNAAAAMGVRGIPALFIFKDGQVISNR-AGAAPKAALQSWIEESI 106


>gi|114762245|ref|ZP_01441713.1| thioredoxin [Pelagibaca bermudensis HTCC2601]
 gi|114545269|gb|EAU48272.1| thioredoxin [Roseovarius sp. HTCC2601]
          Length = 106

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD EV     PVVVDFWA WC PC ++ P +++++++   KVK+ K++++
Sbjct: 1   MATVPVTDATFDEEVKNSDIPVVVDFWAEWCGPCKQIGPALEELSEQYEGKVKVAKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               ++ +  +  IP L LFKDG+VI     GA+ ++ +  WI   +
Sbjct: 61  HDQAVAAQLGVRGIPALFLFKDGEVISNR-TGAAPKASLESWIKEAM 106


>gi|30249037|ref|NP_841107.1| thioredoxin [Nitrosomonas europaea ATCC 19718]
 gi|30138654|emb|CAD84945.1| Thioredoxin [Nitrosomonas europaea ATCC 19718]
          Length = 108

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+SEVL+C  PV+VD+WA WC PC  ++P++D+IA E  D++KI KL+I+E+   
Sbjct: 8   VTDASFESEVLQCPVPVLVDYWAEWCGPCRMIAPLLDEIASEYGDRLKIAKLNIDENQST 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y I  IPTL++FK+G +    + GA S+S +  ++ S +
Sbjct: 68  PQKYGIRGIPTLMIFKNGNIEATKV-GALSKSQLTAFVDSHL 108


>gi|298491749|ref|YP_003721926.1| thioredoxin ['Nostoc azollae' 0708]
 gi|298233667|gb|ADI64803.1| thioredoxin ['Nostoc azollae' 0708]
          Length = 108

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   +F  EVLE   PV+VDFWA WC PC  L+ ++D++A E   +VK+ KL+ +
Sbjct: 1   MTVTNVTEATFKQEVLESETPVLVDFWAPWCGPCRMLATVVDEVAAEYEGQVKVVKLNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++  +++ Y I SIPTL++FK G+ ID ++ GA  +  + + ++  +
Sbjct: 61  QNPIVASHYGIRSIPTLMIFKGGRQIDTVV-GAVPKITLSKILVQYI 106


>gi|1388088|gb|AAC49358.1| thioredoxin m [Pisum sativum]
          Length = 172

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V+  S+D  V+    PV+VDFWA WC PC  ++PIID++A E A K+K  KL+ +ES
Sbjct: 69  VQVVNDSSWDELVIGSETPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNTDES 128

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +T+Y I SIPT++ FK+G+  D ++ GA  ++ + E +   +
Sbjct: 129 PNTATKYGIRSIPTVLFFKNGERKDSVI-GAVPKATLSEKVEKYI 172


>gi|116619449|ref|YP_821605.1| thioredoxin [Candidatus Solibacter usitatus Ellin6076]
 gi|116222611|gb|ABJ81320.1| thioredoxin [Candidatus Solibacter usitatus Ellin6076]
          Length = 109

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L     +FD +VL    PV+VDFWA WC PC ++SP ID +A E A KVK+ KL
Sbjct: 1   MAGQNTLTFSDSTFDEDVLRSDVPVLVDFWAEWCGPCRQMSPTIDVVAGEYAGKVKVGKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           D++ +   + RY +  IPTL+LFK G+V+++ + GA  +SD+++ I + V
Sbjct: 61  DVDANGGTAMRYNVRGIPTLLLFKGGQVVEQRV-GAIGKSDVLKMIDAHV 109


>gi|317970450|ref|ZP_07971840.1| thioredoxin [Synechococcus sp. CB0205]
          Length = 107

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLKSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FKDG+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMIFKDGQKVDTVV-GAVPKTTLSGTISKYL 107


>gi|229829284|ref|ZP_04455353.1| hypothetical protein GCWU000342_01371 [Shuttleworthia satelles DSM
           14600]
 gi|229792447|gb|EEP28561.1| hypothetical protein GCWU000342_01371 [Shuttleworthia satelles DSM
           14600]
          Length = 103

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS LKV T +F+SEVL+   PV+VDFWASWC PC  L P+I +IA+E     ++ KL+++
Sbjct: 1   MSELKVTTANFESEVLKSDVPVMVDFWASWCGPCRMLGPVISEIAEESDGSYRVGKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++ +Y + SIPT+I+FKDG+ + +   G   ++ +++ + 
Sbjct: 61  EEMELAEKYNVMSIPTVIVFKDGQ-VYKKSVGVVPKAQLLDLLK 103


>gi|119491324|ref|ZP_01623378.1| thioredoxin [Lyngbya sp. PCC 8106]
 gi|119453488|gb|EAW34650.1| thioredoxin [Lyngbya sp. PCC 8106]
          Length = 107

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/103 (40%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   SF  +VLE   PV+VDFWA WC PC  ++P++++IA++ A KVK+ KL+ +E+  
Sbjct: 6   QVTDASFKQDVLESDVPVLVDFWAPWCGPCRMVAPVVEEIAEQYAGKVKVVKLNTDENPT 65

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +Y I SIPTL++FK+G+ +D M+ GA  ++ +   I   +
Sbjct: 66  VANQYGIRSIPTLMIFKEGQRVD-MVVGAVPKTTLANTIEKYL 107


>gi|13469690|dbj|BAB39860.1| thioredoxin [Actinobacillus actinomycetemcomitans]
          Length = 107

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L     +F ++VL    PV++DFWA+WC PC  ++PI+DD+A E   KVKI K++I
Sbjct: 1   MSEVLHSSDATFVADVLNSEVPVLLDFWATWCGPCKMIAPILDDLAVEFDGKVKIVKINI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++     ++ + S+PTL+LFKDGK +   + GA  ++ +  +I   +
Sbjct: 61  DDNQATPAQFGVRSVPTLLLFKDGKPVATQV-GALPKNQLAAFINQNI 107


>gi|326204352|ref|ZP_08194210.1| thioredoxin [Clostridium papyrosolvens DSM 2782]
 gi|325985384|gb|EGD46222.1| thioredoxin [Clostridium papyrosolvens DSM 2782]
          Length = 108

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +  + F+S+VL+   PVVVDFWASWC PC  ++PI++++ADE   K +I K++
Sbjct: 1   MSDKITNISKELFESDVLKSDKPVVVDFWASWCGPCRMVAPIMEELADEFDGKAQIAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E  E++ +++I SIPT+++FK G+ +++++ GA S+ +  E I   +
Sbjct: 61  VDEEGELAAQFRIMSIPTVMVFKGGEAVEKIV-GARSKDEFAELIQKHL 108


>gi|296532482|ref|ZP_06895201.1| thioredoxin [Roseomonas cervicalis ATCC 49957]
 gi|296267199|gb|EFH13105.1| thioredoxin [Roseomonas cervicalis ATCC 49957]
          Length = 110

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/105 (44%), Positives = 66/105 (62%), Gaps = 3/105 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF  EVL  S PV+VDFWA WC PC  ++PI+D+IA E A ++ + K++
Sbjct: 1   MSEFTKAVSDDSFKDEVLGASGPVLVDFWAEWCGPCRMVAPILDEIAQEYAGQLTVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           I+E+      Y +  IPT+ILFKDGK ++  + GA  +S + EWI
Sbjct: 61  IDENPMTPNDYAVRGIPTMILFKDGKPVETKV-GAMPRSQMKEWI 104


>gi|294501465|ref|YP_003565165.1| thioredoxin [Bacillus megaterium QM B1551]
 gi|295706813|ref|YP_003599888.1| thioredoxin [Bacillus megaterium DSM 319]
 gi|294351402|gb|ADE71731.1| thioredoxin [Bacillus megaterium QM B1551]
 gi|294804472|gb|ADF41538.1| thioredoxin [Bacillus megaterium DSM 319]
          Length = 104

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+      K+F  E+   S  V+VDFWA WC PC  ++P++++I  EL DKVKI K+D++
Sbjct: 1   MAIAHATDKNFTDEI--KSGLVLVDFWAPWCGPCKMIAPVLEEIDGELNDKVKIVKVDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E + ++ + SIPTL+LFKDG+ +D+++ G   +  + E I   
Sbjct: 59  ENQETAGKFGVMSIPTLVLFKDGEKVDQVV-GFQPKEALTELINKH 103


>gi|145221432|ref|YP_001132110.1| thioredoxin [Mycobacterium gilvum PYR-GCK]
 gi|315446816|ref|YP_004079695.1| thioredoxin [Mycobacterium sp. Spyr1]
 gi|145213918|gb|ABP43322.1| thioredoxin [Mycobacterium gilvum PYR-GCK]
 gi|315265119|gb|ADU01861.1| thioredoxin [Mycobacterium sp. Spyr1]
          Length = 109

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + V   SF  +VL    PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++E
Sbjct: 5   STVTVTDDSFSDDVLSSGTPVLVDFWATWCGPCKMVAPVLEEIASEKAGSLTVAKLDVDE 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +   +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++  I
Sbjct: 65  NPATARDFQVVSIPTMILFKDGQPVKRIV-GAKGKAALLREI 105


>gi|85705744|ref|ZP_01036841.1| thioredoxin [Roseovarius sp. 217]
 gi|85669734|gb|EAQ24598.1| thioredoxin [Roseovarius sp. 217]
          Length = 106

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV   + PVVVDFWA WC PC ++ P++++++ E++ K+KI K+D++
Sbjct: 1   MATVAVTDATFDAEVKNSNIPVVVDFWAEWCGPCKQIGPVLEELSTEMSGKIKIVKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNSAVAMGVRGIPALFIFKDGQVVSNR-AGAAPKAALQSWIEDSI 106


>gi|220929624|ref|YP_002506533.1| thioredoxin [Clostridium cellulolyticum H10]
 gi|219999952|gb|ACL76553.1| thioredoxin [Clostridium cellulolyticum H10]
          Length = 108

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            +   SF+S VL+   PVVVDFWASWC PC  ++PI++++ADE   K  I K++++E  E
Sbjct: 7   NISKDSFESNVLKSDKPVVVDFWASWCGPCRMVAPIMEELADEFNGKASIAKVNVDEEGE 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +++I SIPT+++FK G+ +++++ GA S+++  E I   +
Sbjct: 67  LAAQFRIMSIPTVMVFKGGEAVEKIV-GARSKAEFSELIQKHL 108


>gi|114705060|ref|ZP_01437968.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2
           [Fulvimarina pelagi HTCC2506]
 gi|114539845|gb|EAU42965.1| Thioredoxin:Thioredoxin type domain:Thioredoxin domain 2
           [Fulvimarina pelagi HTCC2506]
          Length = 105

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   +F ++VL  S PVVVDFWA WC PC  ++P   +   E    V+I K++I+
Sbjct: 1   MATKTVTKDTFQNDVLGASKPVVVDFWAEWCGPCKMIAP-SLEEISEENSNVEIAKVNID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E++ ++ I SIPTL++FKDG+ +D +M GA S+S +  WI S 
Sbjct: 60  ENQELAVQFGIRSIPTLMMFKDGQHVDTLM-GAQSKSKLASWIDSA 104


>gi|224368346|ref|YP_002602509.1| TrxA2 [Desulfobacterium autotrophicum HRM2]
 gi|223691062|gb|ACN14345.1| TrxA2 [Desulfobacterium autotrophicum HRM2]
          Length = 106

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  L++D   F+ +VL    PVVVDFWA WC PC  + PI++++     + VK  K+++
Sbjct: 1   MSEILEIDDDGFEKDVLNSDKPVVVDFWAPWCGPCRAIGPIVEELEATYGNTVKFVKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +E+    ++Y I +IPTLI FKDGK+ D+ + G  S+S +   I +
Sbjct: 61  DENPVTPSKYGIKAIPTLIFFKDGKIADQ-ITGMVSKSKLEAAIKA 105


>gi|24372002|ref|NP_716044.1| thioredoxin 1 [Shewanella oneidensis MR-1]
 gi|113968754|ref|YP_732547.1| thioredoxin [Shewanella sp. MR-4]
 gi|114049102|ref|YP_739652.1| thioredoxin [Shewanella sp. MR-7]
 gi|117918866|ref|YP_868058.1| thioredoxin [Shewanella sp. ANA-3]
 gi|24345863|gb|AAN53489.1|AE015489_2 thioredoxin 1 [Shewanella oneidensis MR-1]
 gi|113883438|gb|ABI37490.1| thioredoxin [Shewanella sp. MR-4]
 gi|113890544|gb|ABI44595.1| thioredoxin [Shewanella sp. MR-7]
 gi|117611198|gb|ABK46652.1| thioredoxin [Shewanella sp. ANA-3]
          Length = 108

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+   PV+VDFWA WC PC  ++PI+DD+A+E A +V I KL+
Sbjct: 1   MSDKIIYLSDDSFENDVLKADLPVLVDFWAEWCGPCKMIAPILDDVAEEYAGRVTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL+LFK+G++    + GA S++ + E+I +++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLLFKNGELAATKV-GALSKTQLKEFIDAQI 108


>gi|251773430|gb|EES53979.1| thioredoxin [Leptospirillum ferrodiazotrophum]
          Length = 110

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS    ++ T  +D +VLE    V+VDFWA WC PC  ++P++D++A+E   +V   KL+
Sbjct: 1   MSANVAEITTAEWDKKVLESKGLVMVDFWAPWCGPCRMVAPVVDELAEEYKGRVSFMKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            +++ EI+ RYQ+  IPTLI FKDGK++ +++ GA S+    + I  
Sbjct: 61  TDDNQEIAVRYQVMGIPTLIFFKDGKIVSKLV-GAQSKKTFKDKIEE 106


>gi|291522905|emb|CBK81198.1| thioredoxin [Coprococcus catus GD/7]
          Length = 102

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/104 (32%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F +E+ +   PV+VDFWA WC PC  ++PI+ ++  E    V+I K++++
Sbjct: 1   MAIIDLTKENFQAEITKSDKPVLVDFWAVWCGPCQMMAPILHELEAE-MPDVQIGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  +++ ++++ SIPTLI+FK+G+ + RM+ G +S+ ++ + + 
Sbjct: 60  EQMDLARQFRVVSIPTLIIFKNGQEVQRMV-GVTSKEELKDALK 102


>gi|282855388|ref|ZP_06264711.1| thioredoxin [Pyramidobacter piscolens W5455]
 gi|282586768|gb|EFB92013.1| thioredoxin [Pyramidobacter piscolens W5455]
          Length = 102

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + + +++F SEVL+ S PV++DFWA WC PC   SP++D+IA E A   K+ K++++
Sbjct: 1   MTPIVLTSENFQSEVLQSSEPVLIDFWAPWCAPCRAFSPVLDEIAAE-ASGFKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++   +I SIPTLILFK+G    R + G  S+ +++  + 
Sbjct: 60  EQPELAASLRIMSIPTLILFKNGAPAGRTV-GVQSKENVLALLK 102


>gi|87124808|ref|ZP_01080656.1| Thioredoxin [Synechococcus sp. RS9917]
 gi|86167687|gb|EAQ68946.1| Thioredoxin [Synechococcus sp. RS9917]
          Length = 107

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKATLSGTISKYI 107


>gi|325003244|ref|ZP_08124356.1| thioredoxin [Pseudonocardia sp. P1]
          Length = 107

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 72/108 (66%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + V T SFD +VL+    V+VDFWA+WC PC  ++P++D+IA E  +K+ + KLDI
Sbjct: 1   MANTIDVTTGSFDQDVLKSDKAVLVDFWATWCGPCKMVAPVLDEIAGENTEKLTVAKLDI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + + E++  YQ+ S+PT+ILF  GK + +++ GA  ++ ++  +   +
Sbjct: 61  DANPEVARDYQVMSVPTMILFSGGKPVKQIV-GAKPKAALLADLADHI 107


>gi|317129853|ref|YP_004096135.1| thioredoxin [Bacillus cellulosilyticus DSM 2522]
 gi|315474801|gb|ADU31404.1| thioredoxin [Bacillus cellulosilyticus DSM 2522]
          Length = 104

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  ++F +E       V+ DFWA WC PC  ++P+++++  E+ DKVKI KLD++
Sbjct: 1   MAIVNVSDQNFAAET--GEGVVLADFWAPWCGPCKMIAPVLEELDGEMGDKVKIVKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E + ++ + SIPTL++FKDG+V+D+++ G   +  +   +   +
Sbjct: 59  ENQETAGKFGVMSIPTLLVFKDGQVVDQVV-GFQPKEQLASLLNKHI 104


>gi|260429475|ref|ZP_05783452.1| thioredoxin [Citreicella sp. SE45]
 gi|260420098|gb|EEX13351.1| thioredoxin [Citreicella sp. SE45]
          Length = 106

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD EV     PVVVDFWA WC PC ++ P ++++A++   ++KI K+D++
Sbjct: 1   MATVPVTDATFDEEVKNSDIPVVVDFWAEWCGPCKQIGPALEELAEQYDGQIKIAKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   ++ +  +  IP L +FK+G  +     GA+ ++ +  WI   +
Sbjct: 61  KDQAMAAQLGVRGIPALFIFKNG-EVFSNRTGAAPKASLESWIKEAI 106


>gi|218248832|ref|YP_002374203.1| thioredoxin [Cyanothece sp. PCC 8801]
 gi|257061894|ref|YP_003139782.1| thioredoxin [Cyanothece sp. PCC 8802]
 gi|218169310|gb|ACK68047.1| thioredoxin [Cyanothece sp. PCC 8801]
 gi|256592060|gb|ACV02947.1| thioredoxin [Cyanothece sp. PCC 8802]
          Length = 107

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS   +V    F  EVLE   PV+VDFWA WC PC  ++P++D+IA++   +VK+ KL+ 
Sbjct: 1   MSETPQVTDAKFKEEVLESDIPVLVDFWAPWCGPCRMVAPVVDEIAEQYQGQVKVLKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ + +++Y I SIPTL++FK+G+ +D M+ GA  ++ +   +   +
Sbjct: 61  DENPQTASQYGIRSIPTLMIFKEGQRVD-MVVGAVPKTTLANTLEKYL 107


>gi|840745|emb|CAA55398.1| thioredoxin m [Chlamydomonas reinhardtii]
          Length = 128

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  +F + VLE S PV+VDFWA WC PC  ++P++D+IA E  DK+K  KL+ +ES  +
Sbjct: 27  VNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNV 86

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ Y I SIPT+++FK GK  + ++ GA  ++ I++ +   +
Sbjct: 87  ASEYGIRSIPTIMVFKGGKKCETII-GAVPKATIVQTVEKYL 127


>gi|312261106|dbj|BAJ33558.1| protein disulfide isomerase S-1 [Glycine max]
          Length = 280

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 51/106 (48%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIE 60
            + + +++F+  VL+ +  V+V+F+A WC  C  L+P  + +       + V I  LD +
Sbjct: 64  VVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVVTAFKLEEDVVIANLDAD 123

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 124 KYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEK 169



 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 22/47 (46%)

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           D +E   + ++Y +S  PT+  F  G +  +   G  +   + E++ 
Sbjct: 2   DCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTVDSLAEFVN 48


>gi|300704813|ref|YP_003746416.1| thioredoxin [Ralstonia solanacearum CFBP2957]
 gi|299072477|emb|CBJ43827.1| Putative thioredoxin [Ralstonia solanacearum CFBP2957]
          Length = 280

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V +++F  EV+E S   PV+VDFWA WC PC  L P+++ +  E A K K+ K++
Sbjct: 1   MS--DVTSQNFTQEVIETSRQVPVLVDFWAPWCGPCRTLGPMLEKLEHEYAGKWKLAKVN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            +E+ E+S  + + SIP ++ F DGK +D+ + G   +S +  ++ 
Sbjct: 59  SDENPELSAHFNVRSIPFVVAFADGKPVDQFV-GVLPESQLRAFLD 103


>gi|258622629|ref|ZP_05717650.1| thioredoxin [Vibrio mimicus VM573]
 gi|258623961|ref|ZP_05718914.1| thioredoxin [Vibrio mimicus VM603]
 gi|262173962|ref|ZP_06041639.1| thioredoxin 2 [Vibrio mimicus MB-451]
 gi|258583755|gb|EEW08551.1| thioredoxin [Vibrio mimicus VM603]
 gi|258585085|gb|EEW09813.1| thioredoxin [Vibrio mimicus VM573]
 gi|261891320|gb|EEY37307.1| thioredoxin 2 [Vibrio mimicus MB-451]
          Length = 144

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L+   PVVVDFWA WC PCV  +P+  D+A E   +V+  K+D E 
Sbjct: 39  APIEGTEANF-SALLQSDKPVVVDFWAPWCNPCVGFAPVFSDVAAERKGRVRFIKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  +QI SIPT+++FK+G+ ID M+ GA  +S   +W+   +
Sbjct: 98  QQNLAAHFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWLNQAL 142


>gi|300692197|ref|YP_003753192.1| thioredoxin [Ralstonia solanacearum PSI07]
 gi|299079257|emb|CBJ51929.1| Putative thioredoxin [Ralstonia solanacearum PSI07]
          Length = 280

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V +++F  EV+E S   PV+VDFWA WC PC  L P+++ +  E A K K+ K++
Sbjct: 1   MS--DVTSQNFAQEVIETSRQVPVLVDFWAPWCGPCRTLGPMLEKLEHEYAGKWKLAKVN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            +E+ E+S  + + SIP ++ F DGK +D+ + G   +S +  ++ 
Sbjct: 59  SDENPELSAHFNVRSIPYVVAFADGKPVDQFV-GVLPESQLRAFLD 103


>gi|116328459|ref|YP_798179.1| thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116331191|ref|YP_800909.1| thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
 gi|116121203|gb|ABJ79246.1| Thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116124880|gb|ABJ76151.1| Thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
          Length = 104

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 70/106 (66%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V+  +F SE       V++D WA WC PC  ++P+++++++E+   VKI KL+++
Sbjct: 1   MALAEVNDSNFKSET--SGGLVLIDCWAEWCGPCRMVAPVLEELSNEMNGTVKIKKLNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ + +    ISSIPTL+L+KDG+++D+++ GA  ++ I  +I   
Sbjct: 59  DNQDTAQSLGISSIPTLLLYKDGQLVDKVI-GALPKAQIKNFIERH 103


>gi|238897337|ref|YP_002923014.1| thioredoxin 1, redox factor [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465092|gb|ACQ66866.1| thioredoxin 1, redox factor [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 108

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +++  KSFD +VL+    ++VDFWA WC PC  ++PI+D+IA+E  DK+ ITKL+
Sbjct: 1   MSKEIIQLSDKSFDRDVLKADGLILVDFWAQWCGPCKMIAPILDEIANEYVDKITITKLE 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ +   + +Y I SIPTL+LFK+GK ID  + GA S+ ++ +++   V
Sbjct: 61  IDTNPNTTQKYGIRSIPTLLLFKEGKPIDTKV-GAVSKHELKKFLDKHV 108


>gi|223939100|ref|ZP_03630984.1| thioredoxin [bacterium Ellin514]
 gi|223892260|gb|EEF58737.1| thioredoxin [bacterium Ellin514]
          Length = 114

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF  EVLE + PV+VDFWASWC PC  +SP+++ +A + A K KI K++++E+ 
Sbjct: 12  VDVTDGSFTQEVLESNVPVLVDFWASWCGPCRMISPLVESLAVDFAGKAKIAKVNVDENP 71

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +++ I SIPTL++FK+GK++D  + GASS++ + E +   +
Sbjct: 72  GLCSQFSIRSIPTLLIFKNGKLVDTSI-GASSKTSLTEKLSKYL 114


>gi|187927822|ref|YP_001898309.1| thioredoxin [Ralstonia pickettii 12J]
 gi|187724712|gb|ACD25877.1| thioredoxin [Ralstonia pickettii 12J]
          Length = 281

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 66/106 (62%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +++F  EV+E S   PV+VDFWA WC PC  L P+++ +  E A K K+ K++
Sbjct: 1   MS--DITSQNFAQEVIETSRQIPVLVDFWAPWCGPCRTLGPMLEKLEAEFAGKWKLAKIN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            +E+ E+S ++ + SIP ++ F DGK +D+ + G   ++ +  ++ 
Sbjct: 59  SDENPELSAQFHVRSIPYVVAFVDGKPVDQFV-GVLPEAQLRAFLD 103


>gi|89890045|ref|ZP_01201556.1| thiol-disulfide isomerase/thioredoxin [Flavobacteria bacterium
           BBFL7]
 gi|89518318|gb|EAS20974.1| thiol-disulfide isomerase/thioredoxin [Flavobacteria bacterium
           BBFL7]
          Length = 106

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL    PV+VDFWA+WC PC  + PIID++A +   K  + K+D++
Sbjct: 1   MA-LEITDANFEETVLNSEKPVLVDFWAAWCGPCRMVGPIIDEVATDYDGKAVVGKMDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++F++G+V+ R + G + ++   + I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFQNGEVVGRQV-GVAPKNAYTDAIDALL 105


>gi|284047275|ref|YP_003397615.1| thioredoxin [Conexibacter woesei DSM 14684]
 gi|283951496|gb|ADB54240.1| thioredoxin [Conexibacter woesei DSM 14684]
          Length = 109

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+    +V   +F +EV+E   PV+VDFWA WC PC  ++P++++IA E  + +KI KL+
Sbjct: 1   MAGTITEVTDNNFQAEVIESDVPVLVDFWAPWCGPCRMVAPVLEEIASEKGEALKIVKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           ++++ + +  +++ SIPTLILFK+G  + + + GA  +  +   + 
Sbjct: 61  VDDNQQTAMNFEVLSIPTLILFKNG-AVAKKVVGAYPKRKLEAELE 105


>gi|207728231|ref|YP_002256625.1| thioredoxin protein [Ralstonia solanacearum MolK2]
 gi|206591476|emb|CAQ57088.1| thioredoxin protein [Ralstonia solanacearum MolK2]
          Length = 280

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V +++F  EV+E S   PV+VDFWA WC PC  L P+++ +  E A K K+ K++
Sbjct: 1   MS--DVTSQNFAQEVIETSRQVPVLVDFWAPWCGPCRTLGPMLEKLEHEYAGKWKLAKVN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            +E+ E+S  + + SIP ++ F DGK +D+ + G   +S +  ++ 
Sbjct: 59  SDENPELSAHFNVRSIPFVVAFADGKPVDQFV-GVLPESQLRAFLD 103


>gi|49615095|dbj|BAD24714.2| protein disulfide isomerase-like protein [Glycine max]
          Length = 364

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIE 60
            + + +++F+  VL+ +  V+V+F+A WC  C  L+P  + +A      + V I  LD +
Sbjct: 148 VVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVIANLDAD 207

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 208 KYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEK 253



 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 30  VVVLSEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVLIGKVDCD 88

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ 
Sbjct: 89  EHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADSLAEFVN 132


>gi|83749011|ref|ZP_00946019.1| Thioredoxin [Ralstonia solanacearum UW551]
 gi|207744035|ref|YP_002260427.1| thioredoxin protein [Ralstonia solanacearum IPO1609]
 gi|83724349|gb|EAP71519.1| Thioredoxin [Ralstonia solanacearum UW551]
 gi|206595437|emb|CAQ62364.1| thioredoxin protein [Ralstonia solanacearum IPO1609]
          Length = 280

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V +++F  EV+E S   PV+VDFWA WC PC  L P+++ +  E A K K+ K++
Sbjct: 1   MS--DVTSQNFAQEVIETSRQIPVLVDFWAPWCGPCRTLGPMLEKLEHEYAGKWKLAKVN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            +E+ E+S  + + SIP ++ F DGK +D+ + G   +S +  ++ 
Sbjct: 59  SDENPELSAHFNVRSIPFVVAFADGKPVDQFV-GVLPESQLRAFLD 103


>gi|323697684|ref|ZP_08109596.1| thioredoxin [Desulfovibrio sp. ND132]
 gi|323457616|gb|EGB13481.1| thioredoxin [Desulfovibrio desulfuricans ND132]
          Length = 106

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 72/106 (67%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  ++   +F+ +VL+   PV++DFWA WC PC  + P+ID++A+E   +VKI K++++
Sbjct: 1   MAN-QITDGTFEQDVLQSDIPVLIDFWAPWCGPCRAMGPVIDELAEEFDGQVKIVKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+S    +Y I +IPTLILFK G+V+D+   GA S+S I E I  +
Sbjct: 60  ENSATPGKYGIRAIPTLILFKGGEVLDQS-TGAVSKSSIKEMITKK 104


>gi|297193305|ref|ZP_06910703.1| thioredoxin [Streptomyces pristinaespiralis ATCC 25486]
 gi|297151730|gb|EDY62286.2| thioredoxin [Streptomyces pristinaespiralis ATCC 25486]
          Length = 175

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V   SF+ EVL+   PV+VDFWA+WC PC +++P ++ IA E  DK+++ KL+I+E
Sbjct: 69  ALKNVTDDSFEEEVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHGDKIQVVKLNIDE 128

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   + +Y + SIPTL ++++G  + + + GA  ++ I+  + S +
Sbjct: 129 NPATAAKYGVMSIPTLNVYQNG-EVAKTIVGAKPKAAIVRDLESFI 173


>gi|260461330|ref|ZP_05809578.1| thioredoxin [Mesorhizobium opportunistum WSM2075]
 gi|319785495|ref|YP_004144971.1| thioredoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|259032867|gb|EEW34130.1| thioredoxin [Mesorhizobium opportunistum WSM2075]
 gi|317171383|gb|ADV14921.1| thioredoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 106

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  K+K+ KL+I+
Sbjct: 1   MATVKVDIDNFQSEVLESAAPVVVDFWAEWCDPCKMIAPSLEEISVEMEGKIKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ +  + SIPTL +FK G+V D  + GA  ++ ++ WI
Sbjct: 61  ENPELAAQLGVRSIPTLAIFKGGEVADFSV-GAKPKTALLNWI 102


>gi|190576090|ref|YP_001973935.1| putative thioredoxin 1 [Stenotrophomonas maltophilia K279a]
 gi|194367447|ref|YP_002030057.1| thioredoxin [Stenotrophomonas maltophilia R551-3]
 gi|254521434|ref|ZP_05133489.1| thioredoxin [Stenotrophomonas sp. SKA14]
 gi|190014012|emb|CAQ47652.1| putative thioredoxin 1 [Stenotrophomonas maltophilia K279a]
 gi|194350251|gb|ACF53374.1| thioredoxin [Stenotrophomonas maltophilia R551-3]
 gi|219719025|gb|EED37550.1| thioredoxin [Stenotrophomonas sp. SKA14]
          Length = 109

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V    FDS VL    PV+VDFWA WC PC  ++P +D++AD    + KI K++
Sbjct: 1   MSDKVVHVGDADFDSAVLNSKEPVLVDFWAEWCGPCKMIAPALDELADAYQGRAKIAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +  ++ +Y + SIP L++FKDG+ +   + GA  ++ +   +   +
Sbjct: 61  VDHNRALAAKYHVRSIPYLVVFKDGEKVGEQI-GAVGKAQLAGLLDKAL 108


>gi|283779363|ref|YP_003370118.1| thioredoxin [Pirellula staleyi DSM 6068]
 gi|283437816|gb|ADB16258.1| thioredoxin [Pirellula staleyi DSM 6068]
          Length = 110

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L++   +F +EV+  S PV+VDFWA WC PC K++P+ID++A E A   KI K+
Sbjct: 1   MAAEGVLELTDSNFQTEVISSSQPVLVDFWAPWCGPCRKIAPMIDELASENAGTAKIGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +I+ + E + +Y I +IPT+I+F+DG+ + R   G  ++S + E + + 
Sbjct: 61  NIDNNQEAAMQYGIEAIPTIIIFRDGQPVQRFQ-GIPAKSRVQEALDAA 108


>gi|145346917|ref|XP_001417928.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578156|gb|ABO96221.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 123

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F++EVL+   PV+VDFWA WC PC  ++P+ID +A+E   K+K  KL+ +ES  +
Sbjct: 23  VTDATFEAEVLKSDVPVLVDFWAPWCGPCRMIAPLIDQLAEEYQGKLKAVKLNTDESPSV 82

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT+++FK G+ +D ++ GA  +S +   +   +
Sbjct: 83  ATEYGIRSIPTVMIFKGGQKMDTVI-GAVPKSTLTGTVEKYL 123


>gi|221066136|ref|ZP_03542241.1| thioredoxin [Comamonas testosteroni KF-1]
 gi|264679316|ref|YP_003279223.1| thioredoxin [Comamonas testosteroni CNB-2]
 gi|299532276|ref|ZP_07045669.1| thioredoxin [Comamonas testosteroni S44]
 gi|220711159|gb|EED66527.1| thioredoxin [Comamonas testosteroni KF-1]
 gi|262209829|gb|ACY33927.1| thioredoxin [Comamonas testosteroni CNB-2]
 gi|298719684|gb|EFI60648.1| thioredoxin [Comamonas testosteroni S44]
          Length = 109

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+      +   SF+S+VL+    V+VD+WA WC PC  ++PI+DD+A+    KV+I K+
Sbjct: 1   MASELIKHITDASFESDVLQPGTTVLVDYWAEWCGPCKMIAPILDDVAEGYKGKVQIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+ EI  ++ I  IPTL+LFKDG++    + GA +++ +  ++   +
Sbjct: 61  NVDENREIPAKFGIRGIPTLMLFKDGQLAATKV-GALNKTQLSAFLDQHI 109


>gi|33863398|ref|NP_894958.1| thioredoxin [Prochlorococcus marinus str. MIT 9313]
 gi|124022621|ref|YP_001016928.1| thioredoxin [Prochlorococcus marinus str. MIT 9303]
 gi|33640847|emb|CAE21302.1| Thioredoxin [Prochlorococcus marinus str. MIT 9313]
 gi|123962907|gb|ABM77663.1| Thioredoxin [Prochlorococcus marinus str. MIT 9303]
          Length = 107

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+IA E   K+K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFESKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKATLSGTISKYL 107


>gi|308070606|ref|YP_003872211.1| thioredoxin (TRX) [Paenibacillus polymyxa E681]
 gi|305859885|gb|ADM71673.1| Thioredoxin (TRX) [Paenibacillus polymyxa E681]
          Length = 105

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  +SF++EV E +  V+VDFWA WC PC  ++PI++D++ E+ D VKI K++++
Sbjct: 1   MAIVHVSDQSFNAEV-EGTGTVLVDFWAPWCGPCKMIAPILEDLSTEVGDSVKIAKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E ++R+ + SIPTLI+FKDG+ +D+++ G +S+  +   +   
Sbjct: 60  ENPESASRFGVMSIPTLIVFKDGQPVDKVV-GLNSKEALKSMLTKH 104


>gi|254430799|ref|ZP_05044502.1| thioredoxin [Cyanobium sp. PCC 7001]
 gi|197625252|gb|EDY37811.1| thioredoxin [Cyanobium sp. PCC 7001]
          Length = 107

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+IA E   ++K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLKSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFEGQIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKTTLSGTITKYL 107


>gi|225019581|ref|ZP_03708773.1| hypothetical protein CLOSTMETH_03534 [Clostridium methylpentosum
           DSM 5476]
 gi|224947638|gb|EEG28847.1| hypothetical protein CLOSTMETH_03534 [Clostridium methylpentosum
           DSM 5476]
          Length = 115

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 67/103 (65%), Gaps = 3/103 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F+ EVL  S PV++DFWA WC PC  +SPI+D +++E+  KV     +I+
Sbjct: 12  MAVIHITKENFEKEVLRSSEPVLLDFWAPWCGPCRMVSPIVDQVSNEVDAKVCKI--NID 69

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E+++ + + SIPTL++ +DG+++D  + G   +  I + +
Sbjct: 70  EQQELASSFNVMSIPTLMVMQDGEIVDSSV-GFRGKEQIKQML 111


>gi|119897321|ref|YP_932534.1| thioredoxin-disulfide reductase [Azoarcus sp. BH72]
 gi|119669734|emb|CAL93647.1| thioredoxin-disulfide reductase [Azoarcus sp. BH72]
          Length = 108

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF++EVL+   PV+VD+WA WC PC  ++PI+D++A + A K+K+ KL+I+E+ E 
Sbjct: 8   VTDGSFEAEVLQSQTPVLVDYWAEWCGPCKMIAPILDEVAKDYAGKLKVAKLNIDENQET 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y I  IPTL++FK G +    + GA S+S +  +I S +
Sbjct: 68  PAKYGIRGIPTLMIFKGGNIEATKV-GALSKSQLTAFIDSNI 108


>gi|121608517|ref|YP_996324.1| thioredoxin [Verminephrobacter eiseniae EF01-2]
 gi|121553157|gb|ABM57306.1| thioredoxin [Verminephrobacter eiseniae EF01-2]
          Length = 302

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVL--ECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + V  ++F++EVL      PV+VDFWA WC PC  L P+++ +  E A + K+ K+D ++
Sbjct: 2   IDVTVENFETEVLAASAHVPVLVDFWAPWCGPCKSLGPVLEKLETEYAGRFKLAKIDSDQ 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++  + + SIPT +L  +G+ +D    GA  +S +  ++   +
Sbjct: 62  QQQLAGMFGVRSIPTCMLLMNGQPVDGF-TGALPESQLRSFLDKHL 106


>gi|295136251|ref|YP_003586927.1| thioredoxin [Zunongwangia profunda SM-A87]
 gi|294984266|gb|ADF54731.1| thioredoxin [Zunongwangia profunda SM-A87]
          Length = 105

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++   +F+  VL+   PV+VDFWA+WC PC  + P+I++++ E   K  + KLD++
Sbjct: 1   MA-IEITDANFEETVLKSDKPVMVDFWAAWCGPCRMVGPVIEELSGEYEGKAVVGKLDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++F++G+V+ R + G + ++   + +   +
Sbjct: 60  ANQEFAAKYGVRNIPTVLIFQNGEVVGRQV-GVAPKNTYADALNELL 105


>gi|326317087|ref|YP_004234759.1| thioredoxin [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373923|gb|ADX46192.1| thioredoxin [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 110

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   +F   VL+ S PV+VDFWA WC PC +L PI+DDI++E A + +I K++
Sbjct: 1   MSSQVIPLTNATFSEHVLQSSGPVLVDFWAEWCAPCKQLLPIVDDISEEYAGEARICKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +E+ + + ++Q+  +PT+ILF DGK   R++ G  S++ I + I   +
Sbjct: 61  ADENKDTAQQFQVRGLPTMILFVDGKEKARLV-GLVSKTRIAQIIDEAL 108


>gi|318040295|ref|ZP_07972251.1| thioredoxin [Synechococcus sp. CB0101]
          Length = 107

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+IA E   K+K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLKSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FKDG+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMVFKDGQKVDTVV-GAVPKTTLSGTIAKYL 107


>gi|255629952|gb|ACU15328.1| unknown [Glycine max]
          Length = 185

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   S+++ V+    PV+V+FWA WC PC  ++P+ID++A + A K+   KL+ ++S
Sbjct: 76  VKVVTDSSWNNLVIASETPVLVEFWAPWCGPCRMIAPVIDELAKDYAGKIACYKLNTDDS 135

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T+Y I SIPT++ FK+G+  + ++ GA  +S +   + + +
Sbjct: 136 PNIATQYGIRSIPTVLFFKNGEKKESII-GAVPKSTLSATVENML 179


>gi|157826387|ref|YP_001495451.1| thioredoxin [Rickettsia bellii OSU 85-389]
 gi|157801691|gb|ABV76943.1| Thioredoxin [Rickettsia bellii OSU 85-389]
          Length = 119

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M++  V  KSF+ EVL+   PV+VDFWA WC PC  L+PII++I+ +L  KVK+ K++I+
Sbjct: 15  MAS-NVTDKSFEEEVLKSDLPVLVDFWAEWCGPCRMLTPIIEEISKDLESKVKVLKMNID 73

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ EI ++Y I SIPT++LFK+G+  D  + G   ++ +IEWI + +
Sbjct: 74  ENPEIPSKYGIRSIPTVMLFKNGEQKDTKV-GLHQKNSLIEWINNNI 119


>gi|167748490|ref|ZP_02420617.1| hypothetical protein ANACAC_03234 [Anaerostipes caccae DSM 14662]
 gi|167652482|gb|EDR96611.1| hypothetical protein ANACAC_03234 [Anaerostipes caccae DSM 14662]
          Length = 107

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS LK+   +F  EVL    PV++DFWA+WC PC  +S ++D+IA+E    VK+ K++++
Sbjct: 1   MSVLKITEANFVEEVLNAKEPVLIDFWAAWCGPCRMMSSVVDEIAEE-LHGVKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++ ++++ SIPTL++FK+GK +++   GA  + +I++ + 
Sbjct: 60  EEQELAGKFRVMSIPTLLIFKNGK-VEKSFVGARDKKEIVDALK 102


>gi|153002412|ref|YP_001368093.1| thioredoxin [Shewanella baltica OS185]
 gi|160877133|ref|YP_001556449.1| thioredoxin [Shewanella baltica OS195]
 gi|151367030|gb|ABS10030.1| thioredoxin [Shewanella baltica OS185]
 gi|160862655|gb|ABX51189.1| thioredoxin [Shewanella baltica OS195]
 gi|315269338|gb|ADT96191.1| thioredoxin [Shewanella baltica OS678]
          Length = 170

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++ + +F +   +   P+VVDFWASWC PC   +P+    A     + +  K++ EE
Sbjct: 66  APIELTSANFANHAKKSELPLVVDFWASWCGPCKSFAPVFSAAAKTWEPQFRFGKINTEE 125

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
              ++ ++ I SIPTL++FK GK++ +   GA  QS + +W+ S 
Sbjct: 126 QQALAAQFNIRSIPTLMIFKQGKILAQ-QAGALPQSALNQWLKSH 169


>gi|258510853|ref|YP_003184287.1| thioredoxin [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257477579|gb|ACV57898.1| thioredoxin [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 106

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +   +F    ++   PV+VDFWA+WC PC  ++P++++ A+  ADKV + KL+++
Sbjct: 1   MATMTLTDANFQQ-AIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E ++++ I SIPTLILFK G+ + +++ G   +  +   +
Sbjct: 60  ENPETTSQFGIMSIPTLILFKGGRPVKQLI-GYQPKEQLEAQL 101


>gi|94677026|ref|YP_588646.1| thioredoxin 1 [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|94220176|gb|ABF14335.1| thioredoxin 1 [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 108

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +  ++F  +VL+     +VDFWA WC PC  ++PI+ +IA+E   KV I KL+I+E+
Sbjct: 5   IINISQENFTQQVLQNEGLFLVDFWAEWCAPCKSITPILAEIANEFNGKVTIVKLNIDEN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+ +Y + SIP+L+LF++G+V+   + GA S+  +IE++ + +
Sbjct: 65  PAIAQKYNVRSIPSLLLFRNGEVVATKV-GALSKGQLIEFLNANI 108


>gi|242052897|ref|XP_002455594.1| hypothetical protein SORBIDRAFT_03g013630 [Sorghum bicolor]
 gi|241927569|gb|EES00714.1| hypothetical protein SORBIDRAFT_03g013630 [Sorghum bicolor]
          Length = 368

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDI--ADELADKVKITKLDI 59
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+P  + +    +L + V I  LD 
Sbjct: 151 SVVVLTPETFDSIVLDEAKDVLVEFYAPWCGHCKSLAPTYEKVASVFKLDEGVVIANLDA 210

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++  +++ +Y ++  PTL  F  G        G     D +++I  +
Sbjct: 211 DKYRDLAEKYGVTGFPTLKFFPKGNKAGEDYDGGRDLGDFVKFINEK 257



 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 34  VVALTESTFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKIDCD 92

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ 
Sbjct: 93  EHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFVN 136


>gi|299133346|ref|ZP_07026541.1| thioredoxin [Afipia sp. 1NLS2]
 gi|298593483|gb|EFI53683.1| thioredoxin [Afipia sp. 1NLS2]
          Length = 106

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M   KV    F++EVL+   PVVVDFWA WC PC  ++P +D+IA  + DKVKI KL+++
Sbjct: 1   MGVGKVSDTDFEAEVLKAEGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES + +++Y + SIPTL++FK G++  R + GA+ +  + +WI + V
Sbjct: 61  ESPKTASKYGVMSIPTLMIFKGGEMASRQV-GAAPKQKLQQWITAAV 106


>gi|88808976|ref|ZP_01124485.1| Thioredoxin [Synechococcus sp. WH 7805]
 gi|148239928|ref|YP_001225315.1| thioredoxin [Synechococcus sp. WH 7803]
 gi|88786918|gb|EAR18076.1| Thioredoxin [Synechococcus sp. WH 7805]
 gi|147848467|emb|CAK24018.1| Thioredoxin [Synechococcus sp. WH 7803]
          Length = 107

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+I+ E   K+K+ KL+ +E+  +
Sbjct: 7   VTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEISKEFEGKIKVFKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++ I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQFGIRSIPTLMVFKGGQKVDTVV-GAVPKATLSGTIAKYL 107


>gi|269128280|ref|YP_003301650.1| thioredoxin [Thermomonospora curvata DSM 43183]
 gi|268313238|gb|ACY99612.1| thioredoxin [Thermomonospora curvata DSM 43183]
          Length = 112

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 1   MSA-LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MSA +KV  ++FD  VL+   PV+VDFWA WC PC  +SPI+D+IA E ADK+ + KL+ 
Sbjct: 1   MSAPIKVTDETFDELVLKSDKPVLVDFWADWCGPCRMISPILDEIAAEYADKLTVAKLNA 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+     +  +  +PTL L+ +G+V+++++ GA  +  ++  +   +
Sbjct: 61  DENPATVAQAGVQGLPTLNLYVNGEVVEQIV-GAKPKRALLSTLAPHL 107


>gi|255534910|ref|YP_003095281.1| Thioredoxin [Flavobacteriaceae bacterium 3519-10]
 gi|255341106|gb|ACU07219.1| Thioredoxin [Flavobacteriaceae bacterium 3519-10]
          Length = 105

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++  +SF   VL    PV+VDFWA WC PC  L PI+++I+ +   +  + K+D++
Sbjct: 1   MA-IEITDQSFQDTVLNSDKPVLVDFWAVWCGPCRMLGPIVEEISADFEGRAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + ++S  Y I +IPTL++FK+G+V+D+++ G + +  I E + + +
Sbjct: 60  NNQQVSVDYGIRNIPTLLIFKNGQVVDKIV-GVAPKETIAEKLSAHL 105


>gi|209551529|ref|YP_002283446.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537285|gb|ACI57220.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 106

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 75/106 (70%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  KVK+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E++ ++ + SIPTL +FK G+V D  + GA +++ +  WI S 
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADISV-GAKAKTALSNWISSA 105


>gi|326801306|ref|YP_004319125.1| thioredoxin [Sphingobacterium sp. 21]
 gi|326552070|gb|ADZ80455.1| thioredoxin [Sphingobacterium sp. 21]
          Length = 106

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 73/107 (68%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +FD  VL+   PV+VDFWA WC PC  + P+++++A +   KV + K++++
Sbjct: 1   MA-LEITDSNFDEVVLKSDKPVLVDFWAEWCGPCRMVGPVVEELAKDYDGKVVVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++EIST+Y I +IP L+ FK+G+++D+ + GA  +S +   + +++
Sbjct: 60  HNAEISTKYGIRNIPALLFFKNGEIVDKQI-GAVPKSVLASKLEAQL 105


>gi|320335493|ref|YP_004172204.1| thioredoxin [Deinococcus maricopensis DSM 21211]
 gi|319756782|gb|ADV68539.1| thioredoxin [Deinococcus maricopensis DSM 21211]
          Length = 110

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 65/107 (60%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + +   +F +E+       +VDFWA WC PC  ++P+++++A E   KVK  KL+++
Sbjct: 1   MKPVDLSDSTFKTEI--AEGLTLVDFWAPWCGPCRMIAPVVEELAGEYEGKVKFGKLNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + + +Y++ SIPTLILFKDG+ ++ ++ GA  +      +   +
Sbjct: 59  DNQQTAMQYRVMSIPTLILFKDGQPVEGIV-GAQPKPAFERLLSKHL 104


>gi|83776783|gb|ABC46707.1| chloroplast thioredoxin M-type [Arachis hypogaea]
          Length = 180

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   S++  V+    PV+V+FWA WC PC  ++PIID++A E A K+   K++ ++ 
Sbjct: 77  VQVVTDSSWNKLVIGSETPVLVEFWAPWCGPCRMIAPIIDELAKEYAGKIACYKINTDDC 136

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T+Y I SIPT++ FK+G+     + GA  +S +   +   V
Sbjct: 137 PNIATQYGIRSIPTVLFFKNGEK-KESVIGAVPKSTLSATLDKYV 180


>gi|163787276|ref|ZP_02181723.1| thioredoxin [Flavobacteriales bacterium ALC-1]
 gi|159877164|gb|EDP71221.1| thioredoxin [Flavobacteriales bacterium ALC-1]
          Length = 105

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+   PV+VDFWA+WC PC  + PIID+I+ E   K  + K+D++
Sbjct: 1   MA-LEITDANFEETVLKSDKPVMVDFWAAWCGPCRMVGPIIDEISTEYDGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++FKDG+V+ R + G + ++   + I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFKDGEVVGRQV-GVAPKNAYSDAIDALL 105


>gi|114769727|ref|ZP_01447337.1| Thioredoxin [alpha proteobacterium HTCC2255]
 gi|114549432|gb|EAU52314.1| Thioredoxin [alpha proteobacterium HTCC2255]
          Length = 106

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +F +EV   + PVVVDFWA WC PC ++ P +++++DE   KVKI K++++
Sbjct: 1   MATVKVTDDTFTAEVTNSNIPVVVDFWAEWCGPCKQIGPALEELSDEYEGKVKIVKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L LFKDG+ I     GA+ ++ + +WI S +
Sbjct: 61  ENPNSPAQMGVRGIPALFLFKDGQAIANK-TGAAPKAALADWITSSI 106


>gi|113476828|ref|YP_722889.1| thioredoxin [Trichodesmium erythraeum IMS101]
 gi|110167876|gb|ABG52416.1| thioredoxin [Trichodesmium erythraeum IMS101]
          Length = 109

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF  EVLE + PV+VDFWA WC PC  ++P+++DI+ +   +VK+ KL+ +E+  +
Sbjct: 7   VTDASFKEEVLESNIPVLVDFWAPWCGPCRMVAPVVEDISKQYEGQVKVVKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D M+ GA  ++ +   +   +
Sbjct: 67  ASQYGIRSIPTLMIFKGGERVD-MVVGAVPKTTLANTLDKYI 107


>gi|238061898|ref|ZP_04606607.1| thioredoxin [Micromonospora sp. ATCC 39149]
 gi|237883709|gb|EEP72537.1| thioredoxin [Micromonospora sp. ATCC 39149]
          Length = 124

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V   SF  +VL+   PV+VDFWA WC PC K+SP++++IA E+ D+V I KL+I+E
Sbjct: 20  ATKAVTDASFAIDVLKSDKPVLVDFWAEWCAPCRKISPLLEEIAGEMGDQVSIVKLNIDE 79

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E +  Y++ S+PTL +F++G+ + + + GA  + ++++ I S +
Sbjct: 80  NPETARAYRVMSVPTLTVFRNGEPV-QSIAGAKPKGELVKLIQSAL 124


>gi|21354|emb|CAA35827.1| unnamed protein product [Spinacia oleracea]
          Length = 181

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V+  S+   VLE   PV+VDFWA WC PC  ++P+ID++A E + K+ + KL+ +E+
Sbjct: 76  VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEA 135

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T+Y I SIPT++ FK+G+  + ++ GA  +S + + I   +
Sbjct: 136 PGIATQYNIRSIPTVLFFKNGERKESII-GAVPKSTLTDSIEKYL 179


>gi|30678634|ref|NP_849585.1| ATHM1; enzyme activator [Arabidopsis thaliana]
 gi|11135105|sp|O48737|TRXM1_ARATH RecName: Full=Thioredoxin M1, chloroplastic; Short=AtTrxm1; Flags:
           Precursor
 gi|6539608|gb|AAF15948.1|AF095749_1 thioredoxin m1 [Arabidopsis thaliana]
 gi|9280656|gb|AAF86525.1|AC002560_18 F21B7.28 [Arabidopsis thaliana]
 gi|28393767|gb|AAO42293.1| putative thioredoxin-m [Arabidopsis thaliana]
 gi|28973241|gb|AAO63945.1| putative thioredoxin-m [Arabidopsis thaliana]
 gi|332189475|gb|AEE27596.1| thioredoxin M1 [Arabidopsis thaliana]
          Length = 179

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  ++DS VL+   PV VDFWA WC PC  + PI++++A + A + K  KL+ +ES   
Sbjct: 79  VNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPAT 138

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +Y + SIPT+++F +G+  D ++ GA S+  +   I   +
Sbjct: 139 PGQYGVRSIPTIMIFVNGEKKDTII-GAVSKDTLATSINKFL 179


>gi|115436382|ref|NP_001042949.1| Os01g0339900 [Oryza sativa Japonica Group]
 gi|75331870|sp|Q942L2|PDI22_ORYSJ RecName: Full=Protein disulfide isomerase-like 2-2;
           Short=OsPDIL2-2; AltName: Full=Protein disulfide
           isomerase-like 4-2; Short=OsPDIL4-2; Flags: Precursor
 gi|15623934|dbj|BAB67990.1| putative protein disulfide-isomerase TIGA precursor [Oryza sativa
           Japonica Group]
 gi|113532480|dbj|BAF04863.1| Os01g0339900 [Oryza sativa Japonica Group]
 gi|125525761|gb|EAY73875.1| hypothetical protein OsI_01755 [Oryza sativa Indica Group]
 gi|125570235|gb|EAZ11750.1| hypothetical protein OsJ_01619 [Oryza sativa Japonica Group]
 gi|215694636|dbj|BAG89827.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 371

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDI 59
           S + +   +FDS VL+ +  ++V+F+A WC  C  L+PI +      +L D V I  LD 
Sbjct: 154 SVVVLGPDNFDSIVLDENKDILVEFYAPWCGHCKHLAPIYEKLASVYKLDDGVVIANLDA 213

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++  +++ +Y +S  PTL  F  G        G     D +++I  +
Sbjct: 214 DKHKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRELDDFVKFINEK 260



 Score = 83.7 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 37  VVALTESTFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVFIAKVDCD 95

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PT+  F  G +  +   G  S   + E++ 
Sbjct: 96  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSAEALAEFVN 139


>gi|295102891|emb|CBL00436.1| thioredoxin [Faecalibacterium prausnitzii L2-6]
          Length = 102

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +  ++F++EVL+ + PV++DFWA+WC PC  LSP++D++A+E    VK+ K++++
Sbjct: 1   MAVITITKENFETEVLKSAQPVLLDFWAAWCGPCRMLSPVVDEVAEE-RTDVKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++  + + SIP L+LF++GK++ + + GA  +S ++E +
Sbjct: 60  EQPELAAEFGVMSIPALLLFENGKLVRQAV-GARPKSGVLELL 101


>gi|170724879|ref|YP_001758905.1| thioredoxin [Shewanella woodyi ATCC 51908]
 gi|169810226|gb|ACA84810.1| thioredoxin [Shewanella woodyi ATCC 51908]
          Length = 108

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++V+  + PVVVDFWA WC PC  ++PI+DD+A+E   KV I K++
Sbjct: 1   MSDKIVHLSDDSFENDVINSTLPVVVDFWAEWCGPCKMIAPILDDVAEEYEGKVTIAKMN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++S    +Y +  IPTL++FK+G++    + GA S++ + E+I +++
Sbjct: 61  VDQNSVSPAKYGVRGIPTLLIFKNGELASTKV-GALSKTQLKEFIDAQL 108


>gi|15924135|ref|NP_371669.1| thioredoxin [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926729|ref|NP_374262.1| thioredoxin [Staphylococcus aureus subsp. aureus N315]
 gi|21282757|ref|NP_645845.1| thioredoxin [Staphylococcus aureus subsp. aureus MW2]
 gi|49483308|ref|YP_040532.1| thioredoxin [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49485983|ref|YP_043204.1| thioredoxin [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57651754|ref|YP_186018.1| thioredoxin [Staphylococcus aureus subsp. aureus COL]
 gi|82750752|ref|YP_416493.1| thioredoxin [Staphylococcus aureus RF122]
 gi|87161236|ref|YP_493742.1| thioredoxin [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88194846|ref|YP_499644.1| thioredoxin [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|148267637|ref|YP_001246580.1| thioredoxin [Staphylococcus aureus subsp. aureus JH9]
 gi|150393692|ref|YP_001316367.1| thioredoxin [Staphylococcus aureus subsp. aureus JH1]
 gi|151221269|ref|YP_001332091.1| thioredoxin [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156979467|ref|YP_001441726.1| thioredoxin [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509319|ref|YP_001574978.1| thioredoxin [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|221140457|ref|ZP_03564950.1| thioredoxin [Staphylococcus aureus subsp. aureus str. JKD6009]
 gi|253317072|ref|ZP_04840285.1| thioredoxin [Staphylococcus aureus subsp. aureus str. CF-Marseille]
 gi|253731757|ref|ZP_04865922.1| thioredoxin [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253733619|ref|ZP_04867784.1| thioredoxin [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005931|ref|ZP_05144532.2| thioredoxin [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|257425196|ref|ZP_05601622.1| thioredoxin [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257427859|ref|ZP_05604257.1| thioredoxin [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257430494|ref|ZP_05606876.1| thioredoxin [Staphylococcus aureus subsp. aureus 68-397]
 gi|257433256|ref|ZP_05609614.1| thioredoxin [Staphylococcus aureus subsp. aureus E1410]
 gi|257436095|ref|ZP_05612142.1| thioredoxin [Staphylococcus aureus subsp. aureus M876]
 gi|257795125|ref|ZP_05644104.1| thioredoxin [Staphylococcus aureus A9781]
 gi|258407167|ref|ZP_05680316.1| thioredoxin [Staphylococcus aureus A9763]
 gi|258421742|ref|ZP_05684663.1| thioredoxin [Staphylococcus aureus A9719]
 gi|258423812|ref|ZP_05686698.1| thioredoxin [Staphylococcus aureus A9635]
 gi|258432914|ref|ZP_05688603.1| thioredoxin [Staphylococcus aureus A9299]
 gi|258443404|ref|ZP_05691747.1| thioredoxin [Staphylococcus aureus A8115]
 gi|258446077|ref|ZP_05694239.1| thioredoxin [Staphylococcus aureus A6300]
 gi|258449810|ref|ZP_05697908.1| thioredoxin [Staphylococcus aureus A6224]
 gi|258451842|ref|ZP_05699863.1| thioredoxin [Staphylococcus aureus A5948]
 gi|258454909|ref|ZP_05702872.1| thioredoxin [Staphylococcus aureus A5937]
 gi|262048726|ref|ZP_06021608.1| thioredoxin [Staphylococcus aureus D30]
 gi|262051665|ref|ZP_06023884.1| thioredoxin [Staphylococcus aureus 930918-3]
 gi|269202757|ref|YP_003282026.1| thioredoxin [Staphylococcus aureus subsp. aureus ED98]
 gi|282894172|ref|ZP_06302403.1| thioredoxin [Staphylococcus aureus A8117]
 gi|282903693|ref|ZP_06311581.1| thioredoxin [Staphylococcus aureus subsp. aureus C160]
 gi|282905462|ref|ZP_06313317.1| thioredoxin [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282908436|ref|ZP_06316267.1| thioredoxin [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282910720|ref|ZP_06318523.1| thioredoxin [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282913920|ref|ZP_06321707.1| thioredoxin [Staphylococcus aureus subsp. aureus M899]
 gi|282916394|ref|ZP_06324156.1| thioredoxin [Staphylococcus aureus subsp. aureus D139]
 gi|282918843|ref|ZP_06326578.1| thioredoxin [Staphylococcus aureus subsp. aureus C427]
 gi|282919922|ref|ZP_06327651.1| thioredoxin [Staphylococcus aureus A9765]
 gi|282923965|ref|ZP_06331641.1| thioredoxin [Staphylococcus aureus subsp. aureus C101]
 gi|282928667|ref|ZP_06336264.1| thioredoxin [Staphylococcus aureus A10102]
 gi|283770205|ref|ZP_06343097.1| thioredoxin 1 [Staphylococcus aureus subsp. aureus H19]
 gi|283957888|ref|ZP_06375339.1| thioredoxin [Staphylococcus aureus subsp. aureus A017934/97]
 gi|284024070|ref|ZP_06378468.1| thioredoxin [Staphylococcus aureus subsp. aureus 132]
 gi|293500955|ref|ZP_06666806.1| thioredoxin [Staphylococcus aureus subsp. aureus 58-424]
 gi|293509912|ref|ZP_06668621.1| thioredoxin [Staphylococcus aureus subsp. aureus M809]
 gi|293526499|ref|ZP_06671184.1| thioredoxin [Staphylococcus aureus subsp. aureus M1015]
 gi|294848135|ref|ZP_06788882.1| thioredoxin [Staphylococcus aureus A9754]
 gi|295405949|ref|ZP_06815758.1| thioredoxin [Staphylococcus aureus A8819]
 gi|295427632|ref|ZP_06820264.1| thioredoxin [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296275632|ref|ZP_06858139.1| thioredoxin [Staphylococcus aureus subsp. aureus MR1]
 gi|297208217|ref|ZP_06924647.1| thioredoxin [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297246509|ref|ZP_06930347.1| thioredoxin [Staphylococcus aureus A8796]
 gi|297591414|ref|ZP_06950052.1| thioredoxin [Staphylococcus aureus subsp. aureus MN8]
 gi|300912294|ref|ZP_07129737.1| thioredoxin [Staphylococcus aureus subsp. aureus TCH70]
 gi|304381298|ref|ZP_07363951.1| thioredoxin [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|60390816|sp|Q6GA69|THIO_STAAS RecName: Full=Thioredoxin; Short=Trx
 gi|60390823|sp|Q6GHU0|THIO_STAAR RecName: Full=Thioredoxin; Short=Trx
 gi|60415961|sp|P0A0K4|THIO_STAAM RecName: Full=Thioredoxin; Short=Trx
 gi|60415962|sp|P0A0K5|THIO_STAAW RecName: Full=Thioredoxin; Short=Trx
 gi|60415963|sp|P0A0K6|THIO_STAAU RecName: Full=Thioredoxin; Short=Trx
 gi|60415964|sp|P99122|THIO_STAAN RecName: Full=Thioredoxin; Short=Trx
 gi|81859603|sp|Q5HGT9|THIO_STAAC RecName: Full=Thioredoxin; Short=Trx
 gi|119367394|sp|Q2FHT6|THIO_STAA3 RecName: Full=Thioredoxin; Short=Trx
 gi|119367395|sp|Q2FZD2|THIO_STAA8 RecName: Full=Thioredoxin; Short=Trx
 gi|119367396|sp|Q2YXD0|THIO_STAAB RecName: Full=Thioredoxin; Short=Trx
 gi|3776111|emb|CAA11404.1| thioredoxin [Staphylococcus aureus]
 gi|13700945|dbj|BAB42241.1| thioredoxin [Staphylococcus aureus subsp. aureus N315]
 gi|14246915|dbj|BAB57307.1| thioredoxin [Staphylococcus aureus subsp. aureus Mu50]
 gi|21204195|dbj|BAB94893.1| thioredoxin [Staphylococcus aureus subsp. aureus MW2]
 gi|49241437|emb|CAG40121.1| thioredoxin [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49244426|emb|CAG42854.1| thioredoxin [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57285940|gb|AAW38034.1| thioredoxin [Staphylococcus aureus subsp. aureus COL]
 gi|82656283|emb|CAI80697.1| thioredoxin [Staphylococcus aureus RF122]
 gi|87127210|gb|ABD21724.1| thioredoxin [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87202404|gb|ABD30214.1| thioredoxin [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740706|gb|ABQ49004.1| thioredoxin [Staphylococcus aureus subsp. aureus JH9]
 gi|149946144|gb|ABR52080.1| thioredoxin [Staphylococcus aureus subsp. aureus JH1]
 gi|150374069|dbj|BAF67329.1| thioredoxin [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156721602|dbj|BAF78019.1| thioredoxin [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368128|gb|ABX29099.1| thioredoxin [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|253724486|gb|EES93215.1| thioredoxin [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253728418|gb|EES97147.1| thioredoxin [Staphylococcus aureus subsp. aureus TCH130]
 gi|257272172|gb|EEV04304.1| thioredoxin [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257274700|gb|EEV06187.1| thioredoxin [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278622|gb|EEV09241.1| thioredoxin [Staphylococcus aureus subsp. aureus 68-397]
 gi|257281349|gb|EEV11486.1| thioredoxin [Staphylococcus aureus subsp. aureus E1410]
 gi|257284377|gb|EEV14497.1| thioredoxin [Staphylococcus aureus subsp. aureus M876]
 gi|257789097|gb|EEV27437.1| thioredoxin [Staphylococcus aureus A9781]
 gi|257841322|gb|EEV65767.1| thioredoxin [Staphylococcus aureus A9763]
 gi|257842075|gb|EEV66503.1| thioredoxin [Staphylococcus aureus A9719]
 gi|257846044|gb|EEV70072.1| thioredoxin [Staphylococcus aureus A9635]
 gi|257849354|gb|EEV73331.1| thioredoxin [Staphylococcus aureus A9299]
 gi|257851494|gb|EEV75433.1| thioredoxin [Staphylococcus aureus A8115]
 gi|257855135|gb|EEV78076.1| thioredoxin [Staphylococcus aureus A6300]
 gi|257856730|gb|EEV79633.1| thioredoxin [Staphylococcus aureus A6224]
 gi|257860450|gb|EEV83277.1| thioredoxin [Staphylococcus aureus A5948]
 gi|257862789|gb|EEV85554.1| thioredoxin [Staphylococcus aureus A5937]
 gi|259160400|gb|EEW45425.1| thioredoxin [Staphylococcus aureus 930918-3]
 gi|259163182|gb|EEW47742.1| thioredoxin [Staphylococcus aureus D30]
 gi|262075047|gb|ACY11020.1| thioredoxin [Staphylococcus aureus subsp. aureus ED98]
 gi|269940639|emb|CBI49018.1| thioredoxin [Staphylococcus aureus subsp. aureus TW20]
 gi|282313937|gb|EFB44329.1| thioredoxin [Staphylococcus aureus subsp. aureus C101]
 gi|282316653|gb|EFB47027.1| thioredoxin [Staphylococcus aureus subsp. aureus C427]
 gi|282319834|gb|EFB50182.1| thioredoxin [Staphylococcus aureus subsp. aureus D139]
 gi|282321988|gb|EFB52312.1| thioredoxin [Staphylococcus aureus subsp. aureus M899]
 gi|282325325|gb|EFB55634.1| thioredoxin [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282328101|gb|EFB58383.1| thioredoxin [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282330754|gb|EFB60268.1| thioredoxin [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282589706|gb|EFB94792.1| thioredoxin [Staphylococcus aureus A10102]
 gi|282594638|gb|EFB99622.1| thioredoxin [Staphylococcus aureus A9765]
 gi|282595311|gb|EFC00275.1| thioredoxin [Staphylococcus aureus subsp. aureus C160]
 gi|282763658|gb|EFC03787.1| thioredoxin [Staphylococcus aureus A8117]
 gi|283460352|gb|EFC07442.1| thioredoxin 1 [Staphylococcus aureus subsp. aureus H19]
 gi|283470355|emb|CAQ49566.1| thioredoxin [Staphylococcus aureus subsp. aureus ST398]
 gi|283790037|gb|EFC28854.1| thioredoxin [Staphylococcus aureus subsp. aureus A017934/97]
 gi|285816825|gb|ADC37312.1| Thioredoxin [Staphylococcus aureus 04-02981]
 gi|290920571|gb|EFD97634.1| thioredoxin [Staphylococcus aureus subsp. aureus M1015]
 gi|291095960|gb|EFE26221.1| thioredoxin [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467362|gb|EFF09879.1| thioredoxin [Staphylococcus aureus subsp. aureus M809]
 gi|294824935|gb|EFG41357.1| thioredoxin [Staphylococcus aureus A9754]
 gi|294969384|gb|EFG45404.1| thioredoxin [Staphylococcus aureus A8819]
 gi|295127990|gb|EFG57624.1| thioredoxin [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296886956|gb|EFH25859.1| thioredoxin [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297176615|gb|EFH35878.1| thioredoxin [Staphylococcus aureus A8796]
 gi|297576300|gb|EFH95016.1| thioredoxin [Staphylococcus aureus subsp. aureus MN8]
 gi|298694433|gb|ADI97655.1| thioredoxin [Staphylococcus aureus subsp. aureus ED133]
 gi|300886540|gb|EFK81742.1| thioredoxin [Staphylococcus aureus subsp. aureus TCH70]
 gi|302332753|gb|ADL22946.1| thioredoxin [Staphylococcus aureus subsp. aureus JKD6159]
 gi|302750968|gb|ADL65145.1| thioredoxin [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304340281|gb|EFM06222.1| thioredoxin [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|312438479|gb|ADQ77550.1| thioredoxin [Staphylococcus aureus subsp. aureus TCH60]
 gi|312829538|emb|CBX34380.1| thioredoxin [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315128542|gb|EFT84547.1| thioredoxin [Staphylococcus aureus subsp. aureus CGS03]
 gi|315193815|gb|EFU24210.1| thioredoxin [Staphylococcus aureus subsp. aureus CGS00]
 gi|315196868|gb|EFU27211.1| thioredoxin [Staphylococcus aureus subsp. aureus CGS01]
 gi|320141040|gb|EFW32887.1| thioredoxin [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143097|gb|EFW34887.1| thioredoxin [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323440695|gb|EGA98405.1| thioredoxin [Staphylococcus aureus O11]
 gi|323442362|gb|EGA99991.1| thioredoxin [Staphylococcus aureus O46]
 gi|329313813|gb|AEB88226.1| Thioredoxin [Staphylococcus aureus subsp. aureus T0131]
 gi|329725175|gb|EGG61664.1| thioredoxin [Staphylococcus aureus subsp. aureus 21172]
 gi|329728820|gb|EGG65241.1| thioredoxin [Staphylococcus aureus subsp. aureus 21193]
 gi|329730755|gb|EGG67134.1| thioredoxin [Staphylococcus aureus subsp. aureus 21189]
          Length = 104

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV    FDS+V   S   +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MAIVKVTDADFDSKV--ESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 59  ENPSTAAKYEVMSIPTLIVFKDGQPVDKVV-GFQPKENLAEVLDKHL 104


>gi|255994588|ref|ZP_05427723.1| thioredoxin [Eubacterium saphenum ATCC 49989]
 gi|255993301|gb|EEU03390.1| thioredoxin [Eubacterium saphenum ATCC 49989]
          Length = 103

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++  ++F+ +VL+   PV+VDFWA+WC PC +  PI+DD+  +   K  + K++++  
Sbjct: 2   IIELTNENFEEKVLKSDVPVLVDFWATWCGPCKRQGPILDDLEPKSDGKFAVGKVNVDNE 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
             ++ +Y + SIPTLI+FKDG+V +  + G  S+  ++E + +
Sbjct: 62  PALAQKYGVMSIPTLIVFKDGEVKETAV-GFRSEDKLLEMLNA 103


>gi|258653737|ref|YP_003202893.1| thioredoxin [Nakamurella multipartita DSM 44233]
 gi|258556962|gb|ACV79904.1| thioredoxin [Nakamurella multipartita DSM 44233]
          Length = 149

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +      F + V E S PV+VD WA WC PC  +SP ++ +A ELA ++K+ K++ + +
Sbjct: 42  VVDATDDEFHAVVDESSLPVLVDVWAPWCGPCRMVSPALEKLAGELAGRLKLVKVNADAN 101

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            E+S ++++ SIPTL++   G+VID+ + GA  +  +  W+ S++
Sbjct: 102 PEVSRQFEVRSIPTLVILDHGQVIDKQI-GARPEPQLRSWLESKL 145


>gi|78043796|ref|YP_361015.1| thioredoxin [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995911|gb|ABB14810.1| thioredoxin [Carboxydothermus hydrogenoformans Z-2901]
          Length = 106

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + +  ++F++E L+    ++VDFWA WC PC  ++PI+++IA E   K+ + KLD++
Sbjct: 1   MGIITLTDENFETEALKREGLIIVDFWAEWCGPCRMIAPILEEIAQEYEGKLTVGKLDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E   RY I SIPTL+  K+G+ + R + G   ++++++ I+  +
Sbjct: 61  SNPETPRRYGIMSIPTLLFIKNGEEVGRTV-GFKHKNELMKIIIKNL 106


>gi|284006574|emb|CBA71835.1| thioredoxin [Arsenophonus nasoniae]
          Length = 108

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +    F+  V     P++VDFWA WC PC  ++PI+D+IADE   K+ I KL+
Sbjct: 1   MSEKVIHLSGIDFEETVKSAKKPILVDFWAEWCGPCKMIAPILDEIADEYTAKLIIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ES +I+T Y I SIPTL+LFK+G+ + + + G  S++ + E++   +
Sbjct: 61  VDESIDIATIYGIRSIPTLMLFKNGEKVGQQV-GLLSKTQLKEFLDKNL 108


>gi|260904991|ref|ZP_05913313.1| thioredoxin [Brevibacterium linens BL2]
          Length = 105

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  +V   +F+  VL+   PV+VDFWA WC PC  +SPI+D IA+E  +K+ + K++ +
Sbjct: 1   MST-EVTDATFEETVLKSDKPVLVDFWAPWCGPCRMVSPIVDQIAEENTEKLNVVKVNTD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E +++Y I+SIP L +FKDG  + + + GA  +  + + +
Sbjct: 60  ENLETASKYGITSIPALYVFKDG-EVAKTIIGARPKPALEDEL 101


>gi|255066506|ref|ZP_05318361.1| thioredoxin [Neisseria sicca ATCC 29256]
 gi|255049386|gb|EET44850.1| thioredoxin [Neisseria sicca ATCC 29256]
          Length = 110

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL+   PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 1   MSSELIIHTSDANFEQDVLKSDVPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+     ++ +  IPTL++FK+G+ +   + GA ++  +  ++ + +
Sbjct: 61  NIDENEATPAKFGVRGIPTLMVFKNGENVATKV-GALAKGQLTAFVNASL 109


>gi|124003473|ref|ZP_01688322.1| thioredoxin [Microscilla marina ATCC 23134]
 gi|123991042|gb|EAY30494.1| thioredoxin [Microscilla marina ATCC 23134]
          Length = 106

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 66/105 (62%), Gaps = 3/105 (2%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  L +   +FD EV+    PV+VDFWA WC PC  LSPI++++A E   K  I  +D+
Sbjct: 1   MANTLAITDANFD-EVINSDKPVLVDFWAEWCGPCKMLSPIVEELAGEYDGKAIIASVDV 59

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           + +  +S ++ I SIPTL+ FK+G+++D+ + G   ++ + + + 
Sbjct: 60  DSNPNVSAKFGIRSIPTLLFFKNGEIVDKQV-GYVPKAALAQKLD 103


>gi|104784236|ref|YP_610734.1| thioredoxin [Pseudomonas entomophila L48]
 gi|95113223|emb|CAK17951.1| thioredoxin [Pseudomonas entomophila L48]
          Length = 108

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   SF+++VL+    V+VD+WA WC PC  ++P++D IA++ A K+ + KL+
Sbjct: 1   MSDKIKHVTDASFEADVLKAEGAVLVDYWAEWCGPCKMIAPVLDAIAEDYAGKLVVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  +I + +
Sbjct: 61  IDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLQAFIDANL 108


>gi|87200012|ref|YP_497269.1| thioredoxin [Novosphingobium aromaticivorans DSM 12444]
 gi|87135693|gb|ABD26435.1| thioredoxin [Novosphingobium aromaticivorans DSM 12444]
          Length = 106

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 47/105 (44%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    V   SF S+VL  S PV+VDFWA WC PC  ++P +++IA+EL DKV+I K+DI 
Sbjct: 1   MPTKAVTDASFASDVLGSSKPVLVDFWADWCGPCKMIAPALEEIAEELGDKVEIAKVDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+++ ++++ + SIP LILFKDG+ + + + GA+ +S +  W+ S
Sbjct: 61  ENTDTASKFGVQSIPLLILFKDGQPVAQKL-GAAPKSQLKGWLES 104


>gi|225849914|ref|YP_002730148.1| thioredoxin [Persephonella marina EX-H1]
 gi|225645299|gb|ACO03485.1| thioredoxin [Persephonella marina EX-H1]
          Length = 105

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/98 (38%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  +++ EVL    PV+VDFWA WC PC  ++P+I+++A+EL  K KI KL+ +E+  I
Sbjct: 8   VNESNWEQEVLNSELPVLVDFWAPWCGPCRLIAPVIEELAEELEGKAKICKLNTDENPNI 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +Y I +IPT+++FK+G+V+D  + G   +  +   +
Sbjct: 68  AMKYGIRAIPTIMVFKNGQVVDTKV-GVQPKEVLKSLL 104


>gi|311745731|ref|ZP_07719516.1| thioredoxin [Algoriphagus sp. PR1]
 gi|126575174|gb|EAZ79524.1| thioredoxin [Algoriphagus sp. PR1]
          Length = 106

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   +F+ E+++   P++VDFWA WC PC  + P+++++A +   K  I K+D++ + 
Sbjct: 5   IEITDANFE-EIIKSDQPILVDFWAEWCGPCKMIGPVVEELAGDYDGKAVIGKVDVDANP 63

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++  + I SIPTL+ FK G+++D+ + GA  ++ + + + +++
Sbjct: 64  AVAQAFGIRSIPTLLFFKGGEIVDKQV-GAVPKAVLAQKLDAQL 106


>gi|166030513|ref|ZP_02233342.1| hypothetical protein DORFOR_00174 [Dorea formicigenerans ATCC
           27755]
 gi|166029675|gb|EDR48432.1| hypothetical protein DORFOR_00174 [Dorea formicigenerans ATCC
           27755]
          Length = 101

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F +EVL    PV++DFWASWC PC  +  I+++IA E    +K+ K++++
Sbjct: 1   MSAININKNNFQNEVLNSDKPVLLDFWASWCAPCRMVVSIVEEIASE-RRDIKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E I
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIV-QQVSGARPKNAILEMI 101


>gi|304410788|ref|ZP_07392405.1| thioredoxin [Shewanella baltica OS183]
 gi|307305040|ref|ZP_07584790.1| thioredoxin [Shewanella baltica BA175]
 gi|304350685|gb|EFM15086.1| thioredoxin [Shewanella baltica OS183]
 gi|306912442|gb|EFN42866.1| thioredoxin [Shewanella baltica BA175]
          Length = 170

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++ + +F +   +   P+VVDFWASWC PC   +P+    A     + +  K++ EE
Sbjct: 66  APIELTSANFANHANKSELPLVVDFWASWCGPCKSFAPVFSAAAKTWEPQFRFGKINTEE 125

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
              ++ ++ I SIPTL++FK GK++ +   GA  QS + +W+ S 
Sbjct: 126 QQALAAQFNIRSIPTLMIFKQGKILAQ-QAGALPQSALNQWLKSH 169


>gi|118488968|gb|ABK96292.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 190

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S VLE  +PV+V+FWA WC PC  + PIID++A +   K+K  K++ ++ 
Sbjct: 87  VASVTDATWKSVVLESESPVLVEFWAPWCGPCRMIHPIIDELATQYTGKLKCYKVNTDDC 146

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T+Y I SIPT+I+FK+G+  + ++ GA  ++ +   I   +
Sbjct: 147 PSIATQYGIRSIPTVIIFKNGEKKEAII-GAVPKTTLTTTIEKFL 190


>gi|254444085|ref|ZP_05057561.1| thioredoxin [Verrucomicrobiae bacterium DG1235]
 gi|198258393|gb|EDY82701.1| thioredoxin [Verrucomicrobiae bacterium DG1235]
          Length = 107

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 73/108 (67%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + ++ +SF+  +   + PV+VDFWA WC PC  ++P++++IADEL  K  ITK+++
Sbjct: 1   MADIINLNEQSFNDAISSANGPVLVDFWAPWCGPCKAIAPLLEEIADELDGKAAITKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+S I+ +Y + +IPTLILFK G+ +D ++ G   + D+   + + V
Sbjct: 61  DENSAIAAKYNVRAIPTLILFKGGEQVDTIV-GMIGKDDLKAKVEAHV 107


>gi|71066543|ref|YP_265270.1| thioredoxin [Psychrobacter arcticus 273-4]
 gi|71039528|gb|AAZ19836.1| thioredoxin [Psychrobacter arcticus 273-4]
          Length = 108

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +     +FD +VL+   PV+VDFWA+WC PC  ++PI++D+A E   KVKI K+D
Sbjct: 1   MSDLIINTTDANFDQDVLQSDVPVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + + ++R+ I +IPTL +FK G+ +D  + G   ++++ + +   +
Sbjct: 61  VDNNPQAASRFGIRNIPTLFVFKGGEKVDS-VMGLQPKAELAKVLDKHL 108


>gi|307322543|ref|ZP_07601888.1| thioredoxin [Sinorhizobium meliloti AK83]
 gi|306891805|gb|EFN22646.1| thioredoxin [Sinorhizobium meliloti AK83]
          Length = 107

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L ++T +F  EVL  + PVVVDFWA WC PC K++  +++ + ELA KVK+ K++ +
Sbjct: 1   MATLNINTSNFQKEVLNSAEPVVVDFWAPWCGPCKKIALSLEEFSTELAGKVKVVKVNCD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E+   Y + SIP L +FK G+V D  + G + ++ +  WIL+ +
Sbjct: 61  ENPELVAEYDVRSIPMLAIFKAGEVADIKI-GDAPKTALSSWILNAI 106


>gi|162461791|ref|NP_001105758.1| protein disulfide isomerase6 [Zea mays]
 gi|59861269|gb|AAX09964.1| protein disulfide isomerase [Zea mays]
 gi|223948367|gb|ACN28267.1| unknown [Zea mays]
          Length = 367

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDI--ADELADKVKITKLDI 59
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+P  + +    +L + V I  LD 
Sbjct: 150 SVVVLTPETFDSIVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASVFKLDEGVVIANLDA 209

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++  +++ +Y +S  PTL  F  G        G     D +++I  +
Sbjct: 210 DKHRDLAEKYGVSGFPTLKFFPKGNKAGEDYDGDRDLVDFVKFINEK 256



 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV       +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 33  VVALTESTFEKEV-GKDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKVDCD 91

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ 
Sbjct: 92  EHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFLN 135


>gi|83589778|ref|YP_429787.1| thioredoxin [Moorella thermoacetica ATCC 39073]
 gi|83572692|gb|ABC19244.1| thioredoxin [Moorella thermoacetica ATCC 39073]
          Length = 108

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + V+   F++EVL    PVVVDFWA WC PC  ++P+++ +A +    VK  K+++
Sbjct: 1   MAKPINVNQNDFEAEVLSAPLPVVVDFWAVWCGPCRMMAPVLEQLAADYDGNVKFAKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ E++ RY I SIPTL++FKDG    R++ G   +  + E + + +
Sbjct: 61  DENQELAARYGIMSIPTLVIFKDGAEAGRIV-GYMPKEKLQEQLEAAI 107


>gi|255645357|gb|ACU23175.1| unknown [Glycine max]
          Length = 364

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIE 60
            + + +++F+  VL+ +  V+V+F+A WC  C  L+P  + +A      + V I  LD +
Sbjct: 148 VVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVIANLDAD 207

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 208 KYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEK 253



 Score = 83.3 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 30  VVVLSEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVLIGKVDCD 88

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ 
Sbjct: 89  EHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADSLAEFVN 132


>gi|255636238|gb|ACU18460.1| unknown [Glycine max]
          Length = 276

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIE 60
            + + +++F+  VL+ +  V+V+F+A WC  C  L+P  + +A      + V I  LD +
Sbjct: 148 VVVLTSENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVIANLDAD 207

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 208 KYKDLAEKYDVSGFPTLKFFPKGNKAGEEYGGGRDLDDFVAFINEK 253



 Score = 83.3 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 30  VVVLSEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVLIGKVDCD 88

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ 
Sbjct: 89  EHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADSLAEFVN 132


>gi|153813087|ref|ZP_01965755.1| hypothetical protein RUMOBE_03495 [Ruminococcus obeum ATCC 29174]
 gi|253581201|ref|ZP_04858458.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|149830889|gb|EDM85979.1| hypothetical protein RUMOBE_03495 [Ruminococcus obeum ATCC 29174]
 gi|251847478|gb|EES75451.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
 gi|291545997|emb|CBL19105.1| thioredoxin [Ruminococcus sp. SR1/5]
          Length = 101

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F +EVL    PV++DFWASWC PC  + PI+++IA E    +K+ K++++
Sbjct: 1   MSAININKNNFQNEVLNSDKPVLLDFWASWCAPCRMVVPIVEEIASE-RRDIKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIV-QQVSGARPKNAILEML 101


>gi|149371987|ref|ZP_01891306.1| thioredoxin [unidentified eubacterium SCB49]
 gi|149355127|gb|EDM43688.1| thioredoxin [unidentified eubacterium SCB49]
          Length = 105

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL    PVVVDFWA+WC PC  + P+ID+++++   K  + K+D++
Sbjct: 1   MA-LEITDATFEETVLNSDKPVVVDFWAAWCGPCRMVGPVIDELSNDYEGKAVVGKMDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + ++ + +IPT+++F  G+++DR + G + ++   E I   +
Sbjct: 60  ANQEFAAKFGVRNIPTVLVFHKGELVDRQV-GVAPKATYAEKIDKLL 105


>gi|70733267|ref|YP_263040.1| thioredoxin [Pseudomonas fluorescens Pf-5]
 gi|77461678|ref|YP_351185.1| thioredoxin [Pseudomonas fluorescens Pf0-1]
 gi|68347566|gb|AAY95172.1| thioredoxin [Pseudomonas fluorescens Pf-5]
 gi|77385681|gb|ABA77194.1| thioredoxin [Pseudomonas fluorescens Pf0-1]
          Length = 109

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   SF+++VL+    V+VD+WA WC PC  ++P++D+IA+    K+ + KL
Sbjct: 1   MSSDLIKHVSDASFEADVLKAEGAVLVDYWAEWCGPCKMIAPVLDEIAETYKGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 109


>gi|303326795|ref|ZP_07357237.1| thioredoxin [Desulfovibrio sp. 3_1_syn3]
 gi|302862783|gb|EFL85715.1| thioredoxin [Desulfovibrio sp. 3_1_syn3]
          Length = 107

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   +F+S VL+   PV++DFWA WC PC  + PIID++A E   KV++ K++++E+  
Sbjct: 4   QVTDATFESLVLKSDLPVLLDFWAPWCGPCRAVGPIIDELAKEYEGKVRVVKMNVDENPA 63

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             T++ I +IPTL++FK+G+ +++ + GA ++  + E + S+V
Sbjct: 64  TPTKFGIRAIPTLVVFKNGETVEQ-ITGAVTKVAMKELLDSKV 105


>gi|260436029|ref|ZP_05789999.1| thioredoxin [Synechococcus sp. WH 8109]
 gi|260413903|gb|EEX07199.1| thioredoxin [Synechococcus sp. WH 8109]
          Length = 111

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +        F+ EVL+ S  V+VDFWA+WC PC  ++P++D +A +  D V + KL+++ 
Sbjct: 7   AVADFTDAGFEREVLKASGTVLVDFWAAWCGPCRLIAPLMDWVASDYGDCVSVGKLEVDA 66

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +    YQ+  IPTLILF++G+V+ R   GA ++  +  ++ + +
Sbjct: 67  NPQTRDAYQVQGIPTLILFRNGEVVARH-EGAIAKPQLQSFLDANL 111


>gi|220932648|ref|YP_002509556.1| thioredoxin [Halothermothrix orenii H 168]
 gi|219993958|gb|ACL70561.1| thioredoxin [Halothermothrix orenii H 168]
          Length = 106

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + V   +F  EVL+   PVVVDFWA WC PC  L+P+I  IA E +DKVK+ KL++
Sbjct: 1   MSRPVDVTDGNFSREVLKSDKPVVVDFWAEWCAPCRMLTPVIKKIAREYSDKVKVCKLNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +E+   ++RY + SIPT+ILF++GK + + + G   ++ +++ +
Sbjct: 61  DENQSTASRYGVMSIPTIILFENGK-VKKQVTGYMPKNTLVKKL 103


>gi|325208324|gb|ADZ03776.1| thioredoxin [Neisseria meningitidis NZ-05/33]
          Length = 129

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL    PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 20  MSSELIIHTSDAAFEKDVLNSDTPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKI 79

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++    +R+ +  IPTL++FK+G+V+   + GA ++  +  ++ + +
Sbjct: 80  NIDDNEATPSRFGVRGIPTLMVFKNGEVVATKV-GALAKGQLTAFVEASI 128


>gi|120597337|ref|YP_961911.1| thioredoxin [Shewanella sp. W3-18-1]
 gi|146294518|ref|YP_001184942.1| thioredoxin [Shewanella putrefaciens CN-32]
 gi|120557430|gb|ABM23357.1| thioredoxin [Shewanella sp. W3-18-1]
 gi|145566208|gb|ABP77143.1| thioredoxin [Shewanella putrefaciens CN-32]
 gi|319427883|gb|ADV55957.1| thioredoxin [Shewanella putrefaciens 200]
          Length = 108

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +    F+++VL+   PV+VDFWA WC PC  ++PI+DD+A+E A +V I KL+
Sbjct: 1   MSDKIIYLSDDGFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVAEEYAGRVTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL+LFK+G++    + GA S++ + E+I +++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLLFKNGELAATKV-GALSKTQLKEFIDAQI 108


>gi|310643791|ref|YP_003948549.1| thioredoxin [Paenibacillus polymyxa SC2]
 gi|309248741|gb|ADO58308.1| Thioredoxin [Paenibacillus polymyxa SC2]
          Length = 105

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  +SF++EV E +  V+VDFWA WC PC  ++PI++D++ E+ D VKI K++++
Sbjct: 1   MAIVNVSDQSFNAEV-EGTGTVLVDFWAPWCGPCKMIAPILEDLSTEVGDSVKIAKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E ++R+ + SIPTLI+FKDG+ +D+++ G +S+  +   +   
Sbjct: 60  ENPESASRFGVMSIPTLIVFKDGQPVDKVV-GLNSKEALKSMLTKH 104


>gi|307544325|ref|YP_003896804.1| thioredoxin [Halomonas elongata DSM 2581]
 gi|307216349|emb|CBV41619.1| K03671 thioredoxin 1 [Halomonas elongata DSM 2581]
          Length = 107

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 1   MSA-LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + V   +F+ EVL    PV++ FWA WC PC  ++P++D++A+E    +KI  +++
Sbjct: 1   MANNVDVTNANFEQEVLNAEIPVLLKFWAPWCGPCKVMAPVVDEVAEEREGNLKIVSINV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +++ EI+    +  +PT++LFK G  +  ++ GA S+S + ++I   
Sbjct: 61  DDAPEIAAEQGVRGVPTVMLFKSGAKVASLV-GAQSKSQLTQFIDQN 106


>gi|297830110|ref|XP_002882937.1| hypothetical protein ARALYDRAFT_897824 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297328777|gb|EFH59196.1| hypothetical protein ARALYDRAFT_897824 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 192

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              +    + ++VLE   PV+V+FWA WC PC  + PI+D +A + A K K  K++ +ES
Sbjct: 87  VPNLSDSEWQTQVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 146

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + RY I S+PT+I+FKDG+  D ++ GA  +  + + I   +
Sbjct: 147 PNTANRYGIRSVPTVIIFKDGEKKDSII-GAVPRETLEKTIERFL 190


>gi|168007903|ref|XP_001756647.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162692243|gb|EDQ78601.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 186

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+ +++   VLE + PV+VDFWA WC PC  ++P+ID++A + A K+K  KL+ +ES  I
Sbjct: 84  VNEETWKELVLESTIPVLVDFWAPWCGPCRMIAPLIDELAKQYAGKIKCLKLNTDESPGI 143

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT++LFK+G+  D ++ GA  +S +   +   +
Sbjct: 144 ATEYGIRSIPTVMLFKNGEKKDTVI-GAVPKSTLATTVEKYI 184


>gi|83594762|ref|YP_428514.1| thioredoxin [Rhodospirillum rubrum ATCC 11170]
 gi|83577676|gb|ABC24227.1| Thioredoxin [Rhodospirillum rubrum ATCC 11170]
          Length = 104

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +V   SF+ +VL+   PV+VDFWA WC PC +++P ++++A  L DKV + K++I+E+ +
Sbjct: 3   QVSDASFEEDVLKADGPVLVDFWAEWCGPCRQIAPALEELATALGDKVTVAKINIDENPQ 62

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++Y +  IPTL++FKDG+V    + GA  ++ + EW+ + V
Sbjct: 63  TPSKYGVRGIPTLMIFKDGQVAATKI-GALPKTKLFEWVEASV 104


>gi|225574123|ref|ZP_03782734.1| hypothetical protein RUMHYD_02188 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038674|gb|EEG48920.1| hypothetical protein RUMHYD_02188 [Blautia hydrogenotrophica DSM
           10507]
          Length = 110

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + +   +F  EV+    PV++DFWA WC PC +++PII++I++E    +K+ K++++
Sbjct: 1   MSIINIHKSNFQREVMNSDKPVLLDFWAPWCGPCRRVTPIIEEISNE-RSDIKVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++  + I SIPTL+  K+G+V+ + + GA  ++ I+E + 
Sbjct: 60  EEPELAGEFGIMSIPTLVTVKNGQVVGQTV-GARPKNMILEMLQ 102


>gi|148241837|ref|YP_001226994.1| thioredoxin [Synechococcus sp. RCC307]
 gi|147850147|emb|CAK27641.1| Thioredoxin [Synechococcus sp. RCC307]
          Length = 107

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SFD +VL+C  PV+VDFWA WC PC  ++PI+D+IA E   ++K+ KL+ +E+  +
Sbjct: 7   VTDASFDQDVLQCDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFEGRIKVVKLNTDENPNV 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 67  ASQYGIRSIPTLMVFKGGQKVDTVV-GAVPKTTLASTISKYL 107


>gi|49257111|dbj|BAD24713.1| protein disufide isomerase-like protein [Glycine max]
          Length = 364

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELA--DKVKITKLDIE 60
            + +  ++F+  VL+ +  V+V+F+A WC  C  L+P  + +A      + V I  LD +
Sbjct: 148 VVVLTPENFNEVVLDEAKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEEDVVIANLDAD 207

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 208 KYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEK 253



 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 30  VVVLSEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVLIGKVDCD 88

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PT+  F  G +  +   G  +   ++E++ 
Sbjct: 89  EHKSLCSKYGVSGYPTIQWFPKGSLEAKKYEGPRTAESLVEFVN 132


>gi|464884|sp|P33791|THIO_STRAU RecName: Full=Thioredoxin; Short=Trx
 gi|939972|emb|CAA51317.1| thioredoxin [Streptomyces aureofaciens]
          Length = 106

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KV   +F S+VLE   PV+V F   WC PC  ++P++D+IA+E   KVK+ K++ +E
Sbjct: 2   ATVKVTNATFKSDVLESDKPVLVHFEGPWCGPCKMVAPVLDEIANEYEGKVKVAKVNTDE 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +++++Y + SIPT ++FK G+V   M+ GA+ ++ +  ++ + +
Sbjct: 62  NPQLASQYGVRSIPTRLMFKGGEVAANMV-GAAPKTRLAAFLDASL 106


>gi|114561647|ref|YP_749160.1| thioredoxin [Shewanella frigidimarina NCIMB 400]
 gi|114332940|gb|ABI70322.1| thioredoxin [Shewanella frigidimarina NCIMB 400]
          Length = 108

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+   PV+VDFWA WC PC  ++PI++D+A+E A K+ + KL+
Sbjct: 1   MSDKIVYLSDDSFENDVLKSETPVLVDFWAEWCGPCKMIAPILNDVAEEYAGKLTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL++FK G+++   + GA S++ + E+I +++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLMFKGGELVATKV-GALSKTQLKEFIDAKI 108


>gi|288932581|ref|YP_003436641.1| thioredoxin [Ferroglobus placidus DSM 10642]
 gi|288894829|gb|ADC66366.1| thioredoxin [Ferroglobus placidus DSM 10642]
          Length = 139

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++V++ +FD E+L+    VVVDFWA WC PC  ++PII+ +A E A KV   KL+ +E+ 
Sbjct: 38  IEVNSSNFD-EILKKYENVVVDFWAEWCMPCRMIAPIIEQLAKEYAGKVVFAKLNTDENP 96

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+ RY I+ IPTLI FK+GK +D+++ GA  + +I  WI   +
Sbjct: 97  QIAARYGITGIPTLIFFKNGKPVDKII-GAYPKGEIERWIKRNL 139


>gi|255626027|gb|ACU13358.1| unknown [Glycine max]
          Length = 181

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   S+++ V+    PV+V+FWA WC PC  ++P ID++A E A K+   KL+ ++S
Sbjct: 76  VKVVTDSSWNNLVIASETPVLVEFWAPWCGPCRMIAPAIDELAKEYAGKIACFKLNTDDS 135

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T+Y I SIPT++ FK+G+  + ++ GA  +S +   +   V
Sbjct: 136 PNIATQYGIRSIPTVLFFKNGEKKESII-GAVPKSTLSATVEKYV 179


>gi|239636359|ref|ZP_04677361.1| thioredoxin [Staphylococcus warneri L37603]
 gi|239597714|gb|EEQ80209.1| thioredoxin [Staphylococcus warneri L37603]
 gi|330685724|gb|EGG97360.1| thioredoxin [Staphylococcus epidermidis VCU121]
          Length = 104

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV    FDS++       +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MAIVKVTDSDFDSKIESGVK--LVDFWATWCGPCKMIAPVLEELAGDYEGKADILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 59  ENPSTAAKYEVMSIPTLIVFKDGQPVDKVV-GFQPKENLAEVLDKHL 104


>gi|119713321|gb|ABL97385.1| thioredoxin [uncultured marine bacterium EB80_02D08]
          Length = 108

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MS-ALKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS  +++ D ++F+++VL    PV+VDFWA WC PC +L+P + ++A E ++ +K+ K+D
Sbjct: 1   MSNVIEIRDEENFNNDVLNSEMPVLVDFWAEWCGPCKQLAPTVAEVASEKSETIKVCKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + EI+ +Y I SIP+LI+FK+G+     + GA ++  + ++I + +
Sbjct: 61  VDSNREIAAKYGIRSIPSLIIFKNGEPAGVEV-GALTKQQLEDFINTTI 108


>gi|148655953|ref|YP_001276158.1| thioredoxin [Roseiflexus sp. RS-1]
 gi|148568063|gb|ABQ90208.1| thioredoxin [Roseiflexus sp. RS-1]
          Length = 293

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           S + V+ ++F +EVLE S   PVVVDFWA WC PC  L PI++ +A E      + KL++
Sbjct: 11  SVIDVNERTFRAEVLERSRTVPVVVDFWAPWCGPCRVLGPILERLAAEAKGAWILAKLNV 70

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           +E+  ++  +Q+  IP +  F+DG+V+D    GA  +S +  W+ 
Sbjct: 71  DENPRLAQMFQVQGIPAVKAFRDGRVVDEF-TGALPESQVRAWLK 114


>gi|74316054|ref|YP_313794.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
 gi|74055549|gb|AAZ95989.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
          Length = 108

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SF+ EVL+   PV+VD+WA WC PC  +SPI+D++A E A K+K+ KL+
Sbjct: 1   MSEHVHYISDDSFEQEVLQAGVPVLVDYWADWCGPCKMISPILDEVAKEYAGKLKVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+     ++ I  IPTL++FK+G V    + GA S+S +  ++ S +
Sbjct: 61  IDENQATPPKFGIRGIPTLMIFKNGNVEATKV-GALSKSQLTAFVDSNI 108


>gi|195637554|gb|ACG38245.1| PDIL2-2 - Zea mays protein disulfide isomerase
          Length = 367

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDI--ADELADKVKITKLDI 59
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+P  + +    +L + V I  LD 
Sbjct: 150 SVVVLTPETFDSIVLDETKDVLVEFYAPWCGHCKSLAPTYEKVASVFKLDEGVVIANLDA 209

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++  +++ +Y +S  PTL  F  G        G     D +++I  +
Sbjct: 210 DKHRDLAEKYGVSGFPTLKFFPKGNKAGEDYDGDRDLVDFVKFINEK 256



 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV       +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 33  VVALTESTFEKEV-GKDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIAKVDCD 91

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ 
Sbjct: 92  EHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEFLN 135


>gi|226311260|ref|YP_002771154.1| thioredoxin [Brevibacillus brevis NBRC 100599]
 gi|226094208|dbj|BAH42650.1| thioredoxin [Brevibacillus brevis NBRC 100599]
          Length = 105

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +    ++F  EV E    V+VDFWA WC PC  ++P+++ I  E+  ++KI K++++
Sbjct: 1   MAIVNATDQNFSQEV-EQGGTVLVDFWAPWCGPCKMIAPVLEQIDGEVGSQLKIVKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + + R+ + SIPTLI+FKDG+ +D+++ G   +  ++  +   +
Sbjct: 60  DNPDSAGRFGVMSIPTLIVFKDGQPVDKVI-GFQPKEALMATVGKHL 105


>gi|224476252|ref|YP_002633858.1| putative thioredoxin TrxA [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|222420859|emb|CAL27673.1| putative thioredoxin TrxA [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 104

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +FD +V +     +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MALVKVTDSNFDEKVQDGVK--LVDFWATWCGPCKMIAPVLEELAQDFEGKADILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + ++++ SIPTLI+FKDGK +D+++ G   + ++ E +   +
Sbjct: 59  ENPNTAAKFEVMSIPTLIVFKDGKPVDKVV-GFQPKENLAEVLNKHL 104


>gi|271970310|ref|YP_003344506.1| thioredoxin [Streptosporangium roseum DSM 43021]
 gi|270513485|gb|ACZ91763.1| thioredoxin [Streptosporangium roseum DSM 43021]
          Length = 106

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + +  ++F  +VL+   PV+VDFWA WC PC  ++PI++ I  E  D+V I KL+ +
Sbjct: 1   MIMITLTAENFAEQVLQSDKPVLVDFWAEWCPPCRMIAPILEQIEAEHGDRVTIAKLNYD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E  EI+ RY +  +PTL L+K G+V+ +++ GA  +  ++  +   +
Sbjct: 61  EHQEIAARYGVMGLPTLNLYKGGEVVQQIV-GAKPKRMLLADLEDHI 106


>gi|315181759|gb|ADT88672.1| thioredoxin [Vibrio furnissii NCTC 11218]
          Length = 144

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +FD+ +L+ S PVVVDFWA WC PCV  +PI  D+A+    +V+  K+D E 
Sbjct: 39  APIEGTEANFDA-LLQSSQPVVVDFWAPWCNPCVGFAPIFSDVAEARKGQVRFVKIDTES 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++ ++QI SIPT+++FK+G+ +D M+ GA  +S   +W+   +
Sbjct: 98  QQNLAAKFQIRSIPTIMVFKNGQRVD-MINGALPKSQFDQWLNQAL 142


>gi|165924245|ref|ZP_02220077.1| thioredoxin [Coxiella burnetii RSA 334]
 gi|165916309|gb|EDR34913.1| thioredoxin [Coxiella burnetii RSA 334]
          Length = 108

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/101 (39%), Positives = 76/101 (75%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F++EVL+   PV+VDFWA WC+PC  +SP++++IA E A +VK+ KL+++E+++  
Sbjct: 5   SDENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLNVDENAQTP 64

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           T+Y +  IP+L++F++G+V+DR + GA ++S +  ++  R+
Sbjct: 65  TKYGVRGIPSLLIFREGEVVDRKV-GALNKSQLAAFLDERL 104


>gi|288940437|ref|YP_003442677.1| thioredoxin [Allochromatium vinosum DSM 180]
 gi|288895809|gb|ADC61645.1| thioredoxin [Allochromatium vinosum DSM 180]
          Length = 287

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 66/113 (58%), Gaps = 7/113 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS     + V   +F + V+E S   PV+VDFWA WC PC  L P++  +A++   +  +
Sbjct: 1   MSHSPHVVTVTAANFHAVVIEGSYERPVLVDFWADWCAPCRMLMPMLAKLAEQYGGRFLL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            K+D E    ++ ++ I S+PT+ LF++G+V+D+ M GA  +  + E++   +
Sbjct: 61  AKVDTEAEQALAAQFGIRSLPTVQLFRNGQVVDQFM-GALPEPQVREFLDRHL 112


>gi|228471874|ref|ZP_04056645.1| thioredoxin [Capnocytophaga gingivalis ATCC 33624]
 gi|228276804|gb|EEK15507.1| thioredoxin [Capnocytophaga gingivalis ATCC 33624]
          Length = 105

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   SF+  VL+   PV+VDFWA+WC PC  L P+I++IA E   +V + K+D++
Sbjct: 1   MA-LQITDASFEEVVLKSDKPVLVDFWATWCGPCRMLGPVIEEIATEYEGRVVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++F++G+V+ R + G + ++   E + S +
Sbjct: 60  SNQEYAAKYGVRNIPTVLVFQNGEVVGRQV-GVAPKNTYTEALDSLL 105


>gi|167749012|ref|ZP_02421139.1| hypothetical protein ANACAC_03793 [Anaerostipes caccae DSM 14662]
 gi|167651634|gb|EDR95763.1| hypothetical protein ANACAC_03793 [Anaerostipes caccae DSM 14662]
          Length = 106

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + +  ++F SEVLE   P++VDFWA WC  C ++SP +D I ++  D V+I K++I+
Sbjct: 1   MSIINITKENFQSEVLEAKKPILVDFWAPWCGYCRRISPALDQIGEDREDSVQIGKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E  E++ R+ + +IPT+ILFKDGK     +  A ++  I +W+  +
Sbjct: 61  EQMELAERFGVMTIPTMILFKDGK-AGEPLVAAQTRDQIEQWMQEQ 105


>gi|226356862|ref|YP_002786602.1| Thioredoxin [Deinococcus deserti VCD115]
          Length = 121

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  +++   +F SE+ +     +VDFWA WC PC  ++P+I+++A +   +VKI K++++
Sbjct: 13  MKPVELTDTNFTSEIEQ--GLTLVDFWAPWCGPCRIIAPVIEELAGQYEGRVKIGKVNVD 70

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++     +Y++ SIPTLILFKDG+ ++ ++ GA  +      +   +
Sbjct: 71  DNPVTQGQYRVMSIPTLILFKDGQPVEGVV-GAQPKRAFESLLDKHL 116


>gi|194333752|ref|YP_002015612.1| thioredoxin [Prosthecochloris aestuarii DSM 271]
 gi|194311570|gb|ACF45965.1| thioredoxin [Prosthecochloris aestuarii DSM 271]
          Length = 108

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 39/101 (38%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F +EVL+     +VDFWA+WC PC  L P+I+D+A +   K  I K++++E+  I+
Sbjct: 8   TDQNFKAEVLDSGKVALVDFWAAWCGPCQMLGPVIEDLAGDYEGKAVIAKVNVDENPNIA 67

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             Y I SIPT+++FK+G+++D+M+ GA  ++ I E I +++
Sbjct: 68  AEYGIRSIPTMLIFKNGEIVDQMV-GAMPKNMIAEKIDAQL 107


>gi|258545112|ref|ZP_05705346.1| thioredoxin-1 [Cardiobacterium hominis ATCC 15826]
 gi|258519631|gb|EEV88490.1| thioredoxin-1 [Cardiobacterium hominis ATCC 15826]
          Length = 107

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 76/108 (70%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + V   +F +EV+  + PV+VDFWA+WC PC  ++P ++ +A E   K+KI K+D+
Sbjct: 1   MSKPIAVGEANFHAEVIASAVPVLVDFWATWCGPCKAIAPELEALAAETEGKLKIVKVDV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +++++ +Y I SIPTL+LFK+G+++D  + G +S+ D++ ++ S +
Sbjct: 61  DANNDLAAQYGIRSIPTLLLFKNGELVDNHI-GLASKQDLLNFVQSHI 107


>gi|309780914|ref|ZP_07675653.1| thioredoxin [Ralstonia sp. 5_7_47FAA]
 gi|308920217|gb|EFP65875.1| thioredoxin [Ralstonia sp. 5_7_47FAA]
          Length = 281

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 66/106 (62%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +++F  EV+E S   PV+VDFWA WC PC  L P+++ +  E A K K+ K++
Sbjct: 1   MS--DITSQNFAQEVVETSRQIPVLVDFWAPWCGPCRTLGPMLEKLEAEYAGKWKLAKIN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            +E+ E+S ++ + SIP ++ F DGK +D+ + G   ++ +  ++ 
Sbjct: 59  SDENPELSAQFHVRSIPYVVAFVDGKPVDQFV-GVLPEAQLRAFLD 103


>gi|218294650|ref|ZP_03495504.1| thioredoxin [Thermus aquaticus Y51MC23]
 gi|218244558|gb|EED11082.1| thioredoxin [Thermus aquaticus Y51MC23]
          Length = 110

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  ++V   +F+ E L     V+VDFWA WC PC  ++P+++++A E   K+ + KLD+
Sbjct: 1   MAKPVEVTDANFE-EALRNHPLVLVDFWAEWCAPCRMIAPVLEELAQEYEGKLLVAKLDV 59

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ + + RY++ SIPT+ILFK+G+ ++ ++ GA  + +    I   +
Sbjct: 60  DENPKTAMRYRVMSIPTVILFKNGQPVEVLV-GAQPKRNFQAKIEKHL 106


>gi|241662409|ref|YP_002980769.1| thioredoxin [Ralstonia pickettii 12D]
 gi|240864436|gb|ACS62097.1| thioredoxin [Ralstonia pickettii 12D]
          Length = 281

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 66/106 (62%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +++F  EV+E S   PV+VDFWA WC PC  L P+++ +  E A K K+ K++
Sbjct: 1   MS--DITSQNFAQEVVETSRQIPVLVDFWAPWCGPCRTLGPMLEKLEAEYAGKWKLAKIN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            +E+ E+S ++ + SIP ++ F DGK +D+ + G   ++ +  ++ 
Sbjct: 59  SDENPELSAQFHVRSIPYVVAFVDGKPVDQFV-GVLPEAQLRAFLD 103


>gi|2507458|sp|P07591|TRXM_SPIOL RecName: Full=Thioredoxin M-type, chloroplastic; Short=Trx-M;
           Contains: RecName: Full=Thioredoxin M-type Mc; Contains:
           RecName: Full=Thioredoxin M-type Md; Flags: Precursor
 gi|21348|emb|CAA35826.1| unnamed protein product [Spinacia oleracea]
          Length = 181

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V+  S+   VLE   PV+VDFWA WC PC  ++P+ID++A E + K+ + KL+ +E+
Sbjct: 76  VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEA 135

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T+Y I SIPT++ FK+G+  + ++ GA  +S + + I   +
Sbjct: 136 PGIATQYNIRSIPTVLFFKNGERKESII-GAVPKSTLTDSIEKYL 179


>gi|315022288|gb|EFT35316.1| Thioredoxin [Riemerella anatipestifer RA-YM]
          Length = 105

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F   V+    PV+VDFWA WC PC  L PI++++A++   K  + KLD++
Sbjct: 1   MA-LEITDSNFKEVVINSDKPVLVDFWAVWCGPCRMLGPIVEELANDFEGKAVVGKLDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +++  Y I +IPT+++FK+G+V+D+++ G S +  I E + + +
Sbjct: 60  NNQQVAMEYGIRNIPTVLIFKNGEVVDKLV-GVSPKEVIAEKLSAHL 105


>gi|301165632|emb|CBW25203.1| thioredoxin [Bacteriovorax marinus SJ]
          Length = 107

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 69/106 (65%), Gaps = 2/106 (1%)

Query: 1   MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS + K D  SFD++V+    PV+VDFWA WC PC  L+P++D++A E+ +  KI K+++
Sbjct: 1   MSNVGKTDQASFDTDVINSDKPVLVDFWAEWCGPCRTLAPVLDEVAGEVGENAKILKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +E+ +++ +Y I  IPT+I FK+G+    ++ G   + +I + +  
Sbjct: 61  DENGDLAQKYGIRGIPTMIFFKNGEPAKTLV-GLQGKDEIKKTLEE 105


>gi|239827960|ref|YP_002950584.1| thioredoxin [Geobacillus sp. WCH70]
 gi|239808253|gb|ACS25318.1| thioredoxin [Geobacillus sp. WCH70]
          Length = 104

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +    ++F +E  E     +VDFWA WC PC  ++P+++++   + DKVKI K++++
Sbjct: 1   MAIVNATDQTFAAETKE--GLTLVDFWAPWCGPCRMVAPVLEEVDQVMGDKVKIVKVNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E ++++ + SIPTL++FK+G+++D+ + G   +  +++ +   V
Sbjct: 59  ENPETASKFGVMSIPTLLVFKNGELVDKTI-GYQPKEALVQLLEKHV 104


>gi|27467756|ref|NP_764393.1| thioredoxin [Staphylococcus epidermidis ATCC 12228]
 gi|57866655|ref|YP_188311.1| thioredoxin [Staphylococcus epidermidis RP62A]
 gi|242242445|ref|ZP_04796890.1| thioredoxin [Staphylococcus epidermidis W23144]
 gi|251810593|ref|ZP_04825066.1| thioredoxin [Staphylococcus epidermidis BCM-HMP0060]
 gi|282876407|ref|ZP_06285274.1| thioredoxin [Staphylococcus epidermidis SK135]
 gi|293366873|ref|ZP_06613549.1| thioredoxin-1 [Staphylococcus epidermidis M23864:W2(grey)]
 gi|38605279|sp|Q8CPL5|THIO_STAES RecName: Full=Thioredoxin; Short=Trx
 gi|81819414|sp|Q5HQ29|THIO_STAEQ RecName: Full=Thioredoxin; Short=Trx
 gi|27315300|gb|AAO04435.1|AE016746_225 thioredoxin [Staphylococcus epidermidis ATCC 12228]
 gi|57637313|gb|AAW54101.1| thioredoxin [Staphylococcus epidermidis RP62A]
 gi|242234095|gb|EES36407.1| thioredoxin [Staphylococcus epidermidis W23144]
 gi|251805753|gb|EES58410.1| thioredoxin [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295432|gb|EFA87959.1| thioredoxin [Staphylococcus epidermidis SK135]
 gi|291319174|gb|EFE59544.1| thioredoxin-1 [Staphylococcus epidermidis M23864:W2(grey)]
 gi|319401541|gb|EFV89751.1| thioredoxin [Staphylococcus epidermidis FRI909]
 gi|329730004|gb|EGG66395.1| thioredoxin [Staphylococcus epidermidis VCU144]
 gi|329734439|gb|EGG70752.1| thioredoxin [Staphylococcus epidermidis VCU045]
 gi|329736342|gb|EGG72614.1| thioredoxin [Staphylococcus epidermidis VCU028]
          Length = 104

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV    FDS++       +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MAIVKVTDSDFDSKIESGVK--LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 59  ENPSTAAKYEVMSIPTLIVFKDGEPVDKVV-GFQPKENLAEVLDKHL 104


>gi|126172680|ref|YP_001048829.1| thioredoxin [Shewanella baltica OS155]
 gi|125995885|gb|ABN59960.1| thioredoxin [Shewanella baltica OS155]
          Length = 170

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++ + +F +   +   P+VVDFWASWC PC   +P+    A     + +  K++ EE
Sbjct: 66  APIELTSANFANHANKSELPLVVDFWASWCGPCKSFAPVFSAAAKTWEPQFRFGKINTEE 125

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
              ++ ++ I SIPTL++FK GK++ +   GA  QS + +W+ S 
Sbjct: 126 QQALAAQFNIRSIPTLMIFKQGKILAQ-QAGALPQSALNQWLKSH 169


>gi|153813840|ref|ZP_01966508.1| hypothetical protein RUMTOR_00046 [Ruminococcus torques ATCC 27756]
 gi|317501976|ref|ZP_07960160.1| thioredoxin [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088208|ref|ZP_08337127.1| thioredoxin [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145848236|gb|EDK25154.1| hypothetical protein RUMTOR_00046 [Ruminococcus torques ATCC 27756]
 gi|316896656|gb|EFV18743.1| thioredoxin [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330408452|gb|EGG87918.1| thioredoxin [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 102

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 38/104 (36%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+ T +FD EVL+   PV+VDF+A WC PC  + P++++I+ EL D       +I+
Sbjct: 1   MAVVKLTTANFDQEVLQADRPVLVDFYADWCGPCKMMGPVVEEISGELDDVKVCKI-NID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++ RY + SIPT I FK+G++  + + GA  +  + + + 
Sbjct: 60  EEMEVAQRYGVMSIPTFIAFKNGEMTGKQV-GAVPKGALADLVK 102


>gi|34112934|gb|AAQ62379.1| predicted thiol-disulfide isomerase/thioredoxin [uncultured marine
           gamma proteobacterium EBAC31A08]
          Length = 108

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 73/105 (69%), Gaps = 3/105 (2%)

Query: 1   MS-ALKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS  +++ D +SF+S+VL    PV+VDFWA WC PC +L+P ++ +A E ++ +K+ K+D
Sbjct: 1   MSNVIEIRDEESFNSDVLNSEKPVLVDFWAEWCGPCKQLAPTVETVAAEKSETLKVCKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ++ + EI+ +Y I SIP+LI+FK+G+     + GA ++  + ++I
Sbjct: 61  VDSNREIAAKYGIRSIPSLIIFKNGEPAGVEV-GALTKQQLEDFI 104


>gi|167757999|ref|ZP_02430126.1| hypothetical protein CLOSCI_00336 [Clostridium scindens ATCC 35704]
 gi|167664431|gb|EDS08561.1| hypothetical protein CLOSCI_00336 [Clostridium scindens ATCC 35704]
          Length = 109

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A  +  ++F+ EVL+   PV+VDFWA+WC PC  + PII+++A E     KI K++++
Sbjct: 8   MAATHLTKETFNEEVLQAKEPVLVDFWATWCGPCQMVLPIIEELAGE-VKDAKICKVNVD 66

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++  Y++ SIPTL++F+DGK + R + GA S+++I+E + 
Sbjct: 67  EQPELAKEYRVMSIPTLMVFRDGKPVKREV-GAKSKAEILEMLK 109


>gi|323489942|ref|ZP_08095163.1| thioredoxin [Planococcus donghaensis MPA1U2]
 gi|323396238|gb|EGA89063.1| thioredoxin [Planococcus donghaensis MPA1U2]
          Length = 104

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +    ++F  EV      V+VDFWA+WC PC  ++P+++++  E++DKVKI K+D++
Sbjct: 1   MAIVHGTDQNFSQEV--SEGLVLVDFWATWCGPCKMIAPVLEELDAEMSDKVKIVKVDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ E +  Y I SIPTL+L KDG+ +D+++ G   +  + E +   
Sbjct: 59  QNQETAGNYGIMSIPTLLLMKDGETVDKVV-GFRPKEALAELVEKH 103


>gi|254496686|ref|ZP_05109549.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354114|gb|EET12786.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 108

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     +   SFD +V+  + PV+VDFWA WC PC  L+PI++++A     +V   K++
Sbjct: 1   MSDHIKTITDASFDQDVINANKPVLVDFWAEWCGPCRALTPILEEVAATHGAEVTFAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           I+E+ +   ++ + SIPTLILFK+G+ ++ +  G  S+S +  ++ S 
Sbjct: 61  IDENPQAPAKFGVMSIPTLILFKNGQ-VEAVKMGLLSKSQLSAFVESH 107


>gi|89214056|gb|ABD64368.1| thioredoxin [Pseudomonas chlororaphis]
          Length = 109

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   SF+++VL+    V+VD+WA WC PC  ++P++D+IA+    K+ + KL
Sbjct: 1   MSSDLIKHVSDASFEADVLKAEGAVLVDYWAEWCGPCKMIAPVVDEIAETYKGKLTVAKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 61  NIDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 109


>gi|86134260|ref|ZP_01052842.1| thioredoxin [Polaribacter sp. MED152]
 gi|85821123|gb|EAQ42270.1| thioredoxin [Polaribacter sp. MED152]
          Length = 105

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +FD  VL+   PV+VDFWA+WC PC  + PI+D+I  E   K  + K+D++
Sbjct: 1   MA-LEITDATFDEVVLQSDKPVLVDFWAAWCGPCRMVGPIVDEIHAEYDGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++FK+G+V+D+ + G + +    + I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFKNGEVVDKQV-GVAPKKTYTDKIDAAL 105


>gi|78049511|ref|YP_365686.1| thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|294626525|ref|ZP_06705124.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|294665092|ref|ZP_06730396.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|325920133|ref|ZP_08182097.1| thioredoxin [Xanthomonas gardneri ATCC 19865]
 gi|325928805|ref|ZP_08189972.1| thioredoxin [Xanthomonas perforans 91-118]
 gi|78037941|emb|CAJ25686.1| thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|292599215|gb|EFF43353.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292605134|gb|EFF48481.1| thioredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|325540778|gb|EGD12353.1| thioredoxin [Xanthomonas perforans 91-118]
 gi|325549384|gb|EGD20274.1| thioredoxin [Xanthomonas gardneri ATCC 19865]
          Length = 113

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++
Sbjct: 1   MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  ++ +Y + SIP L+LFKDG+V    + GA  +  + + I   +
Sbjct: 61  VDQNRALAIKYHVRSIPMLLLFKDGQVQATQI-GAVGKGQLTQMIDKTL 108


>gi|242076576|ref|XP_002448224.1| hypothetical protein SORBIDRAFT_06g023440 [Sorghum bicolor]
 gi|241939407|gb|EES12552.1| hypothetical protein SORBIDRAFT_06g023440 [Sorghum bicolor]
          Length = 186

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S V+E   PV+V+FWASWC PC  + P++  ++ +   K++  KL+ +E+
Sbjct: 81  VPDVTKSTWQSLVIESELPVLVEFWASWCGPCKMIDPVVGKLSKDYEGKLRCYKLNTDEN 140

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I+++Y + SIPTL++ K+G+     + GA  +S ++  I   V
Sbjct: 141 PDIASQYGVRSIPTLMILKNGEK-KESVIGAVPESTLVTCIEKFV 184


>gi|225182135|ref|ZP_03735561.1| thioredoxin [Dethiobacter alkaliphilus AHT 1]
 gi|225167178|gb|EEG76003.1| thioredoxin [Dethiobacter alkaliphilus AHT 1]
          Length = 109

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L+V   +F  EVL+ + PVVVDFWA+WC PC  ++P+++++A ++  KVKI K++
Sbjct: 1   MSDYVLEVSDANFADEVLKANVPVVVDFWAAWCGPCRMMAPVLEEVARDMDGKVKIVKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++   +  Y+I SIPTL+ FK G+ +D  + G   +  + + I   +
Sbjct: 61  VDKNRTTAGNYKIMSIPTLMFFKGGESVDTQV-GFVPKEQLKKKIDELL 108


>gi|291452656|ref|ZP_06592046.1| thioredoxin/thioredoxin reductase hybrid protein [Streptomyces
           albus J1074]
 gi|291355605|gb|EFE82507.1| thioredoxin/thioredoxin reductase hybrid protein [Streptomyces
           albus J1074]
          Length = 181

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF+ +VL+   PV+VDFWA+WC PC +++P ++ IA E  +++++ KL+I+E+ E 
Sbjct: 75  VTDASFEQDVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHGEQIEVVKLNIDENPET 134

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +Y + SIPTL +++ G  + + + GA  ++ I+  +   +
Sbjct: 135 AAKYGVMSIPTLNVYQGG-EVAKTIVGAKPKAAIVRDLDEFI 175


>gi|171909709|ref|ZP_02925179.1| thioredoxin [Verrucomicrobium spinosum DSM 4136]
          Length = 106

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M A+++ ++SFD  +   S PV+VDF A WC PC  +SP+I+ +A E   +  + K++++
Sbjct: 1   MKAIELSSQSFDRTLASTSQPVLVDFHAEWCGPCRMMSPVIEQVAGEQQGRAVVAKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ++ +++ RY ISSIPTLI+FKD + +   + GA S+S I   I
Sbjct: 61  DAPDLAQRYGISSIPTLIVFKDAQPVAT-VRGAQSKSAIESLI 102


>gi|261363658|ref|ZP_05976541.1| thioredoxin [Neisseria mucosa ATCC 25996]
 gi|288568200|gb|EFC89760.1| thioredoxin [Neisseria mucosa ATCC 25996]
          Length = 110

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL+   PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 1   MSSELIIHTSDANFEQDVLKSDVPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++     ++ +  IPTL++FK+G+ +   + GA ++  +  ++ + +
Sbjct: 61  NIDDNEATPAKFGVRGIPTLMVFKNGENVATKV-GALAKGQLTAFVNASL 109


>gi|289209628|ref|YP_003461694.1| thioredoxin [Thioalkalivibrio sp. K90mix]
 gi|288945259|gb|ADC72958.1| thioredoxin [Thioalkalivibrio sp. K90mix]
          Length = 108

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +      FD +VL+   PV+VD+WA WC PC  ++PI+D+IA+E A KVK+ KL+
Sbjct: 1   MSDKIVYTSDAGFDEDVLKADQPVLVDYWAEWCGPCKMIAPILDEIAEEYAGKVKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+     +Y I  IPTL+LFK+G V    + GA S+S +  ++   +
Sbjct: 61  IDENPSTPPKYGIRGIPTLMLFKNGDVEATKV-GALSKSQLTAFLDQHL 108


>gi|197302900|ref|ZP_03167951.1| hypothetical protein RUMLAC_01628 [Ruminococcus lactaris ATCC
           29176]
 gi|197297981|gb|EDY32530.1| hypothetical protein RUMLAC_01628 [Ruminococcus lactaris ATCC
           29176]
          Length = 102

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS +K+  ++F+ EVL+    V+VDF+A WC PC  +SPI+D+IA+E   ++K+  ++I+
Sbjct: 1   MSVVKLTVENFEQEVLQAEKLVLVDFYADWCGPCKMMSPIVDEIAEE-ESEIKVCNINID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           ++ EI+ +Y++ SIPT I FK+G+   R + GA S+ +++  I 
Sbjct: 60  QAMEIAQKYRVMSIPTFIAFKNGEEAGRQI-GAVSKGELLSLIK 102


>gi|320355042|ref|YP_004196381.1| thioredoxin [Desulfobulbus propionicus DSM 2032]
 gi|320123544|gb|ADW19090.1| thioredoxin [Desulfobulbus propionicus DSM 2032]
          Length = 109

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 67/110 (60%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + +    F+S ++  S P +VDFWA WC PC  + P+ID++A E   KV I K+
Sbjct: 1   MASDKVVHISDSEFESGIIGNSLPCLVDFWAPWCGPCKAIGPVIDELAAEYEGKVVIAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++     ++ I +IPTLILFK G+VID+ + GA  +S + + I   +
Sbjct: 61  NVDDNPATPGKFGIRAIPTLILFKGGEVIDQ-ITGAVGKSQLQDLIKKAI 109


>gi|86141807|ref|ZP_01060331.1| thioredoxin (thioredoxin M) [Leeuwenhoekiella blandensis MED217]
 gi|85831370|gb|EAQ49826.1| thioredoxin (thioredoxin M) [Leeuwenhoekiella blandensis MED217]
          Length = 105

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 67/104 (64%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+   PV+VDFWA+WC PC  + P+I++I+ E   K  + KLD++
Sbjct: 1   MA-LEITDANFEETVLQSDKPVLVDFWAAWCGPCRMVGPVIEEISTEYDGKAVVGKLDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            + E + +Y + +IPT+++FK G+V+ R + G + ++   E I 
Sbjct: 60  ANQEFAAKYGVRNIPTVLMFKGGEVVGRQV-GVAPKNVYTEAID 102


>gi|226362883|ref|YP_002780663.1| thioredoxin [Rhodococcus opacus B4]
 gi|226241370|dbj|BAH51718.1| thioredoxin [Rhodococcus opacus B4]
          Length = 107

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + +   SF  +V+    PV+VDFWA+WC PC  ++P++++IA E +DK+ I KLDI
Sbjct: 1   MSNTVTITDDSFQQDVISSDKPVLVDFWATWCGPCKMIAPVLEEIAGEHSDKLTIAKLDI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +   +  +Q+ SIPTLILFKDGK I+ ++ G   ++ +++ +
Sbjct: 61  DANPGAARDFQVMSIPTLILFKDGKPINTIV-GTKGKAALLKEL 103


>gi|257785118|ref|YP_003180335.1| thioredoxin [Atopobium parvulum DSM 20469]
 gi|257473625|gb|ACV51744.1| thioredoxin [Atopobium parvulum DSM 20469]
          Length = 105

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  ++ T  FDS +     PV+VDFWASWC PC  L P+++++ +E+ADK+ + K++++
Sbjct: 1   MA-QQLTTAEFDSVLANADKPVLVDFWASWCGPCRALGPVVEEVGNEMADKLDVYKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + ++++TR++I SIPTLILFK+G+ +  M+ G   ++D++  + + +
Sbjct: 60  DEADLATRFRIVSIPTLILFKNGEPVHTMV-GNLPKADLVSELNANL 105


>gi|331085315|ref|ZP_08334401.1| thioredoxin [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330408098|gb|EGG87588.1| thioredoxin [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 103

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 76/103 (73%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+++ +++F  EVLE   PV+VDFWA WC PC  + PII+++A+E    VKI K++++
Sbjct: 1   MAAIQLTSETFQKEVLEAKEPVLVDFWAPWCGPCQMVLPIIEELAEE-VTDVKICKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  +I+  Y++ SIPTLILFKDGK++ + + GA ++ +++E I
Sbjct: 60  EQMKIAKEYRVMSIPTLILFKDGKIVKQDL-GAKTKEELLEMI 101


>gi|289664842|ref|ZP_06486423.1| thioredoxin [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289671092|ref|ZP_06492167.1| thioredoxin [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 113

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++
Sbjct: 1   MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  ++ +Y + SIP L+LFKDG+V    + GA  +  + + I   +
Sbjct: 61  VDQNRALAIKYHVRSIPMLLLFKDGEVQATQI-GAVGKGQLTQMIDKTL 108


>gi|300779339|ref|ZP_07089197.1| thioredoxin [Chryseobacterium gleum ATCC 35910]
 gi|300504849|gb|EFK35989.1| thioredoxin [Chryseobacterium gleum ATCC 35910]
          Length = 132

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   SF   VL+   PV+VDFWA WC PC  L PII+++A +   K  + K+D++
Sbjct: 28  MA-LEITDSSFQDTVLKSDKPVLVDFWAVWCGPCRTLGPIIEEVASDFEGKAVVGKVDVD 86

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + EIS +Y I +IPT+++FK+G+V+D+++ G + +  I E + + +
Sbjct: 87  NNQEISMQYGIRNIPTVLIFKNGEVVDKLV-GVAPKEVIAEKLSAHL 132


>gi|45657831|ref|YP_001917.1| thioredoxin [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|45601071|gb|AAS70554.1| thioredoxin [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 104

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 69/106 (65%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V+  +F SE       V++D WA WC PC  ++P++++++ EL   VKI KL+++
Sbjct: 1   MALAEVNDTNFKSET--SGGLVLIDCWAEWCGPCRMVAPVLEELSGELDGLVKIKKLNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ + +    ISSIPTL+L+KDG+++D+++ GA  ++ I  +I   
Sbjct: 59  DNQDTAQSLGISSIPTLLLYKDGQLVDKVI-GALPKAQIKNFIERH 103


>gi|329891018|ref|ZP_08269361.1| thioredoxin [Brevundimonas diminuta ATCC 11568]
 gi|328846319|gb|EGF95883.1| thioredoxin [Brevundimonas diminuta ATCC 11568]
          Length = 110

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SFD++VL+ S PV+VDFWA WC PC ++ P ++ IADELA KV + K++I+
Sbjct: 1   MATVKVTDDSFDADVLKSSTPVLVDFWAEWCGPCKQIGPALEQIADELAGKVTVAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +S  + ++  +  IPTL+LFKDG++    + GA  +  I+EW+   
Sbjct: 61  DSPMVPSKMGVKGIPTLMLFKDGQMTSMKV-GAMPKGKIVEWLAEA 105


>gi|223975165|gb|ACN31770.1| unknown [Zea mays]
          Length = 173

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S V+E   PV+V+FWASWC PC  + PI+  ++ E   K+K  KL+ +E+
Sbjct: 67  VPDVSKSTWQSLVVESELPVLVEFWASWCGPCKMIDPIVGKLSKEYEGKLKCYKLNTDEN 126

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I+T++ I SIPT+++FK+G+  D ++ GA  +S ++  I   V
Sbjct: 127 PDIATQFGIRSIPTMMIFKNGEKKDSVI-GAVPESTLVTCIDKYV 170


>gi|295399450|ref|ZP_06809432.1| thioredoxin [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109991|ref|YP_003988307.1| thioredoxin [Geobacillus sp. Y4.1MC1]
 gi|294978916|gb|EFG54512.1| thioredoxin [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215092|gb|ADP73696.1| thioredoxin [Geobacillus sp. Y4.1MC1]
          Length = 104

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 71/107 (66%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +    ++F SE  E     +VDFWA WC PC  ++P+++++  EL DKVKI K++++
Sbjct: 1   MAIVNATDQTFASETKE--GLTLVDFWAPWCGPCRMVAPVLEEVDKELGDKVKIVKVNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E ++++ + SIPTL++FK+G+++D+ + G   +  +I+ +   V
Sbjct: 59  ENQETASKFGVMSIPTLLVFKNGELVDKTI-GYQPKEALIQLLEKHV 104


>gi|315271299|gb|ACO46848.2| putative Thioredoxin [Deinococcus deserti VCD115]
          Length = 109

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  +++   +F SE+ +     +VDFWA WC PC  ++P+I+++A +   +VKI K++++
Sbjct: 1   MKPVELTDTNFTSEIEQ--GLTLVDFWAPWCGPCRIIAPVIEELAGQYEGRVKIGKVNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++     +Y++ SIPTLILFKDG+ ++ ++ GA  +      +   +
Sbjct: 59  DNPVTQGQYRVMSIPTLILFKDGQPVEGVV-GAQPKRAFESLLDKHL 104


>gi|198284550|ref|YP_002220871.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218666652|ref|YP_002427218.1| thioredoxin, putative [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198249071|gb|ACH84664.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518865|gb|ACK79451.1| thioredoxin, putative [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 289

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/113 (33%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 1   MSA----LKVDTKSFDSEV--LECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           M+     L+V+  +F   V  L     V+VDFWA WC PC  L P+++ +A+E+     +
Sbjct: 1   MAVSGHVLEVNLDNFQEAVVGLSRKVLVLVDFWAPWCAPCRALGPVLEKLAEEMGGAFVL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            K++ +E++++S +YQ+  IP +  FKDGKV+D    GA  +S +  +I   +
Sbjct: 61  AKVNSDENADLSRQYQVRGIPAVKAFKDGKVVDEF-TGALPESAVRRFIEKNL 112


>gi|225026479|ref|ZP_03715671.1| hypothetical protein EUBHAL_00728 [Eubacterium hallii DSM 3353]
 gi|224956167|gb|EEG37376.1| hypothetical protein EUBHAL_00728 [Eubacterium hallii DSM 3353]
          Length = 101

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F +EVL    PV++DFWASWC PC  + PI+++IA E    +K+ K++++
Sbjct: 1   MSAININKNNFQNEVLNSDKPVLLDFWASWCAPCRMVVPIVEEIASE-RRDIKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIV-QQISGARPKNAILEML 101


>gi|111020640|ref|YP_703612.1| thioredoxin [Rhodococcus jostii RHA1]
 gi|110820170|gb|ABG95454.1| thioredoxin [Rhodococcus jostii RHA1]
          Length = 107

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + +   SF  +V+    PV+VDFWA+WC PC  ++P++++IA E ++K+ I KLDI
Sbjct: 1   MSNTVTITDDSFQQDVISSDKPVLVDFWATWCGPCKMIAPVLEEIAGEHSEKLTIAKLDI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + +   +  +Q+ SIPTLILFKDGK I+ ++ G   ++ +++ +
Sbjct: 61  DANPGAARDFQVMSIPTLILFKDGKPINTIV-GTKGKAALLKEL 103


>gi|307103142|gb|EFN51405.1| hypothetical protein CHLNCDRAFT_33111 [Chlorella variabilis]
          Length = 164

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 68/102 (66%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +++  VL+   PV+VDFWA WC PC  ++P++D+IA E  DK++  KL+ +ES  +
Sbjct: 63  VTDSTWEELVLKSPVPVLVDFWAPWCGPCRMIAPLVDEIAAEYGDKLRTLKLNTDESPNV 122

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT+++FK+G+ +D ++ GA  +  +++ +   +
Sbjct: 123 ATEYGIRSIPTVMVFKNGQKMDAVI-GAVPKGTLVQTVEKYM 163


>gi|289706708|ref|ZP_06503056.1| thioredoxin [Micrococcus luteus SK58]
 gi|289556628|gb|EFD49971.1| thioredoxin [Micrococcus luteus SK58]
          Length = 129

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/101 (37%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V    FD +VL+   PV+VDFWA WC PC  L P+++D+A E   K  I KL+++
Sbjct: 23  MSTITVTDADFDQKVLQSELPVLVDFWAEWCGPCRMLGPVLEDMAVEHEGKAVIAKLNVD 82

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           E+  I+ RY ++SIP ++ F++G+ +   + GA  ++ + +
Sbjct: 83  ENPAIAARYGVTSIPLVVGFQNGEKVVESV-GAKPKAALEK 122


>gi|262395383|ref|YP_003287236.1| thioredoxin 2 [Vibrio sp. Ex25]
 gi|262338977|gb|ACY52771.1| thioredoxin 2 [Vibrio sp. Ex25]
          Length = 144

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L+   PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E 
Sbjct: 39  APIEGTQDNF-SVLLQSDTPVVVDFWAPWCNPCVGFAPVFSDVAHEQAGTARFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++ ++ I SIPT+++FK+G+ +D M+ GA  +S   +W+   +
Sbjct: 98  QQALAAQFGIRSIPTIMVFKNGQRVD-MINGALPKSQFDQWLNQAL 142


>gi|221195071|ref|ZP_03568127.1| thioredoxin [Atopobium rimae ATCC 49626]
 gi|221184974|gb|EEE17365.1| thioredoxin [Atopobium rimae ATCC 49626]
          Length = 105

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 73/107 (68%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  ++ T  FDS +     PV+VDFWASWC PC  L P+++ + +E++DK+ + K++++
Sbjct: 1   MA-QQLTTAEFDSVLASADKPVLVDFWASWCGPCRALGPVVEQVGEEMSDKLSVYKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  +++TR++I SIPTLILFK G+ +  M+ G   +SD++  + + +
Sbjct: 60  DEPDLATRFRIVSIPTLILFKGGEPVHTMV-GNLPKSDLVSELTANL 105


>gi|124514173|gb|EAY55688.1| Thioredoxin [Leptospirillum rubarum]
 gi|206602299|gb|EDZ38780.1| Thioredoxin [Leptospirillum sp. Group II '5-way CG']
          Length = 110

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   ++V+   +D  VL     V+VDFWA WC PC  ++PI++++++E   KV   KL+
Sbjct: 1   MAGNVVEVNAPEWDKSVLGAGGLVMVDFWAPWCGPCRTVAPIVEELSEEYKGKVSFMKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +++ EI+ +YQ+  IPTL+ FKDGK++D+++ GA S+ +  + I S +
Sbjct: 61  TDDNQEIAVKYQVMGIPTLMFFKDGKIVDKIV-GAQSKKNFKDKIDSLL 108


>gi|87302139|ref|ZP_01084964.1| Thioredoxin [Synechococcus sp. WH 5701]
 gi|87283064|gb|EAQ75020.1| Thioredoxin [Synechococcus sp. WH 5701]
          Length = 107

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA  V   SF+ +VL+   PV+VDFWA WC PC  ++PI+D+IA E   K+K+ KL+ +E
Sbjct: 3   SATAVTDASFELDVLKSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFEGKLKVYKLNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  ++++Y I SIPTL++FK G+ +D ++ GA  ++ +   I   +
Sbjct: 63  NPNVASQYGIRSIPTLMIFKGGQKVDTVV-GAVPKNTLSGTIAKYL 107


>gi|313115930|ref|ZP_07801357.1| thioredoxin [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310621694|gb|EFQ05222.1| thioredoxin [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 106

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ LK+   +F++E+L    PV++DF+A WC PC  LSP++ ++A+E +  +K+ K++++
Sbjct: 1   MAELKITAANFENEILHSDKPVLLDFYADWCGPCKMLSPVLHELAEEKSGTLKVGKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++ R+Q+SSIP L++FKDGK I + + G   +S+I   + 
Sbjct: 61  EQMELAMRFQVSSIPMLVVFKDGKAITKSV-GYRPKSEIAAMVE 103


>gi|300791153|ref|YP_003771444.1| thioredoxin [Amycolatopsis mediterranei U32]
 gi|299800667|gb|ADJ51042.1| thioredoxin [Amycolatopsis mediterranei U32]
          Length = 107

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 68/102 (66%), Gaps = 2/102 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  +KV   +F  EVL    PV+VDFWA+WC PC  ++P++++IA E  +K+ I K+DI
Sbjct: 1   MANTVKVTDATFVDEVLTSEKPVLVDFWATWCGPCKMVAPVLEEIAAENGEKLTIAKIDI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +E+      YQ+ SIPTLILF+ GK + +++ GA  ++ ++ 
Sbjct: 61  DENPNTPRDYQVMSIPTLILFQGGKPVKQIV-GAKPKAALLS 101


>gi|78187123|ref|YP_375166.1| thioredoxin [Chlorobium luteolum DSM 273]
 gi|78167025|gb|ABB24123.1| thioredoxin [Chlorobium luteolum DSM 273]
          Length = 109

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F +EVLE     +VDFWA+WC PC+ L P+I+++A +   K  I K++++++   +
Sbjct: 9   TDQNFKAEVLESGKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAVIAKVNVDDNPNTA 68

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +Y I SIPT+++FK+G+V+D+M+ GA  ++ I + I   +
Sbjct: 69  AQYGIRSIPTMLVFKNGQVVDQMV-GAMPKNMIAKKIDEHI 108


>gi|166710444|ref|ZP_02241651.1| thioredoxin [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 113

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++
Sbjct: 1   MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  ++ +Y + SIP L+LFK+G+V    + GA  +  + + I   +
Sbjct: 61  VDQNRALAIKYHVRSIPMLLLFKNGEVQATQI-GAVGKGQLTQMIEKTL 108


>gi|283852507|ref|ZP_06369775.1| thioredoxin [Desulfovibrio sp. FW1012B]
 gi|283572115|gb|EFC20107.1| thioredoxin [Desulfovibrio sp. FW1012B]
          Length = 144

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +   +FD+ V +   P++VDFWA WC PC  ++P  D  +  L  +V + K D +E  
Sbjct: 42  VTLTQANFDTFVAKSDLPILVDFWAPWCGPCRAMAPAFDQASAMLHPRVILAKCDTQEEQ 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+ R +I  +PT++LF  G+     + GA   ++I+ W+   +
Sbjct: 102 DIADRMRIQGVPTMVLFSGGRE-KTRISGARGAAEIVAWVRQSL 144


>gi|23099572|ref|NP_693038.1| thioredoxin [Oceanobacillus iheyensis HTE831]
 gi|22777802|dbj|BAC14073.1| thioredoxin [Oceanobacillus iheyensis HTE831]
          Length = 104

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 66/106 (62%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V  ++F  E       V+ DFWA WC PC  ++P++++I  E+ +KV+I KLD++
Sbjct: 1   MAIKHVTDQNFTEET--SKGLVLADFWAPWCGPCKMIAPVLEEIDGEMEEKVQIVKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E + ++ + SIPTL+LFKDG V+D+++ G   +  + + I   
Sbjct: 59  ENQETAGKFGVMSIPTLLLFKDGDVVDQVI-GFQPKEALEDLINKH 103


>gi|168060637|ref|XP_001782301.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162666231|gb|EDQ52891.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 155

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  ++   VLE   PV+VDFWA WC PC  ++P+ID++A   A +V+  KL+ +ES  I
Sbjct: 53  VNEATWKELVLESKIPVLVDFWAPWCGPCRMIAPLIDELAKTYAGQVRCLKLNTDESPGI 112

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT+++FK+G+  D ++ GA  +S +   +   +
Sbjct: 113 ATEYGIRSIPTVMVFKNGEKKDTVI-GAVPKSTLATTLEKYL 153


>gi|145309338|gb|ABK41839.1| thioredoxin [Flavobacterium columnare]
          Length = 105

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +   +FD  VL+   PV+VDFWA+WC PC  + P+ID+IA E   K  I K+D++
Sbjct: 1   MA-LAITDATFDEVVLQSDKPVLVDFWAAWCGPCRMVGPVIDEIATEYEGKAVIGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++F++G+V+ R + G + +    + I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLIFQNGEVVGRQV-GVAPKDTYAKAIDALL 105


>gi|124053397|sp|Q1RKN1|THIO_RICBR RecName: Full=Thioredoxin; Short=Trx
          Length = 105

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M++  V  KSF+ EVL+   PV+VDFWA WC PC  L+PII++I+ +L  KVK+ K++I+
Sbjct: 1   MAS-NVTDKSFEEEVLKSDLPVLVDFWAEWCSPCRMLTPIIEEISKDLESKVKVLKMNID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ EI ++Y I SIPT++LFK+G+  D  + G   ++ +IEWI + +
Sbjct: 60  ENPEIPSKYGIRSIPTVMLFKNGEQKDTKV-GLHQKNSLIEWINNNI 105


>gi|70726817|ref|YP_253731.1| thioredoxin [Staphylococcus haemolyticus JCSC1435]
 gi|119367397|sp|Q4L5F0|THIO_STAHJ RecName: Full=Thioredoxin; Short=Trx
 gi|68447541|dbj|BAE05125.1| thioredoxin [Staphylococcus haemolyticus JCSC1435]
          Length = 104

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +FD  +       +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MAIVKVTDSNFDENIQSGVK--LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + ++++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 59  ENPSTAAKFEVMSIPTLIVFKDGEPVDKVV-GFQPKENLAEVLDKHL 104


>gi|332520057|ref|ZP_08396521.1| thioredoxin [Lacinutrix algicola 5H-3-7-4]
 gi|332044616|gb|EGI80810.1| thioredoxin [Lacinutrix algicola 5H-3-7-4]
          Length = 105

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+ +VL    PV+VDFWA+WC PC  + PIID I++E   K  + K+D++
Sbjct: 1   MA-LEITDANFEEKVLNSDKPVMVDFWAAWCGPCRMVGPIIDQISEEYEGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++F++G+V+ R + G + ++   E I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFQNGEVVGRQV-GVAPKNAYSEAIDALL 105


>gi|317471979|ref|ZP_07931311.1| thioredoxin [Anaerostipes sp. 3_2_56FAA]
 gi|316900383|gb|EFV22365.1| thioredoxin [Anaerostipes sp. 3_2_56FAA]
          Length = 107

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 75/107 (70%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS LK+   +F  EVL    PV++DFWA+WC PC  +SP++D+IA+E    VKI K++++
Sbjct: 1   MSVLKITGANFVEEVLNAKEPVLIDFWAAWCGPCRMMSPVVDEIAEE-LHGVKIGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E  E++ ++++ SIPTL++FK+GK +++   GA  + +I++ +  +V
Sbjct: 60  EEQELAVKFRVMSIPTLLIFKNGK-VEKSFVGARDKKEIVDALKMQV 105


>gi|289551050|ref|YP_003471954.1| Thioredoxin [Staphylococcus lugdunensis HKU09-01]
 gi|315658546|ref|ZP_07911418.1| thioredoxin [Staphylococcus lugdunensis M23590]
 gi|289180582|gb|ADC87827.1| Thioredoxin [Staphylococcus lugdunensis HKU09-01]
 gi|315496875|gb|EFU85198.1| thioredoxin [Staphylococcus lugdunensis M23590]
          Length = 104

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +FD  + +     +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MAIVKVTDSNFDENIQDGVK--LVDFWATWCGPCKMIAPVLEELAGDYEGKADILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + ++++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 59  ENPSTAAKFEVMSIPTLIVFKDGEPVDKVV-GFQPKENLAEVLDKHL 104


>gi|313205976|ref|YP_004045153.1| thioredoxin [Riemerella anatipestifer DSM 15868]
 gi|312445292|gb|ADQ81647.1| thioredoxin [Riemerella anatipestifer DSM 15868]
 gi|325336584|gb|ADZ12858.1| thioredoxin [Riemerella anatipestifer RA-GD]
          Length = 105

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F   V+    PV+VDFWA WC PC  L PI++++A++   K  + K+D++
Sbjct: 1   MA-LEITDSNFKEVVINSDKPVLVDFWAVWCGPCRMLGPIVEELANDFEGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +++  Y I +IPT+++FK+G+V+D+++ G S +  I E + + +
Sbjct: 60  NNQQVAMEYGIRNIPTVLIFKNGEVVDKLV-GVSPKEVIAEKLSAHL 105


>gi|220935293|ref|YP_002514192.1| thioredoxin [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996603|gb|ACL73205.1| thioredoxin [Thioalkalivibrio sp. HL-EbGR7]
          Length = 286

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
              V   +FD  VLE S   PV+VDFWA+WC+PC  L P++  +A     +  + K++ +
Sbjct: 7   IFDVTQANFDQVVLEGSRERPVLVDFWAAWCQPCQMLMPVLAKLAAAYGGRFILAKINSD 66

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E   +++RY I S+PT++LF+ GK +D+ M G   +S I   +   +
Sbjct: 67  EQQALASRYGIRSLPTVMLFRHGKPVDQFM-GVQPESTIRALLEKHL 112


>gi|159027635|emb|CAO87007.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 118

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 72/108 (66%), Gaps = 2/108 (1%)

Query: 1   MSAL-KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS +  V   +F  EVL+ ++ V+VDFWA WC PC  ++P++++IA +   +VK+ KL+ 
Sbjct: 1   MSEVPAVTDANFKVEVLDSADLVLVDFWAPWCGPCRMVAPVVEEIAKDFKGQVKVVKLNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+  I+++Y I SIPTL++FK+G+ +D ++ GA  ++ +   +   +
Sbjct: 61  DENPIIASQYGIRSIPTLMIFKEGQKVDTVV-GAVPKTTLANTLTKHL 107


>gi|268315840|ref|YP_003289559.1| thioredoxin [Rhodothermus marinus DSM 4252]
 gi|262333374|gb|ACY47171.1| thioredoxin [Rhodothermus marinus DSM 4252]
          Length = 110

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 11  FDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTR 68
           F  EV+E S   PVVVDFWA WC PC  L P+++ +A E     ++ K++ ++  E++  
Sbjct: 7   FQKEVIEKSHEKPVVVDFWAPWCGPCRILGPVLEKLARESKGAWRLVKVNTDQHPELAMH 66

Query: 69  YQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           Y +  IPT+ LF++G+V+D  + GA  +  +  W+   V
Sbjct: 67  YGVRGIPTVKLFRNGEVVDEFV-GALPEPAVRRWLQQHV 104


>gi|318040370|ref|ZP_07972326.1| thioredoxin [Synechococcus sp. CB0101]
          Length = 110

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 63/106 (59%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S L +   +F +EVL+ + PV+VD WA WC PC  ++P++D  A E + ++ + KL+ + 
Sbjct: 6   SVLHLTDANFQAEVLDAATPVLVDVWAEWCGPCRLMAPMMDWAAGEYSGRLAVGKLEADP 65

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +     +  I  +PTL++FK+G+ + R   GA +Q  +  ++ + +
Sbjct: 66  NPTARDQMGIQGLPTLVIFKNGQEVARH-EGAMAQPQLKAFLDAHL 110


>gi|94499749|ref|ZP_01306285.1| thioredoxin [Oceanobacter sp. RED65]
 gi|94427950|gb|EAT12924.1| thioredoxin [Oceanobacter sp. RED65]
          Length = 108

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SFD++VL+   PV+VD+WA WC PC  ++P++++IA+E   K+K+ KL+
Sbjct: 1   MSDNIITLSDDSFDADVLQSDVPVLVDYWAEWCGPCKMIAPVLEEIAEEYDGKLKVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++     ++ I  IPTL++FK G V    + GA S+S +  +I S +
Sbjct: 61  IDQNEATPPKFGIRGIPTLMIFKGGNVEGTKV-GALSKSQLTAFIDSTI 108


>gi|108802362|ref|YP_642559.1| thioredoxin [Mycobacterium sp. MCS]
 gi|119871515|ref|YP_941467.1| thioredoxin [Mycobacterium sp. KMS]
 gi|126438342|ref|YP_001074033.1| thioredoxin [Mycobacterium sp. JLS]
 gi|108772781|gb|ABG11503.1| thioredoxin [Mycobacterium sp. MCS]
 gi|119697604|gb|ABL94677.1| thioredoxin [Mycobacterium sp. KMS]
 gi|126238142|gb|ABO01543.1| thioredoxin [Mycobacterium sp. JLS]
          Length = 109

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   SF  +VL  S PV+VDFWA+WC PC  ++P++++IA E A  + + KLD++ 
Sbjct: 5   ATVTVTDDSFSEDVLTSSTPVLVDFWATWCGPCKMVAPVLEEIASEKAGALTVAKLDVDA 64

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +  +Q+ SIPT+ILFKDG+ + R++ GA  ++ ++  +   +
Sbjct: 65  NPTTARDFQVVSIPTMILFKDGEPVKRIV-GAKGKAALLRELTDLL 109


>gi|13474238|ref|NP_105806.1| thioredoxin [Mesorhizobium loti MAFF303099]
 gi|14024990|dbj|BAB51592.1| thioredoxin [Mesorhizobium loti MAFF303099]
          Length = 107

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +KVD  +F ++VL  + PVVVDFWA WC PC +++P ++DIA EL  K+KI KL+I+E
Sbjct: 3   ATVKVDKNNFQADVLNANVPVVVDFWAEWCGPCKQIAPSLEDIATELGAKIKIAKLNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           + E++ ++ + SIPTL++FK G+V D  + GA+ ++ +  WI 
Sbjct: 63  NPELAAQFGVRSIPTLMIFKGGEVADMKV-GAAPKTALSHWIN 104


>gi|91204817|ref|YP_537172.1| thioredoxin [Rickettsia bellii RML369-C]
 gi|91068361|gb|ABE04083.1| Thioredoxin [Rickettsia bellii RML369-C]
          Length = 119

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M++  V  KSF+ EVL+   PV+VDFWA WC PC  L+PII++I+ +L  KVK+ K++I+
Sbjct: 15  MAS-NVTDKSFEEEVLKSDLPVLVDFWAEWCSPCRMLTPIIEEISKDLESKVKVLKMNID 73

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ EI ++Y I SIPT++LFK+G+  D  + G   ++ +IEWI + +
Sbjct: 74  ENPEIPSKYGIRSIPTVMLFKNGEQKDTKV-GLHQKNSLIEWINNNI 119


>gi|37681366|ref|NP_935975.1| thiol-disulfide isomerase and thioredoxin [Vibrio vulnificus YJ016]
 gi|37200118|dbj|BAC95946.1| thiol-disulfide isomerase and thioredoxin [Vibrio vulnificus YJ016]
          Length = 112

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L++  + F+++V+  + PV+VDFWA WC PC  ++PI+D+IA+E   K+ I KL+
Sbjct: 5   MSDKILQLSDEGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLN 64

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+ ++    ++ I  IPTL+LFK+G V    + GA S++ + E++ + +
Sbjct: 65  IDHNAGTPPKFGIRGIPTLLLFKNGSVAATKV-GALSKTQLKEFLDANL 112


>gi|320449449|ref|YP_004201545.1| thioredoxin [Thermus scotoductus SA-01]
 gi|320149618|gb|ADW20996.1| thioredoxin [Thermus scotoductus SA-01]
          Length = 110

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 68/108 (62%), Gaps = 3/108 (2%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  ++V   +FD   L     V+VDFWA WC PC  ++PI++++A E   K+ + KLD+
Sbjct: 1   MAKPIEVTDANFDQ-TLSGHPLVLVDFWAEWCAPCRMIAPILEELAREYEGKLIVAKLDV 59

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ + + R+++ SIPT+ILFK+G+ ++ ++ GA  + +    I   +
Sbjct: 60  DENPKTAMRFRVMSIPTVILFKNGQPVEVLV-GAQPKRNFEAKIQKHL 106


>gi|325913812|ref|ZP_08176171.1| thioredoxin [Xanthomonas vesicatoria ATCC 35937]
 gi|325539887|gb|EGD11524.1| thioredoxin [Xanthomonas vesicatoria ATCC 35937]
          Length = 113

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++
Sbjct: 1   MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  ++ +Y + SIP L+LFKDG+V    + GA  +  + + I   +
Sbjct: 61  VDQNRALAIKYHVRSIPMLLLFKDGEVQASQI-GAVGKGQLTQMIDKTL 108


>gi|325265746|ref|ZP_08132435.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Kingella
           denitrificans ATCC 33394]
 gi|324982877|gb|EGC18500.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Kingella
           denitrificans ATCC 33394]
          Length = 123

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + V   +F++EVL+ + PV++DFWA WC PC  ++PI+D +A E A KVK+ K++
Sbjct: 14  MSEHIIHVTDATFEAEVLKAAEPVLLDFWAPWCGPCKMIAPILDQLAQEWAGKVKVVKMN 73

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+  +  ++ I SIPTL++ KDGKV+     GA ++  +  ++ + +
Sbjct: 74  VDENQVVPAQFGIRSIPTLVVLKDGKVLANR-SGALAKPQLEAFVNASI 121


>gi|302879021|ref|YP_003847585.1| thioredoxin [Gallionella capsiferriformans ES-2]
 gi|302581810|gb|ADL55821.1| thioredoxin [Gallionella capsiferriformans ES-2]
          Length = 144

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++++  +F+  +     PV++DFWA WC PC  ++P     A  L  ++++ KLD E++ 
Sbjct: 42  VELNAGNFNRHIGRSDIPVLIDFWAPWCGPCKMMAPAFVKAAALLEPRMRLAKLDTEQAQ 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++ +Y I SIPTL LFK+G+ I R   GA   + I++W  +++
Sbjct: 102 ELAAQYNIRSIPTLALFKNGREIAR-QAGAMDVNGIVQWARAKL 144


>gi|329119899|ref|ZP_08248573.1| thioredoxin [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464055|gb|EGF10366.1| thioredoxin [Neisseria bacilliformis ATCC BAA-1200]
          Length = 109

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 67/110 (60%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL    PV++DFWA WC PC  ++PI+D++A E   ++KI K+
Sbjct: 1   MSSELIIHTTDVNFEQDVLNSDIPVLLDFWAPWCGPCKMIAPILDEVAAEYQGRLKIVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ +   ++ +  IPTL++FKDG+     + GA ++  +  +I + +
Sbjct: 61  NIDENEQTPAKFGVRGIPTLMVFKDGQNTATKV-GALAKGQLTAFINASI 109


>gi|291296442|ref|YP_003507840.1| thioredoxin [Meiothermus ruber DSM 1279]
 gi|290471401|gb|ADD28820.1| thioredoxin [Meiothermus ruber DSM 1279]
          Length = 110

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 74/108 (68%), Gaps = 3/108 (2%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  ++V+  +FD+  L+ +  V+VDFWA WC PC  ++P+++++A E   KV + KLD+
Sbjct: 1   MAKPIEVNDANFDA-TLKENKYVLVDFWAEWCGPCRMVAPVMEELAKEYEGKVTVAKLDV 59

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + + + + ++++ SIPT+ILFKDG+ ++ M+ GA+ +S+ +  +   V
Sbjct: 60  DANPQTAMKFRVMSIPTIILFKDGQPVEVMV-GAAPKSNFVARLNKHV 106


>gi|118473002|ref|YP_891128.1| thioredoxin [Mycobacterium smegmatis str. MC2 155]
 gi|118174289|gb|ABK75185.1| thioredoxin [Mycobacterium smegmatis str. MC2 155]
          Length = 110

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V   SF ++VL  S PV+VDFWA+WC PC  ++P++++IA E  D++ + K+D++ 
Sbjct: 6   ATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDA 65

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +  +Q+ SIPT+ILFKDG  + R++ GA  ++ ++  +   +
Sbjct: 66  NPATARDFQVVSIPTMILFKDGAPVKRIV-GAKGKAALLRELSDAL 110


>gi|49473709|ref|YP_031751.1| thioredoxin [Bartonella quintana str. Toulouse]
 gi|49239212|emb|CAF25531.1| Thioredoxin [Bartonella quintana str. Toulouse]
          Length = 107

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 77/104 (74%), Gaps = 1/104 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K D  +F++EVL  S PVVVDFWA WC PC  ++PI+D+I+ E+  ++KI K++I+
Sbjct: 1   MTCIKTDKCNFENEVLASSVPVVVDFWAEWCGPCKMIAPILDEISTEMQGQIKIAKVNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E+ E++T+Y + SIPTL++FK+GK    M+ GA+S+  + EWI 
Sbjct: 61  ENPELATQYGVRSIPTLLMFKNGKASSNMV-GAASKGRVSEWIK 103


>gi|152968443|ref|YP_001364227.1| thioredoxin [Kineococcus radiotolerans SRS30216]
 gi|151362960|gb|ABS05963.1| thioredoxin [Kineococcus radiotolerans SRS30216]
          Length = 108

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S   V   +FD+EVL+   PV+VDFWA WC PC +++PI+++IA E  DK+ + K++ +E
Sbjct: 3   STAPVTDDTFDAEVLQSDKPVLVDFWAPWCGPCRQVAPILEEIAAEHGDKITVVKVNTDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  I+ +Y ++SIPTL ++  G+V+  ++ GA  +  +++ +
Sbjct: 63  NPRIAAKYGVTSIPTLNVYSGGEVVKTVI-GARPKPVLLKEL 103


>gi|332877003|ref|ZP_08444756.1| thioredoxin [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685111|gb|EGJ57955.1| thioredoxin [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 105

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+ S PV+VDFWA WC PC  L P+I++IA E   KV + KLD++
Sbjct: 1   MA-LEITDGNFEELVLKSSQPVLVDFWAVWCGPCRMLGPVIEEIAKEYEGKVVVGKLDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + + + +Y I +IPT+++FKDG+V+ R + G + +    + + S +
Sbjct: 60  NNQDFAGKYGIRNIPTVLVFKDGEVVGRQV-GVAPKKTYTDALDSLL 105


>gi|121534396|ref|ZP_01666219.1| thioredoxin [Thermosinus carboxydivorans Nor1]
 gi|121306889|gb|EAX47808.1| thioredoxin [Thermosinus carboxydivorans Nor1]
          Length = 107

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + V+  +F  EVL+ S PV+VDFWA WC  C KLSP+ D++A+E+ DKVK+ K+++
Sbjct: 1   MANVVNVNETNFQEEVLDSSKPVLVDFWAPWCGFCTKLSPVFDELANEMGDKVKLVKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +E+  ++ +Y + S+PT+ILFK+G+     + G   +  I   I
Sbjct: 61  DENRSLAQKYGVMSLPTMILFKNGEP-GEKLIGFMPKQAIAAKI 103


>gi|301064499|ref|ZP_07204902.1| thioredoxin [delta proteobacterium NaphS2]
 gi|300441388|gb|EFK05750.1| thioredoxin [delta proteobacterium NaphS2]
          Length = 150

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   SF SE++    PV++D WA WC PC  + P+I+ +A E A +V+I KL+++E+ 
Sbjct: 47  IDVTDMSFQSEIINVPGPVLIDCWAPWCGPCRTVGPVIEQLASEYAGRVRIAKLNVDENP 106

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + ++RY I SIPT++LFK+G +++ ++ GA  + +I   + S +
Sbjct: 107 QTASRYSIRSIPTMLLFKNGDLVNSLV-GALPKGEIESHLNSLL 149


>gi|224121896|ref|XP_002330680.1| thioredoxin m [Populus trichocarpa]
 gi|222872284|gb|EEF09415.1| thioredoxin m [Populus trichocarpa]
          Length = 196

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V  +++ S V+E   PV+++FWA WC PC  + P+I +++ E   K+K   L+ +ES   
Sbjct: 96  VTDETWQSLVIEADGPVMIEFWAPWCGPCRIIHPVIAELSTEYGGKLKCFMLNTDESPST 155

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            T+Y I SIPT+I+FK G+  D ++ GA  ++ +I  I   +
Sbjct: 156 VTKYGIRSIPTIIIFKKGEKKDAII-GAVPKTTLISNIKKFL 196


>gi|212702985|ref|ZP_03311113.1| hypothetical protein DESPIG_01023 [Desulfovibrio piger ATCC 29098]
 gi|212673573|gb|EEB34056.1| hypothetical protein DESPIG_01023 [Desulfovibrio piger ATCC 29098]
          Length = 107

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 71/106 (66%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  ++   +FDS VL    PV++DFWA WC PC  + PIID++A E   KV+I K++++
Sbjct: 1   MAE-QISDATFDSVVLNSDIPVLLDFWAPWCGPCRAVGPIIDELAAEYEGKVRIVKMNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+    T++ I +IPTL+LFK+G+ ID+ + GA ++  I+  + ++
Sbjct: 60  ENPATPTKFGIRAIPTLMLFKNGQAIDQ-VTGAVNKDAIVNILQTK 104


>gi|322435411|ref|YP_004217623.1| thioredoxin [Acidobacterium sp. MP5ACTX9]
 gi|321163138|gb|ADW68843.1| thioredoxin [Acidobacterium sp. MP5ACTX9]
          Length = 115

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 70/108 (64%), Gaps = 4/108 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+     +V+  +F+ +VL+ S PV+VDFWA+WC PC  L+P++D +A++   ++K+ K+
Sbjct: 1   MAGQFVSEVNDSNFEQDVLKSSQPVLVDFWAAWCGPCRALAPVVDQVAEQFNGQLKVMKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           D++++S   +RY I  IP L++FKDGK +   + G   ++ I + I  
Sbjct: 61  DVDKNSATPSRYGIRGIPALLIFKDGK-VAEQIVGVVPKASIEQSITK 107


>gi|167772271|ref|ZP_02444324.1| hypothetical protein ANACOL_03648 [Anaerotruncus colihominis DSM
           17241]
 gi|167665374|gb|EDS09504.1| hypothetical protein ANACOL_03648 [Anaerotruncus colihominis DSM
           17241]
          Length = 116

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS       +F SEVL+ S P++VDFWA WC PC  L P+ID +ADEL+ K  + K++I+
Sbjct: 12  MSVKHFSNDTFQSEVLQGSGPILVDFWAPWCGPCKMLGPVIDGLADELSGKAVVGKVNID 71

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y + +IPT+ILFKDG+ ++R++ G  S+  + + +   
Sbjct: 72  DEPDLAAKYGVVTIPTIILFKDGQEVNRLV-GVQSKLTLTQMVEQA 116


>gi|312198465|ref|YP_004018526.1| thioredoxin [Frankia sp. EuI1c]
 gi|311229801|gb|ADP82656.1| thioredoxin [Frankia sp. EuI1c]
          Length = 121

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + V  +SF   VL+   PV+VDFWA WC PC  ++P++D IA + A ++ +  L+ +E 
Sbjct: 18  VVTVTDRSFADLVLDSQVPVLVDFWAEWCPPCRMMAPVLDRIAADYAGRLVVASLNCDEQ 77

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +  Y + ++PT  +F+ G+ +  ++ GA S + + + +   +
Sbjct: 78  PQTARTYGVLAMPTFKIFRGGEPVASVV-GARSGAAMRKLLDEHL 121


>gi|255261243|ref|ZP_05340585.1| thioredoxin [Thalassiobium sp. R2A62]
 gi|255103578|gb|EET46252.1| thioredoxin [Thalassiobium sp. R2A62]
          Length = 106

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV     PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATVAVTDATFDAEVRNSDVPVVVDFWAEWCGPCKQIGPALEELSAEMEGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L +FK G+V+     GA+ ++ +  WI   +
Sbjct: 61  ENPNSPAQMGVRGIPALFVFKGGEVVSNR-AGAAPKAALQSWIEDSI 106


>gi|228476254|ref|ZP_04060956.1| thioredoxin [Staphylococcus hominis SK119]
 gi|314936675|ref|ZP_07844022.1| thioredoxin [Staphylococcus hominis subsp. hominis C80]
 gi|228269657|gb|EEK11159.1| thioredoxin [Staphylococcus hominis SK119]
 gi|313655294|gb|EFS19039.1| thioredoxin [Staphylococcus hominis subsp. hominis C80]
          Length = 104

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +FD  +       +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MAIVKVTDSNFDENIQSGVK--LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 59  ENPSTAAKYEVMSIPTLIVFKDGEAVDKVV-GFQPKENLAEVLDKHL 104


>gi|223043755|ref|ZP_03613798.1| thioredoxin [Staphylococcus capitis SK14]
 gi|242373377|ref|ZP_04818951.1| thioredoxin [Staphylococcus epidermidis M23864:W1]
 gi|314933342|ref|ZP_07840707.1| thioredoxin [Staphylococcus caprae C87]
 gi|222442852|gb|EEE48954.1| thioredoxin [Staphylococcus capitis SK14]
 gi|242348740|gb|EES40342.1| thioredoxin [Staphylococcus epidermidis M23864:W1]
 gi|313653492|gb|EFS17249.1| thioredoxin [Staphylococcus caprae C87]
          Length = 104

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV    FD+++       +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MAIVKVTDSDFDTKIESGVK--LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 59  ENPSTAAKYEVMSIPTLIVFKDGQPVDKVV-GFQPKENLAEVLDKHL 104


>gi|304317063|ref|YP_003852208.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778565|gb|ADL69124.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 110

 Score = 99.5 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 78/111 (70%), Gaps = 5/111 (4%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   +FDSEV     PV+VDFWA+WC PC  ++P++++ A++ +DK+K+ KL+++
Sbjct: 1   MKPIDVTDMNFDSEVYNSDKPVLVDFWAAWCGPCRMMAPVLEEFAEDYSDKIKVVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII----EWILSRV 107
           E+  I+++Y+I SIPTL +F++G+++D+++ G   +  +     ++I ++V
Sbjct: 61  ENPLIASQYRIMSIPTLGVFQNGQLVDKVI-GFMPKEQLEYRLAKYIDAQV 110


>gi|52081352|ref|YP_080143.1| thioredoxin [Bacillus licheniformis ATCC 14580]
 gi|52786729|ref|YP_092558.1| hypothetical protein BLi02998 [Bacillus licheniformis ATCC 14580]
 gi|319647259|ref|ZP_08001481.1| thioredoxin [Bacillus sp. BT1B_CT2]
 gi|52004563|gb|AAU24505.1| thioredoxin [Bacillus licheniformis ATCC 14580]
 gi|52349231|gb|AAU41865.1| TrxA [Bacillus licheniformis ATCC 14580]
 gi|317390606|gb|EFV71411.1| thioredoxin [Bacillus sp. BT1B_CT2]
          Length = 104

 Score = 99.5 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K   ++F SE       V+ DFWA WC PC  ++P+++++  E+ DK+KI K+D++
Sbjct: 1   MAIVKATDQTFSSET--SEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E + +Y + SIPTL++ KDG+V++  + G   +  + E +   +
Sbjct: 59  ENQETAGKYGVMSIPTLLVLKDGEVVETSV-GFKPKEALEELVNKHL 104


>gi|58583925|ref|YP_202941.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625713|ref|YP_453085.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188574751|ref|YP_001911680.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58428519|gb|AAW77556.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369653|dbj|BAE70811.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519203|gb|ACD57148.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 113

 Score = 99.5 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++
Sbjct: 1   MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  ++ +Y + SIP L+LFK+G+V    + GA  +  + + I   +
Sbjct: 61  VDQNRALAIKYHVRSIPMLLLFKNGEVQATQI-GAVGKGQLTQMIDKTL 108


>gi|297180046|gb|ADI16271.1| thiol-disulfide isomerase and thioredoxins [uncultured bacterium
           HF0010_16H03]
          Length = 108

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 1   MS-ALKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS  +++   ++F+ +VL    PV+VDFWA WC PC +LSP +++IA E  +K+K+ K+D
Sbjct: 1   MSNVIELQGEENFNDDVLNSDKPVLVDFWAEWCGPCKQLSPTVEEIALENQEKLKVCKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ++ + EI+ +Y I SIP+LI+FK+G+     + GA S+  + ++I
Sbjct: 61  VDSNREIAAKYGIRSIPSLIIFKNGEPAGVEI-GALSKQQLEDFI 104


>gi|153206904|ref|ZP_01945722.1| thioredoxin [Coxiella burnetii 'MSU Goat Q177']
 gi|212219584|ref|YP_002306371.1| thioredoxin [Coxiella burnetii CbuK_Q154]
 gi|120576977|gb|EAX33601.1| thioredoxin [Coxiella burnetii 'MSU Goat Q177']
 gi|212013846|gb|ACJ21226.1| thioredoxin [Coxiella burnetii CbuK_Q154]
          Length = 112

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS        ++F++EVL+   PV+VDFWA WC+PC  +SP++++IA E A +VK+ K +
Sbjct: 1   MSEHVHTASDENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKFN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+++  T+Y +  IP+L++F++G+V+DR + GA ++S +  ++  R+
Sbjct: 61  VDENAQTPTKYGVRGIPSLLIFREGEVVDRKV-GALNKSQLAAFLDERL 108


>gi|120406997|ref|YP_956826.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
 gi|119959815|gb|ABM16820.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
          Length = 110

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 69/109 (63%), Gaps = 5/109 (4%)

Query: 1   MS----ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITK 56
           MS     + V   SF  +VL    PV+VDFWA+WC PC  ++P++++IA E A  + + K
Sbjct: 1   MSDSKNTVTVTDDSFSDDVLSSGTPVLVDFWATWCGPCKMVAPVLEEIASEKAGSLTVAK 60

Query: 57  LDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +D++E+   +  +Q+ SIPT+ILFKDGK + R++ GA  ++ ++  +  
Sbjct: 61  IDVDENPATARDFQVVSIPTMILFKDGKPVKRIV-GAKGKAALLRELSE 108


>gi|313675638|ref|YP_004053634.1| thioredoxin [Marivirga tractuosa DSM 4126]
 gi|312942336|gb|ADR21526.1| thioredoxin [Marivirga tractuosa DSM 4126]
          Length = 107

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 71/106 (66%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +++   +F+ E+L+   PV+VDFWA WC PC  + P+++++A +   K  I K++++E
Sbjct: 3   STVEITDSNFE-EILKSDQPVLVDFWAEWCGPCKMIGPLVEELAGDYDGKAVIGKVNVDE 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  +S ++ I SIPTL++FK G+V+D+ + GA  +  + + I +++
Sbjct: 62  NPNVSAKFGIRSIPTLLVFKGGEVVDKQI-GAVPKQVLADKIDAQM 106


>gi|330812505|ref|YP_004356967.1| thioredoxin [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327380613|gb|AEA71963.1| thioredoxin [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 123

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS      V   SF+++VL+    V+VD+WA WC PC  ++P++D+IA+    K+ + KL
Sbjct: 15  MSSDLIKHVSDASFEADVLKAEGAVLVDYWAEWCGPCKMIAPVLDEIAETYKGKLTVAKL 74

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ E   ++ +  IPTL+LFK+G V    + GA S+S +  ++ + +
Sbjct: 75  NIDENQETPAKHGVRGIPTLMLFKNGNVEATKV-GALSKSQLAAFLDANI 123


>gi|296387383|ref|ZP_06876882.1| thioredoxin [Pseudomonas aeruginosa PAb1]
          Length = 289

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS       V   +F+  V+E S   PV+VDFWA WC PC  L P++  IA+    ++ +
Sbjct: 1   MSDTPYIFDVTGANFEQLVIENSFHKPVLVDFWADWCAPCKALMPLLAQIAESYQGELLL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            K++ +   +I  R+ I S+PT++LFKDG+ +D    GA  +S I   +   V
Sbjct: 61  AKVNCDVEQDIVMRFGIRSLPTVVLFKDGQPVDGF-AGAQPESQIRALLEPHV 112


>gi|107103574|ref|ZP_01367492.1| hypothetical protein PaerPA_01004644 [Pseudomonas aeruginosa PACS2]
          Length = 289

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS       V   +F+  V+E S   PV+VDFWA WC PC  L P++  IA+    ++ +
Sbjct: 1   MSDTPYIFDVTGANFEQLVIENSFHKPVLVDFWADWCAPCKALMPLLAQIAESYQGELLL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            K++ +   +I  R+ I S+PT++LFKDG+ +D    GA  +S I   +   V
Sbjct: 61  AKVNCDVEQDIVMRFGIRSLPTVVLFKDGQPVDGF-AGAQPESQIRALLEPHV 112


>gi|152987483|ref|YP_001346427.1| thioredoxin [Pseudomonas aeruginosa PA7]
 gi|150962641|gb|ABR84666.1| thioredoxin [Pseudomonas aeruginosa PA7]
          Length = 289

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS       V   +F+  V+E S   PV+VDFWA WC PC  L P++  IA+    ++ +
Sbjct: 1   MSDTPYIFDVTGANFEQLVIENSFHKPVLVDFWADWCAPCKALMPLLAQIAESYQGELLL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            K++ +   +I  R+ I S+PT++LFKDG+ +D    GA  +S I   +   V
Sbjct: 61  AKVNCDVEQDIVMRFGIRSLPTVVLFKDGQPVDGF-AGAQPESQIRALLEPHV 112


>gi|254236949|ref|ZP_04930272.1| hypothetical protein PACG_02973 [Pseudomonas aeruginosa C3719]
 gi|126168880|gb|EAZ54391.1| hypothetical protein PACG_02973 [Pseudomonas aeruginosa C3719]
          Length = 289

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS       V   +F+  V+E S   PV+VDFWA WC PC  L P++  IA+    ++ +
Sbjct: 1   MSDTPYIFDVTGANFEQLVIENSFHKPVLVDFWADWCAPCKALMPLLAQIAESYQGELLL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            K++ +   +I  R+ I S+PT++LFKDG+ +D    GA  +S I   +   V
Sbjct: 61  AKVNCDVEQDIVMRFGIRSLPTVVLFKDGQPVDGF-AGAQPESQIRALLEPHV 112


>gi|120555887|ref|YP_960238.1| thioredoxin [Marinobacter aquaeolei VT8]
 gi|120325736|gb|ABM20051.1| thioredoxin [Marinobacter aquaeolei VT8]
          Length = 146

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/104 (36%), Positives = 63/104 (60%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L++  ++F +       PV+VDFWASWC PC  ++P  +  A     KV+  KL+ E++
Sbjct: 41  VLELTEQNFATHTGRSDLPVLVDFWASWCGPCKMMAPQFEQAAKAWRGKVRFAKLNTEQA 100

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
              + ++ I SIPTLILF++G+ + R   GA +Q+ I +W+ S+
Sbjct: 101 PGPAGQFAIRSIPTLILFQNGREVAR-QSGAMNQAQISQWLQSQ 143


>gi|116052097|ref|YP_789059.1| putative thioredoxin [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115587318|gb|ABJ13333.1| putative thioredoxin [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 289

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS       V   +F+  V+E S   PV+VDFWA WC PC  L P++  IA+    ++ +
Sbjct: 1   MSDTPYIFDVTGANFEQLVIENSFHKPVLVDFWADWCAPCKALMPLLAQIAESYQGELLL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            K++ +   +I  R+ I S+PT++LFKDG+ +D    GA  +S I   +   V
Sbjct: 61  AKVNCDVEQDIVMRFGIRSLPTVVLFKDGQPVDGF-AGAQPESQIRALLEPHV 112


>gi|15599256|ref|NP_252750.1| thioredoxin [Pseudomonas aeruginosa PAO1]
 gi|218889659|ref|YP_002438523.1| putative thioredoxin [Pseudomonas aeruginosa LESB58]
 gi|254242742|ref|ZP_04936064.1| hypothetical protein PA2G_03507 [Pseudomonas aeruginosa 2192]
 gi|9950258|gb|AAG07448.1|AE004822_8 probable thioredoxin [Pseudomonas aeruginosa PAO1]
 gi|126196120|gb|EAZ60183.1| hypothetical protein PA2G_03507 [Pseudomonas aeruginosa 2192]
 gi|218769882|emb|CAW25643.1| probable thioredoxin [Pseudomonas aeruginosa LESB58]
          Length = 289

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS       V   +F+  V+E S   PV+VDFWA WC PC  L P++  IA+    ++ +
Sbjct: 1   MSDTPYIFDVTGANFEQLVIENSFHKPVLVDFWADWCAPCKALMPLLAQIAESYQGELLL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            K++ +   +I  R+ I S+PT++LFKDG+ +D    GA  +S I   +   V
Sbjct: 61  AKVNCDVEQDIVMRFGIRSLPTVVLFKDGQPVDGF-AGAQPESQIRALLEPHV 112


>gi|110677843|ref|YP_680850.1| thioredoxin [Roseobacter denitrificans OCh 114]
 gi|109453959|gb|ABG30164.1| thioredoxin [Roseobacter denitrificans OCh 114]
          Length = 106

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L V   +FD+EV     PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATLAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPSLEELSAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L +FKDG+V+   M GA  ++ +  WI   +
Sbjct: 61  ENPNSPAQMGVRGIPALFIFKDGQVV-SNMAGAKPKAALQGWIEDNI 106


>gi|18241|emb|CAA44209.1| thioredoxin Ch2 [Chlamydomonas reinhardtii]
          Length = 106

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  +F + VLE S PV+VDFWA WC PC  ++P++D+IA E  DK+K  KL+ +ES  +
Sbjct: 5   VNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNV 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ Y I SIPT+++FK GK  + ++ GA  ++ I++ +   +
Sbjct: 65  ASEYGIRSIPTIMVFKGGKKCETII-GAVPKATIVQTVEKYL 105


>gi|73662959|ref|YP_301740.1| thioredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC
           15305]
 gi|119367398|sp|Q49WR2|THIO_STAS1 RecName: Full=Thioredoxin; Short=Trx
 gi|72495474|dbj|BAE18795.1| thioredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC
           15305]
          Length = 104

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   +FD  +   S   +VDFWA+WC PC  ++P+++++A +   K  I KLD++
Sbjct: 1   MAIVKVTDSNFDDNI--QSGVNLVDFWATWCGPCKMIAPVLEELAGDYDGKANILKLDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + ++++ SIPTLI+FKDG+ +D+++ G   + ++ E I   +
Sbjct: 59  ENPSTAAKFEVMSIPTLIVFKDGEPVDKVV-GFQPKENLAEVIEKHL 104


>gi|255548505|ref|XP_002515309.1| protein disulfide isomerase, putative [Ricinus communis]
 gi|223545789|gb|EEF47293.1| protein disulfide isomerase, putative [Ricinus communis]
          Length = 359

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDI--ADELADKVKITKLDI 59
           S + +   +F+  VL+ S  V+V+F+A WC  C  L+P  + +  A +  D V I  LD 
Sbjct: 143 SVVVLTADNFNEVVLDESKDVLVEFYAPWCGHCKNLAPTYEKVAAAFKSEDDVVIANLDA 202

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++  +I  +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 203 DKYRDIGEKYGVSGFPTLKFFPKGNKAGEDYEGGRDLEDFVTFINEK 249



 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +++F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 26  VVVLTEDNFEKEVGQ-DRGALIEFYAPWCGHCKKLAPEYEKLGTSFKKAKSVLIGKVDCD 84

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ S 
Sbjct: 85  EHKSLCSKYGVSGYPTVQWFPKGSLEPKKYEGPRTAESLAEFVNSE 130


>gi|6226714|sp|P50338|THIO_GRIPA RecName: Full=Thioredoxin; Short=Trx
 gi|3980051|emb|CAA54076.1| thioredoxin [Griffithsia pacifica]
          Length = 109

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  +V   SF  EV+    PV+VDFWA WC PC  ++  ID+IA +  DK+K+ K++ +
Sbjct: 1   MSISQVIDTSFHEEVINSRQPVLVDFWAPWCGPCRMIASTIDEIAHDYKDKLKVVKVNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++  I+T Y I SIPT+++F +GK +D ++ GA  +  ++  +   +
Sbjct: 61  QNPTIATEYGIRSIPTVMIFINGKKVDTVV-GAVPKLTLLNTLQKHL 106


>gi|307006517|gb|ADN23543.1| protein disulfide isomerase [Hyalomma marginatum rufipes]
          Length = 333

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 3/103 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++   +F+  VL+  +  +V+F+A WC  C  L+P     A EL  KVK+  +D    
Sbjct: 51  VVELTDSNFEELVLKSDDLWLVEFFAPWCGHCKNLAPHWAKAATELKGKVKLGAVDATVY 110

Query: 63  SEISTRYQISSIPTLILFKDGKV---IDRMMPGASSQSDIIEW 102
             ++++Y +   PT+  F  GK          G  +  DI++W
Sbjct: 111 QGLASQYDVKGYPTIKFFPAGKKDRHSAEEYNGGRTADDIVQW 153


>gi|297809773|ref|XP_002872770.1| hypothetical protein ARALYDRAFT_490216 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297318607|gb|EFH49029.1| hypothetical protein ARALYDRAFT_490216 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 186

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 64/102 (62%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  ++DS VL+   PV+VDFWA WC PC  + P+++D+A +   K+K  KL+ +ES   
Sbjct: 85  VNDSTWDSLVLKADGPVLVDFWAPWCGPCKMIDPLVNDLAQQYTGKIKFYKLNTDESPST 144

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++Y + SIPT+++F +G+  D ++ GA  ++ +   I   +
Sbjct: 145 PSQYGVRSIPTIMIFVNGEKKDTII-GAVPKTTLTSSIDKFL 185


>gi|330877578|gb|EGH11727.1| thioredoxin [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 290

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 62/107 (57%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
                + +FD +V++     PV+VDFWA WC PC  L P++  I +    ++ + K++ +
Sbjct: 8   IFDATSANFDQQVIDKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++ +R+ I S+PT++LFKDG+ +D    GA  +S+I + +   V
Sbjct: 68  AEPDVVSRFGIRSLPTVVLFKDGQPVDGF-AGAQPESEIRKILEQHV 113


>gi|304414181|ref|ZP_07395549.1| thioredoxin [Candidatus Regiella insecticola LSR1]
 gi|304283395|gb|EFL91791.1| thioredoxin [Candidatus Regiella insecticola LSR1]
          Length = 108

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     ++ K+F  +VL+ S PV+VDFWA WC PC  L+PI+D+IA+E A K+ +TKL+
Sbjct: 1   MSKNIKDLEDKTFQVDVLKASGPVLVDFWAEWCGPCKTLAPILDEIANEYAGKLTVTKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I++  E + +Y +  IPTL+LFKDGK +     G  S++D+ + + + +
Sbjct: 61  IDDQRETAPKYGVRGIPTLLLFKDGK-VAANQVGLVSKTDLKKLLDTHL 108


>gi|28867914|ref|NP_790533.1| thioredoxin [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969278|ref|ZP_03397416.1| thioredoxin [Pseudomonas syringae pv. tomato T1]
 gi|301381782|ref|ZP_07230200.1| thioredoxin [Pseudomonas syringae pv. tomato Max13]
 gi|302061018|ref|ZP_07252559.1| thioredoxin [Pseudomonas syringae pv. tomato K40]
 gi|302130530|ref|ZP_07256520.1| thioredoxin [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28851150|gb|AAO54228.1| thioredoxin [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213925956|gb|EEB59513.1| thioredoxin [Pseudomonas syringae pv. tomato T1]
 gi|330964927|gb|EGH65187.1| thioredoxin [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331018222|gb|EGH98278.1| thioredoxin [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 290

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 62/107 (57%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
                + +FD +V++     PV+VDFWA WC PC  L P++  I +    ++ + K++ +
Sbjct: 8   IFDATSANFDQQVIDKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++ +R+ I S+PT++LFKDG+ +D    GA  +S+I + +   V
Sbjct: 68  AEPDVVSRFGIRSLPTVVLFKDGQPVDGF-AGAQPESEIRKILEQHV 113


>gi|226309506|ref|YP_002769468.1| thioredoxin [Rhodococcus erythropolis PR4]
 gi|229491192|ref|ZP_04385020.1| thioredoxin [Rhodococcus erythropolis SK121]
 gi|226188625|dbj|BAH36729.1| thioredoxin [Rhodococcus erythropolis PR4]
 gi|229321930|gb|EEN87723.1| thioredoxin [Rhodococcus erythropolis SK121]
          Length = 107

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 69/102 (67%), Gaps = 2/102 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + +   SF  +VL    PV+VDFWA+WC PC  ++P++++IA E ++K+ + KLDI
Sbjct: 1   MSNTVTITDDSFKQDVLGSDKPVLVDFWATWCGPCKMVAPVLEEIAGENSEKLTVAKLDI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           + +   +  +Q+ SIPT+ILFKDGK I  ++ GA  ++ +++
Sbjct: 61  DANPAAARDFQVMSIPTMILFKDGKPIKTIV-GAKGKAALLK 101


>gi|115459582|ref|NP_001053391.1| Os04g0530600 [Oryza sativa Japonica Group]
 gi|75326953|sp|Q7X8R5|TRXM2_ORYSJ RecName: Full=Thioredoxin M2, chloroplastic; Short=OsTrxm2;
           AltName: Full=OsTrx14; Flags: Precursor
 gi|38346628|emb|CAD41211.2| OSJNBa0074L08.22 [Oryza sativa Japonica Group]
 gi|38346759|emb|CAE03864.2| OSJNBa0081C01.10 [Oryza sativa Japonica Group]
 gi|90399375|emb|CAH68387.1| B1011H02.3 [Oryza sativa Indica Group]
 gi|113564962|dbj|BAF15305.1| Os04g0530600 [Oryza sativa Japonica Group]
 gi|116312031|emb|CAJ86387.1| OSIGBa0155K17.14 [Oryza sativa Indica Group]
 gi|125549121|gb|EAY94943.1| hypothetical protein OsI_16748 [Oryza sativa Indica Group]
 gi|125591078|gb|EAZ31428.1| hypothetical protein OsJ_15561 [Oryza sativa Japonica Group]
 gi|215697315|dbj|BAG91309.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 180

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
             +V   ++ S V+E   PV+V +WA+WC PC  + P++  ++ E   K+K  KL+ +E+
Sbjct: 75  VPEVTKSTWQSLVMESELPVLVGYWATWCGPCKMIDPVVGKLSKEYEGKLKCYKLNTDEN 134

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I+++Y + SIPT+++FK+G+  D ++ GA  +S +I  I   V
Sbjct: 135 PDIASQYGVRSIPTMMIFKNGEKKDAVI-GAVPESTLIASIEKFV 178


>gi|206889683|ref|YP_002249716.1| thioredoxin [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741621|gb|ACI20678.1| thioredoxin [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 110

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   +++ +  +++EVL     ++VDFWA WC PC  ++P I+++A E   K+K+ KL+
Sbjct: 1   MAEGIVELTSSKWETEVLNSKGVIMVDFWAPWCGPCRIIAPTIEELAKEYEGKIKVGKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +E+ EI+TRY I  IPT++ FKDG+ +D+++ G   +S +   + S +
Sbjct: 61  TDENPEIATRYGIMGIPTIMFFKDGQRVDQIV-GVVPKSILKSKLDSLL 108


>gi|134103805|ref|YP_001109466.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338]
 gi|291005737|ref|ZP_06563710.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338]
 gi|133916428|emb|CAM06541.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338]
          Length = 108

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+   + VDT SF S VL+   PV+VDFWA+WC PC  ++P++++IA E  DK+ + KLD
Sbjct: 1   MAGNTVTVDTDSFKSVVLDSDKPVLVDFWATWCGPCKMVAPVLEEIAGEHGDKLTVAKLD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++  + + YQ+ SIPTL+LF  G+ + +++ GA  ++ ++  +   +
Sbjct: 61  IDKNPSLQSEYQVMSIPTLLLFSGGEPVKQIV-GAKPKAALLSDLQDYL 108


>gi|126734389|ref|ZP_01750136.1| thioredoxin [Roseobacter sp. CCS2]
 gi|126717255|gb|EBA14119.1| thioredoxin [Roseobacter sp. CCS2]
          Length = 106

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV +   PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATVAVTDATFDAEVRQSDIPVVVDFWAEWCGPCKQIGPALEELSSEMEGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L +FK+G+V+     GA+ ++ +  WI   +
Sbjct: 61  ENPNSPAQMGVRGIPALFVFKNGEVVSNK-AGAAPKAALQGWIEESI 106


>gi|189346343|ref|YP_001942872.1| thioredoxin [Chlorobium limicola DSM 245]
 gi|189340490|gb|ACD89893.1| thioredoxin [Chlorobium limicola DSM 245]
          Length = 109

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F +E+LE     +VDFWA+WC PC+ L P+I+++A +   K  I K++++E+   +
Sbjct: 9   TDQNFKTEILESDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAVIAKVNVDENPNTA 68

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +Y I SIPT+++FK+G+V+D+M+ GA  ++ I + I   +
Sbjct: 69  AQYGIRSIPTMLVFKNGQVVDQMV-GAMPKNMIAKKIDEHI 108


>gi|84514935|ref|ZP_01002298.1| thioredoxin [Loktanella vestfoldensis SKA53]
 gi|84511094|gb|EAQ07548.1| thioredoxin [Loktanella vestfoldensis SKA53]
          Length = 106

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV +   PVVVDFWA WC PC ++ P ++++++E+A KVKI K++++
Sbjct: 1   MATVAVTDATFDAEVRQSDIPVVVDFWAEWCGPCKQIGPALEELSNEMAGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++     +  +  IP L +FK+G+V+     GA+ ++ I  WI   +
Sbjct: 61  DNPNSPAQMGVRGIPALFVFKNGQVVANK-AGAAPKAAIQGWIEESI 106


>gi|269837494|ref|YP_003319722.1| thioredoxin [Sphaerobacter thermophilus DSM 20745]
 gi|269786757|gb|ACZ38900.1| thioredoxin [Sphaerobacter thermophilus DSM 20745]
          Length = 237

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 62/101 (61%), Gaps = 1/101 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            ++  T +FD +VL+   PVVVDFWA WC PC  ++P+ + +A++    V+  K+++++ 
Sbjct: 110 VIEATTATFDDQVLKADLPVVVDFWAPWCGPCKMMAPVFERLAEQYRGLVRFVKVNVDQE 169

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
             ++ RY++  IPTL  F  GK+++  + GA  +S +   +
Sbjct: 170 PSLAMRYRVQGIPTLAFFWQGKLVNIHV-GALPESALQTAV 209


>gi|21673670|ref|NP_661735.1| thioredoxin [Chlorobium tepidum TLS]
 gi|25453296|sp|Q8KE49|THIO2_CHLTE RecName: Full=Thioredoxin-2; Short=Trx-2
 gi|21646790|gb|AAM72077.1| thioredoxin [Chlorobium tepidum TLS]
          Length = 109

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
           +   ++F +E+L      +VDFWA+WC PC+ L P+I+++A +   K  I KL+++E+  
Sbjct: 7   EATDQNFQAEILNSDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAIIAKLNVDENPN 66

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +Y I SIPT+++ K GKV+D+M+ GA  ++ I + +   +
Sbjct: 67  TAGQYGIRSIPTMLIIKGGKVVDQMV-GALPKNMIAKKLDEHI 108


>gi|219669602|ref|YP_002460037.1| thioredoxin [Desulfitobacterium hafniense DCB-2]
 gi|219539862|gb|ACL21601.1| thioredoxin [Desulfitobacterium hafniense DCB-2]
          Length = 109

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 73/109 (66%), Gaps = 4/109 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+        T +++ EVL     V+VDFWA+WC PC  ++PII+++ADE+A +V I KL
Sbjct: 1   MAGENVKTFTTANWNEEVLGSDKAVLVDFWAAWCGPCRMVAPIIEELADEMAGRVIIGKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +++E   I+ +YQ+ SIPTL +FK+G+V+D+ + G   ++D+++ I   
Sbjct: 61  NVDEEPAIAGQYQVMSIPTLAVFKNGQVVDKSV-GFRGKADLVKMIEKH 108


>gi|21244554|ref|NP_644136.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
 gi|21110229|gb|AAM38672.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
          Length = 113

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    ++K+ K++
Sbjct: 1   MSDKVQHVGDADFDTAVLQAGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  ++ +Y + SIP L+LFKDG+V    + GA  +  + + I   +
Sbjct: 61  VDQNRALAIKYHVRSIPMLLLFKDGQVQATQI-GAVGKGQLTQMIDKTL 108


>gi|319953454|ref|YP_004164721.1| thioredoxin [Cellulophaga algicola DSM 14237]
 gi|319422114|gb|ADV49223.1| thioredoxin [Cellulophaga algicola DSM 14237]
          Length = 105

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +FD  VL+   PVVVDFWA+WC PC  + PIID+++ E   K  + K+D++
Sbjct: 1   MA-LEITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPIIDEVSTEYDGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++FK+G+++ R + G S +    + I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFKNGEIVSRQV-GVSPKKVYTDAIDAAL 105


>gi|261381184|ref|ZP_05985757.1| thioredoxin [Neisseria subflava NJ9703]
 gi|284796002|gb|EFC51349.1| thioredoxin [Neisseria subflava NJ9703]
          Length = 110

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     SF+ +VL+   PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 1   MSSELIIHASDASFEQDVLKSDVPVLLDFWAPWCGPCRMIAPILDDIASEFQGRLKVVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+     ++ +  IPTL++FK+GK +   + GA ++  +  ++ + +
Sbjct: 61  NIDENEVTPAKFGVRGIPTLMVFKNGKNVATKV-GALAKGQLTAFVEASI 109


>gi|67458394|ref|YP_246018.1| thioredoxin [Rickettsia felis URRWXCal2]
 gi|67003927|gb|AAY60853.1| Thioredoxin [Rickettsia felis URRWXCal2]
          Length = 153

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/103 (45%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+  
Sbjct: 52  NVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELKGKVKVLKMNIDENPN 111

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I + Y I SIPT++LFK+G+  D  + G   ++ +++WI   +
Sbjct: 112 IPSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWINKSI 153


>gi|261418301|ref|YP_003251983.1| thioredoxin [Geobacillus sp. Y412MC61]
 gi|297529155|ref|YP_003670430.1| thioredoxin [Geobacillus sp. C56-T3]
 gi|319767739|ref|YP_004133240.1| thioredoxin [Geobacillus sp. Y412MC52]
 gi|261374758|gb|ACX77501.1| thioredoxin [Geobacillus sp. Y412MC61]
 gi|297252407|gb|ADI25853.1| thioredoxin [Geobacillus sp. C56-T3]
 gi|317112605|gb|ADU95097.1| thioredoxin [Geobacillus sp. Y412MC52]
          Length = 105

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +    ++F +E        +VDFWA WC PC  ++P+++++  E+ DKVKI K++++
Sbjct: 1   MAIVNATDQTFAAET--KDGLTLVDFWAPWCGPCRMIAPVLEELDREMGDKVKIVKVNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E ++++ + SIPTL+LFKDG+++D+ + G   +  +++ +   V
Sbjct: 59  ENQETASKFGVMSIPTLLLFKDGQLVDKAV-GYQPKEALVQLVGKHV 104


>gi|56964433|ref|YP_176164.1| thioredoxin [Bacillus clausii KSM-K16]
 gi|56910676|dbj|BAD65203.1| thioredoxin [Bacillus clausii KSM-K16]
          Length = 104

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +    ++F  E  E    V+VDFWA WC PC  ++P+++++  +L DK KI K+D++
Sbjct: 1   MAIVNATDQNFTEETKE--GLVLVDFWAPWCGPCKMIAPVLEELDGDLGDKAKIVKVDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E + ++ + SIPTL++ KDG+V+D+ + G   +  + E +  ++
Sbjct: 59  ENQETAGKFGVMSIPTLLVLKDGEVVDKAV-GFQPKEALEELLNKQM 104


>gi|117926932|ref|YP_867549.1| thioredoxin [Magnetococcus sp. MC-1]
 gi|117610688|gb|ABK46143.1| thioredoxin [Magnetococcus sp. MC-1]
          Length = 110

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 65/109 (59%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS          F+++VL+   PV+VDFWA WC PC +++P +D +A +    +K+ KL+
Sbjct: 1   MSEHVTSTTDSQFETDVLQAETPVLVDFWAEWCGPCKQVAPFLDQLAQDKVGSLKVVKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+  +  R+ +  IPTL++FK G++    + GA  +S + EW+   +
Sbjct: 61  IDENPNVPGRFGVRGIPTLMIFKGGQIQASKI-GAMPKSKLYEWVDEAL 108


>gi|157835497|pdb|2O85|A Chain A, S. Aureus Thioredoxin P31t Mutant
          Length = 107

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV    FDS+V   S   +VDFWA+WC  C  ++P+++++A +   K  I KLD++
Sbjct: 4   MAIVKVTDADFDSKV--ESGVQLVDFWATWCGTCKMIAPVLEELAADYEGKADILKLDVD 61

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 62  ENPSTAAKYEVMSIPTLIVFKDGQPVDKVV-GFQPKENLAEVLDKHL 107


>gi|21232053|ref|NP_637970.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66767821|ref|YP_242583.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|188990935|ref|YP_001902945.1| thioredoxin [Xanthomonas campestris pv. campestris str. B100]
 gi|21113794|gb|AAM41894.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66573153|gb|AAY48563.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|167732695|emb|CAP50889.1| thioredoxin [Xanthomonas campestris pv. campestris]
          Length = 285

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/112 (36%), Positives = 69/112 (61%), Gaps = 7/112 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS       V T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A +     ++
Sbjct: 1   MSDKAHVFDVTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAADYNGAFEL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
            K+D+++  +I+  +QI S+PT+ L K G+++D   PGA  +  I E++   
Sbjct: 61  AKVDVDKEQQIAAAFQIRSVPTVFLVKGGELVDGF-PGAMPEGQIREFLTQH 111


>gi|73759943|dbj|BAE20189.1| thioredoxin [Brevibacillus choshinensis]
          Length = 105

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +    ++F  EV E    V+VDFWA WC PC  ++P+++ +  E+  K+KI K++++
Sbjct: 1   MAIVNGTDQNFSQEV-EQGGTVLVDFWAPWCGPCKMIAPVLEQMDSEVGSKLKIVKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + + R+ + SIPTLI+FKDG+ +D+++ G   +  ++  +   +
Sbjct: 60  DNPDSAGRFGVMSIPTLIVFKDGQPVDKVI-GFQPKEALMATVGKHL 105


>gi|239980797|ref|ZP_04703321.1| thioredoxin [Streptomyces albus J1074]
          Length = 113

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 1   MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+ LK V   SF+ +VL+   PV+VDFWA+WC PC +++P ++ IA E  +++++ KL+I
Sbjct: 1   MAELKSVTDASFEQDVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHGEQIEVVKLNI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ E + +Y + SIPTL +++ G  + + + GA  ++ I+  +   +
Sbjct: 61  DENPETAAKYGVMSIPTLNVYQGG-EVAKTIVGAKPKAAIVRDLDEFI 107


>gi|110597395|ref|ZP_01385682.1| thioredoxin [Chlorobium ferrooxidans DSM 13031]
 gi|110340939|gb|EAT59410.1| thioredoxin [Chlorobium ferrooxidans DSM 13031]
          Length = 109

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 70/101 (69%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F +E+L+ S   +VDFWA+WC PC+ L P+I+++A +   K  I KL+++E+   +
Sbjct: 9   TDQNFQAEILDSSKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAVIAKLNVDENPATA 68

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +Y I SIP+L++FK+G+V+D+++ GA  ++ I + I  ++
Sbjct: 69  AKYGIRSIPSLLIFKNGQVVDQLL-GAVPKNQIAKKIDDQL 108


>gi|6573652|pdb|1DBY|A Chain A, Nmr Structures Of Chloroplast Thioredoxin M Ch2 From The
           Green Alga Chlamydomonas Reinhardtii
          Length = 107

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M A  V+  +F + VLE S PV+VDFWA WC PC  ++P++D+IA E  DK+K  KL+ +
Sbjct: 1   MEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ES  +++ Y I SIPT+++FK GK  + ++ GA  ++ I++ +   +
Sbjct: 61  ESPNVASEYGIRSIPTIMVFKGGKKCETII-GAVPKATIVQTVEKYL 106


>gi|320160914|ref|YP_004174138.1| thioredoxin [Anaerolinea thermophila UNI-1]
 gi|319994767|dbj|BAJ63538.1| thioredoxin [Anaerolinea thermophila UNI-1]
          Length = 117

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + V   +F+  VL+ + PV+VDFWA WC PC  ++P+++ IA E A KV + K++ +E+ 
Sbjct: 6   IHVTDAAFEKTVLQSTLPVIVDFWAPWCGPCKMIAPVLEKIAKEYAGKVIVAKVNTDENP 65

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E + +Y I  IPTL+ F +GK++ R + GA  +  + + +   +
Sbjct: 66  EWAMKYGIQGIPTLLFFSNGKIVHRQV-GALPERALRDIVSQFL 108


>gi|147821099|emb|CAN70962.1| hypothetical protein VITISV_038267 [Vitis vinifera]
          Length = 357

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + + + SFD  VL     V+V+F+A WC  C  L+PI +    A +    V I  LD +
Sbjct: 142 VVVLTSDSFDEVVLNEKKDVLVEFYAPWCGHCKSLAPIYEKVATAFKSEGDVVIANLDAD 201

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + ++  +
Sbjct: 202 KYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLEDFVTFVNEK 247



 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ E+       +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 24  VVVLTEANFEQEI-GKDRSALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCD 82

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   GA S   + E++ + 
Sbjct: 83  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARSAEALAEFVNNE 128


>gi|225450626|ref|XP_002282603.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
 gi|296089758|emb|CBI39577.3| unnamed protein product [Vitis vinifera]
          Length = 357

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + + + SFD  VL     V+V+F+A WC  C  L+PI +    A +    V I  LD +
Sbjct: 142 VVVLTSDSFDEVVLNEKKDVLVEFYAPWCGHCKSLAPIYEKVATAFKSEGDVVIANLDAD 201

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 202 KYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLEDFVTFINDK 247



 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ E+       +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 24  VVVLTEANFEQEI-GKDRSALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCD 82

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   GA S   + E++ + 
Sbjct: 83  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARSAEALAEFVNNE 128


>gi|221069976|ref|ZP_03546081.1| thioredoxin [Comamonas testosteroni KF-1]
 gi|220714999|gb|EED70367.1| thioredoxin [Comamonas testosteroni KF-1]
          Length = 316

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + V  ++F++EV+  S   PV+VDFWA WC PC  L P+++ +      + K+ K+D ++
Sbjct: 2   IDVTLENFEAEVVAASMAVPVLVDFWAPWCGPCKTLGPVLEKLEVAYEGRFKLVKIDSDQ 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++++ + I SIPT +L   GK +D  M GA  +  + E++   +
Sbjct: 62  EQQLASMFGIRSIPTCVLMIGGKPVDGFM-GAQPEGKLREFLDKHL 106


>gi|78189117|ref|YP_379455.1| thioredoxin [Chlorobium chlorochromatii CaD3]
 gi|78171316|gb|ABB28412.1| thioredoxin [Chlorobium chlorochromatii CaD3]
          Length = 109

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/101 (35%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
              +F +E+L+ +   +VDFWA+WC PC+ L P+I+++A E   K  I KL+++E+   +
Sbjct: 9   TDSNFKAEILDSNKVALVDFWAAWCGPCMMLGPVIEELAGEYEGKAIIAKLNVDENPNTA 68

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +Y I SIP+L++FK+G+++D+M+ GA  ++ I + +   +
Sbjct: 69  AQYGIRSIPSLLIFKNGQIVDQML-GALPKNMIAKALDKHL 108


>gi|168056396|ref|XP_001780206.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162668356|gb|EDQ54965.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 153

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 63/104 (60%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + V+  +FD+EVL+   PV+VDFWA WC PC  ++  ++++  +   K+K+ K++ + +
Sbjct: 42  VISVNQDNFDAEVLQSKLPVLVDFWADWCGPCKLVATSMEEVDSKYEGKLKVVKIETDPN 101

Query: 63  SEISTRYQISSIPTLILFKDGKVI-DRMMPGASSQSDIIEWILS 105
            E+   Y++  +PTLI+F DGK + D    GA S + I+  I  
Sbjct: 102 PELVAEYKVYGLPTLIMFVDGKAVPDGRYEGAISFTKIVSMIEK 145


>gi|89056558|ref|YP_512009.1| thioredoxin [Jannaschia sp. CCS1]
 gi|88866107|gb|ABD56984.1| thioredoxin [Jannaschia sp. CCS1]
          Length = 106

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   V   +FD+EV +   PVVVDFWA WC PC ++ P ++++++E   +VKI KL+++
Sbjct: 1   MATTAVTDATFDTEVKQSDIPVVVDFWAEWCGPCKQIGPALEELSEEYEGRVKIVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++    +  +  IP L +FKDG+V+   + GA+ ++ + +WI   V
Sbjct: 61  ENANAPMQLGVRGIPALFMFKDGEVVSNKV-GAAPKAALQKWIDEAV 106


>gi|21233205|ref|NP_639122.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66770147|ref|YP_244909.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|188993354|ref|YP_001905364.1| thioredoxin [Xanthomonas campestris pv. campestris str. B100]
 gi|21115553|gb|AAM43477.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66575479|gb|AAY50889.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|167735114|emb|CAP53326.1| thioredoxin [Xanthomonas campestris pv. campestris]
          Length = 113

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V    FD+ VL+   PV+VDFWA WC PC  ++P++DD+AD    K+K+ K++
Sbjct: 1   MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGKLKVAKVN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++++  ++ +Y + SIP L+LFKDG+V    + GA  +  + + I   +
Sbjct: 61  VDQNRALAIKYHVRSIPMLLLFKDGEVQASQI-GAVGKGQLTQMIDKTL 108


>gi|302384280|ref|YP_003820103.1| thioredoxin [Brevundimonas subvibrioides ATCC 15264]
 gi|302194908|gb|ADL02480.1| thioredoxin [Brevundimonas subvibrioides ATCC 15264]
          Length = 111

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 71/105 (67%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV   SFD++VL+ S PV+VDFWA WC PC ++ P ++ IADELA +V I K++I+
Sbjct: 1   MATMKVTDDSFDTDVLKASTPVLVDFWAEWCGPCKQIGPALEQIADELAGQVTIAKINID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +S    ++  +  IPTL+LFKDG++    + GA  +  I+EW+  
Sbjct: 61  DSPMTPSKLGVKGIPTLMLFKDGQMTSLKV-GAMPKGKILEWLAE 104


>gi|225076928|ref|ZP_03720127.1| hypothetical protein NEIFLAOT_01979 [Neisseria flavescens
           NRL30031/H210]
 gi|319637899|ref|ZP_07992665.1| thioredoxin I [Neisseria mucosa C102]
 gi|224951758|gb|EEG32967.1| hypothetical protein NEIFLAOT_01979 [Neisseria flavescens
           NRL30031/H210]
 gi|317401054|gb|EFV81709.1| thioredoxin I [Neisseria mucosa C102]
          Length = 110

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     SF+ +VL+   PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 1   MSSELIIHASDASFEQDVLKSDVPVLLDFWAPWCGPCKMIAPILDDIASEFQGRLKVVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++     ++ +  IPTL++FK+G+ +   + GA ++  +  ++ + +
Sbjct: 61  NIDDNEATPAKFGVRGIPTLMVFKNGENVATKV-GALAKGQLTAFVEASI 109


>gi|262199086|ref|YP_003270295.1| thioredoxin [Haliangium ochraceum DSM 14365]
 gi|262082433|gb|ACY18402.1| thioredoxin [Haliangium ochraceum DSM 14365]
          Length = 110

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    ++++  SFD+EV     P +VDFWA WC PC +++PI+ ++A +   K+K+ K+
Sbjct: 1   MADSNVIELNDGSFDAEVTNSDTPTLVDFWAVWCGPCRQVAPIVSELAKDYEGKLKVAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           DI+ +     ++ I SIPTL+LFK G+V++ ++ GA  +S I   +   +
Sbjct: 61  DIDHNQITPQKFGIRSIPTLLLFKGGEVVETII-GAMPKSKIEAKLTPHL 109


>gi|21328717|gb|AAM48723.1| thioredoxin [uncultured marine proteobacterium]
          Length = 106

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +     +FDS V +   PVVVDFWA WC PC ++ P +++++ E+  K+K+ K+D++
Sbjct: 1   MATVAATDATFDSIVKDSDLPVVVDFWAEWCGPCKQIGPSLEELSVEMEGKIKVVKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L LFKDG+VI     GA+ ++ +  WI   +
Sbjct: 61  SNPSAAAALGVRGIPALFLFKDGQVISNK-TGAAPKAALKSWIDDAI 106


>gi|319761321|ref|YP_004125258.1| thioredoxin [Alicycliphilus denitrificans BC]
 gi|330823196|ref|YP_004386499.1| thioredoxin [Alicycliphilus denitrificans K601]
 gi|317115882|gb|ADU98370.1| thioredoxin [Alicycliphilus denitrificans BC]
 gi|329308568|gb|AEB82983.1| thioredoxin [Alicycliphilus denitrificans K601]
          Length = 148

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 59/102 (57%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +D  +FD  V     PVVVDFWA WC PC +++P     A  L   V++ KLD E   
Sbjct: 46  LALDAATFDRHVGRSHVPVVVDFWAPWCGPCRQMAPAFAQAARTLEPHVRLAKLDTEAHP 105

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +I+ RY I SIPT+ILFK G+   R + GA   +DI  W+ S
Sbjct: 106 QIAGRYGIRSIPTMILFKGGREAAR-VSGALGAADIARWVNS 146


>gi|285019641|ref|YP_003377352.1| thioredoxin [Xanthomonas albilineans GPE PC73]
 gi|283474859|emb|CBA17358.1| putative thioredoxin protein [Xanthomonas albilineans]
          Length = 113

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   L V    FD+ VL+    V+VDFWA WC PC  ++P++DD+A+    ++K+ K++
Sbjct: 1   MSDKVLHVGDADFDTAVLQSDEAVLVDFWAEWCGPCKMIAPVLDDLAEAYDGRLKVAKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+   + +Y + SIP L+LFK+G++    + GA  +  + + I   +
Sbjct: 61  VDENRATAIKYHVRSIPMLLLFKNGQIQATQI-GAVGKGQLTQMIDKTL 108


>gi|168060101|ref|XP_001782037.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162666528|gb|EDQ53180.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 185

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V+  ++   VLE   PV+VDFWA WC PC  ++P+ID++A + A K++  KL+ +ES  I
Sbjct: 83  VNDATWKELVLESQIPVLVDFWAPWCGPCRMIAPLIDELAKQYAGKIRCLKLNTDESPGI 142

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT++LFK G+  D ++ GA  +S +   +   +
Sbjct: 143 ATEYGIRSIPTVMLFKGGEKKDTVI-GAVPKSTLTTTVEKYI 183


>gi|319779375|ref|YP_004130288.1| Thioredoxin [Taylorella equigenitalis MCE9]
 gi|317109399|gb|ADU92145.1| Thioredoxin [Taylorella equigenitalis MCE9]
          Length = 105

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
             + +  SF ++VLE + PV+VDFWA WC PC  ++PI++++  EL DK+ I K++++++
Sbjct: 2   IKEANIDSFKADVLESTKPVLVDFWAPWCGPCKMVAPILEELDSELTDKISIVKVNVDDN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +++ ++ I SIPTL+LFK+G      + GA ++SD+  +I + +
Sbjct: 62  QDLAAQFGIRSIPTLMLFKNGNQSAVKV-GAVTKSDLTNFINTNI 105


>gi|257094885|ref|YP_003168526.1| thioredoxin [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257047409|gb|ACV36597.1| thioredoxin [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 108

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS     V   +F  +VL+   PV+VD+WA WC PC  ++P++DDIA + A ++K+ KL+
Sbjct: 1   MSEHIHHVTDDNFGIDVLQSDQPVLVDYWAEWCGPCKMIAPLLDDIASDYAGRLKVVKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+++ +    Y I  IPTL+LFK+G V    + GA S+S +I +I S +
Sbjct: 61  IDDNQKTPASYGIRGIPTLMLFKNGNVEATKV-GALSRSQLITFIDSNL 108


>gi|328947707|ref|YP_004365044.1| thioredoxin [Treponema succinifaciens DSM 2489]
 gi|328448031|gb|AEB13747.1| thioredoxin [Treponema succinifaciens DSM 2489]
          Length = 102

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/101 (41%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +K++  +F  EVL  + PV+VDFWA+WC PC  LSPII++IA E ++ +K+ K++++E  
Sbjct: 3   VKINESNFKEEVLNSTKPVLVDFWATWCGPCRMLSPIIEEIAAEKSETLKVGKVNVDEEP 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            ++T++ I+SIP L+LFK+GKV+   + G   + +I++ I 
Sbjct: 63  ALATQFGIASIPMLVLFKNGKVVRTSV-GYQPKEEILKLIE 102


>gi|325917112|ref|ZP_08179345.1| thioredoxin [Xanthomonas vesicatoria ATCC 35937]
 gi|325536688|gb|EGD08451.1| thioredoxin [Xanthomonas vesicatoria ATCC 35937]
          Length = 286

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/112 (36%), Positives = 69/112 (61%), Gaps = 7/112 (6%)

Query: 1   MS----ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKI 54
           MS       V T +F++EVL+ S   PV+VDFWA+WC PC  L+PI++ +A E     ++
Sbjct: 1   MSDKPHVFDVTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYHGAFEL 60

Query: 55  TKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
            K+D+++  +I+  +QI S+PT+ L K G+++D   PGA  +  + E++   
Sbjct: 61  AKVDVDKEQQIAAAFQIRSVPTVFLVKGGEIVDGF-PGAMPEGQVREFLTQH 111


>gi|301154051|gb|ADK66335.1| chloroplast thioredoxin M-type 2 precursor [Zea mays]
          Length = 171

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S V+E   PV+V FWASWC PC  + PI+  ++ E   K+K  KL+ +E+
Sbjct: 65  VPDVSKSTWQSLVVESELPVLVQFWASWCGPCKMIDPIVGKLSKEYEGKLKCYKLNTDEN 124

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I+T++ I SIPT+++FK+G+  D ++ GA  +S ++  I   V
Sbjct: 125 PDIATQFGIRSIPTMMIFKNGEKKDAVI-GAVPESTLVTCIDKYV 168


>gi|264680705|ref|YP_003280615.1| thioredoxin [Comamonas testosteroni CNB-2]
 gi|299529407|ref|ZP_07042845.1| thioredoxin [Comamonas testosteroni S44]
 gi|262211221|gb|ACY35319.1| thioredoxin [Comamonas testosteroni CNB-2]
 gi|298722656|gb|EFI63575.1| thioredoxin [Comamonas testosteroni S44]
          Length = 316

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + V  ++F++EV+  S   PV+VDFWA WC PC  L P+++ +      + K+ K+D ++
Sbjct: 2   IDVTLENFEAEVVAASMAVPVLVDFWAPWCGPCKTLGPVLEKLEVAYEGRFKLVKIDSDQ 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++++ + I SIPT +L   GK +D  M GA  +  + E++   +
Sbjct: 62  EQQLASMFGIRSIPTCVLMIGGKPVDGFM-GAQPEGKLREFLDKHL 106


>gi|195605112|gb|ACG24386.1| thioredoxin M-type [Zea mays]
          Length = 173

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S V+E   PV+V FWASWC PC  + PI+  ++ E   K+K  KL+ +E+
Sbjct: 67  VPDVSKSTWQSLVVESELPVLVQFWASWCGPCKMIDPIVGKLSKEYEGKLKCYKLNTDEN 126

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I+T++ I SIPT+++FK+G+  D ++ GA  +S ++  I   V
Sbjct: 127 PDIATQFGIRSIPTMMIFKNGEKKDAVI-GAVPESTLVTCIDKYV 170


>gi|226494121|ref|NP_001150752.1| thioredoxin M-type [Zea mays]
 gi|194703776|gb|ACF85972.1| unknown [Zea mays]
 gi|195636554|gb|ACG37745.1| thioredoxin M-type [Zea mays]
 gi|195641494|gb|ACG40215.1| thioredoxin M-type [Zea mays]
          Length = 173

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S V+E   PV+V FWASWC PC  + PI+  ++ E   K+K  KL+ +E+
Sbjct: 67  VPDVSKSTWQSLVVESELPVLVQFWASWCGPCKMIDPIVGKLSKEYEGKLKCYKLNTDEN 126

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I+T++ I SIPT+++FK+G+  D ++ GA  +S ++  I   V
Sbjct: 127 PDIATQFGIRSIPTMMIFKNGEKKDAVI-GAVPESTLVTCIDKYV 170


>gi|110742393|dbj|BAE99119.1| thioredoxin m4 [Arabidopsis thaliana]
          Length = 180

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              +    + ++VLE   PV+V+FWA WC PC  + PI+D +A + A K K  K++ +ES
Sbjct: 75  VPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 134

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + RY I S+PT+I+FK G+  D ++ GA  +  + + I   +
Sbjct: 135 PNTANRYGIRSVPTVIIFKGGEKKDSII-GAVPRETLEKTIERFL 178


>gi|15232567|ref|NP_188155.1| TRX-M4 (ARABIDOPSIS THIOREDOXIN M-TYPE 4); enzyme activator
           [Arabidopsis thaliana]
 gi|27735268|sp|Q9SEU6|TRXM4_ARATH RecName: Full=Thioredoxin M4, chloroplastic; Short=AtTrxm4; Flags:
           Precursor
 gi|14030705|gb|AAK53027.1|AF375443_1 AT3g15360/MJK13_2 [Arabidopsis thaliana]
 gi|7021721|gb|AAF35402.1| thioredoxin m4 [Arabidopsis thaliana]
 gi|15795101|dbj|BAB02365.1| thioredoxin m4 [Arabidopsis thaliana]
 gi|16974519|gb|AAL31169.1| AT3g15360/MJK13_2 [Arabidopsis thaliana]
 gi|21593734|gb|AAM65701.1| thioredoxin m4 [Arabidopsis thaliana]
 gi|332642138|gb|AEE75659.1| thioredoxin M4 [Arabidopsis thaliana]
          Length = 193

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              +    + ++VLE   PV+V+FWA WC PC  + PI+D +A + A K K  K++ +ES
Sbjct: 88  VPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 147

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              + RY I S+PT+I+FK G+  D ++ GA  +  + + I   +
Sbjct: 148 PNTANRYGIRSVPTVIIFKGGEKKDSII-GAVPRETLEKTIERFL 191


>gi|119357012|ref|YP_911656.1| thioredoxin [Chlorobium phaeobacteroides DSM 266]
 gi|119354361|gb|ABL65232.1| thioredoxin [Chlorobium phaeobacteroides DSM 266]
          Length = 109

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/101 (35%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F +E+L+     +VDFWA+WC PC+ L P+I+++A +   K  + KL+++++   +
Sbjct: 9   TDQNFKTEILDSDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAIVAKLNVDDNPNTA 68

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++Y I SIPT++L K+GKV+D+M+ GA  ++ I + I   +
Sbjct: 69  SQYGIRSIPTMLLIKNGKVVDQMV-GAMPKNMIAKKIDEHL 108


>gi|308233505|ref|ZP_07664242.1| thioredoxin [Atopobium vaginae DSM 15829]
 gi|328943423|ref|ZP_08240888.1| thioredoxin [Atopobium vaginae DSM 15829]
 gi|327491392|gb|EGF23166.1| thioredoxin [Atopobium vaginae DSM 15829]
          Length = 105

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           + +  FDS +   + PV++DFWA+WC PC  L P I++I++E+ADK+ + K +++E  E+
Sbjct: 5   ITSADFDSIISSSTKPVLIDFWATWCGPCRALGPKIEEISEEMADKLAVYKCNVDEEPEL 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + ++QI SIPT+ILFKDG  +  ++ G   + +++  I + +
Sbjct: 65  AQQFQIVSIPTVILFKDGNAVHSLV-GNMPKDELVSEIEAHL 105


>gi|325281576|ref|YP_004254118.1| thioredoxin [Odoribacter splanchnicus DSM 20712]
 gi|324313385|gb|ADY33938.1| thioredoxin [Odoribacter splanchnicus DSM 20712]
          Length = 105

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V+  +F+  VL+ + PV+VDFWA WC PC  + PI+++I++E A K+ + K+D++
Sbjct: 1   MA-IAVNDSNFEEVVLKSAQPVLVDFWAEWCGPCKMMLPIVEEISEEFAGKITVAKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            S   + ++ I +IPT++ FKDGKV D+ + GA  ++ ++E I   +
Sbjct: 60  GSPSTAAKFGIRNIPTILFFKDGKVADKQV-GAVPKNSLVEKINKLL 105


>gi|297170262|gb|ADI21299.1| thiol-disulfide isomerase and thioredoxins [uncultured gamma
           proteobacterium HF0010_09F21]
          Length = 105

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   ++  +F SEVLE    V+VDFWA WC PC ++SP ++++A++ ++ + + K++++
Sbjct: 1   MAN-DINKDNFSSEVLENDKLVLVDFWAEWCGPCKQISPRLEELANKYSENLTVCKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++  Y I SIP LI+FK G+++D ++ GA S  ++ + +   +
Sbjct: 60  ENRELAIEYNIRSIPALIIFKSGEMVDSLI-GAVSLEELEDLVTRNL 105


>gi|302836253|ref|XP_002949687.1| hypothetical protein VOLCADRAFT_120809 [Volvox carteri f.
           nagariensis]
 gi|300265046|gb|EFJ49239.1| hypothetical protein VOLCADRAFT_120809 [Volvox carteri f.
           nagariensis]
          Length = 126

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/101 (37%), Positives = 66/101 (65%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
           +  +F S VLE   PV+VDFWA WC PC  ++P++D+IA E   K+K  K++ +ES  ++
Sbjct: 26  NDDTFKSVVLESKVPVLVDFWAPWCGPCRIIAPVVDEIAKEFTGKLKCVKINTDESPNVA 85

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + + I SIPT+++FK GK  + ++ GA  ++ I++ +   +
Sbjct: 86  SEFGIRSIPTIMVFKGGKKCETII-GAVPKATIVQTVEKYL 125


>gi|260769219|ref|ZP_05878152.1| thioredoxin 2 [Vibrio furnissii CIP 102972]
 gi|260614557|gb|EEX39743.1| thioredoxin 2 [Vibrio furnissii CIP 102972]
          Length = 144

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +FD+ +L+ + PVVVDFWA WC PCV  +PI  D+A+    +V+  K+D E 
Sbjct: 39  APIEGTEANFDA-LLQSAQPVVVDFWAPWCNPCVGFAPIFSDVAEARKGQVRFVKIDTES 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++ ++QI SIPT+++FK+G+ +D ++ GA  +S   +W+   +
Sbjct: 98  QQNLAAKFQIRSIPTIMVFKNGQRVD-VINGALPKSQFDQWLNQAL 142


>gi|308389483|gb|ADO31803.1| thioredoxin I [Neisseria meningitidis alpha710]
 gi|325136476|gb|EGC59082.1| thioredoxin [Neisseria meningitidis M0579]
 gi|325201925|gb|ADY97379.1| thioredoxin [Neisseria meningitidis M01-240149]
          Length = 110

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL    PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 1   MSSELIIHTSDAAFEKDVLNSDTPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++    +R+ +  IPTL++FK+G+V+   + GA ++  +  ++ + +
Sbjct: 61  NIDDNEATPSRFGVRGIPTLMVFKNGEVVATKV-GALAKGQLTAFVEASI 109


>gi|158521524|ref|YP_001529394.1| thioredoxin [Desulfococcus oleovorans Hxd3]
 gi|158510350|gb|ABW67317.1| thioredoxin [Desulfococcus oleovorans Hxd3]
          Length = 109

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L +   SF++EV++   PV VDFWA WC PC  + P+++++A     K+K  K +++++
Sbjct: 5   VLSISDGSFEAEVIQAEMPVFVDFWAPWCGPCKAIGPLVEELAAAYEGKIKFAKCNVDDN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               T++ I +IPTLI+FK G+V++R + G   ++ +   +   +
Sbjct: 65  PSTPTKFGIQAIPTLIIFKGGEVVER-ITGMVPKAKLEAALNKAL 108


>gi|302336496|ref|YP_003801703.1| thioredoxin [Olsenella uli DSM 7084]
 gi|301320336|gb|ADK68823.1| thioredoxin [Olsenella uli DSM 7084]
          Length = 105

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           + T  FDS +     PV+VDFWASWC PC  L P+++ +ADE++D++ + K ++++  ++
Sbjct: 5   ITTAEFDSVLANADKPVLVDFWASWCGPCRALGPVVEQVADEMSDQLALYKCNVDDEGDL 64

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + R+QI SIPT+ILFK GK +  M+ G   ++++++ + + +
Sbjct: 65  AQRFQIVSIPTMILFKGGKPVHTMV-GNMPKAELVKELQANL 105


>gi|291525190|emb|CBK90777.1| thioredoxin [Eubacterium rectale DSM 17629]
          Length = 101

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 74/103 (71%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F++EVL     V++DFWASWC PC ++ PI+++IADE    +K+ K++++
Sbjct: 1   MSAININKNNFENEVLNSDKTVLLDFWASWCAPCRRVVPIVEEIADE-RRDIKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIV-QQVSGARPKNAILEML 101


>gi|224114952|ref|XP_002316901.1| thioredoxin m [Populus trichocarpa]
 gi|222859966|gb|EEE97513.1| thioredoxin m [Populus trichocarpa]
          Length = 190

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   ++ S VLE  +PV+V+FWA WC PC  + P+ID++A++ A K+K  KL+ ++ S I
Sbjct: 90  VTDATWKSLVLESESPVLVEFWAPWCGPCRMIHPVIDELANQYAGKLKCYKLNTDDCSSI 149

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T Y I SIPT+I+FK+G+  + ++ GA  ++ +   I   +
Sbjct: 150 ATEYGIRSIPTVIIFKNGEKKEAII-GAVPKTTLTTSIEKFL 190


>gi|163732947|ref|ZP_02140391.1| thioredoxin [Roseobacter litoralis Och 149]
 gi|161393482|gb|EDQ17807.1| thioredoxin [Roseobacter litoralis Och 149]
          Length = 106

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L V   +FD+EV     PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATLAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPSLEELSAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  +  IP L +FKDG+V+   M GA+ ++ +  WI   +
Sbjct: 61  ENPNSPAQMGVRGIPALFIFKDGQVV-SNMAGANPKAALQGWIEDNI 106


>gi|24214628|ref|NP_712109.1| thioredoxin [Leptospira interrogans serovar Lai str. 56601]
 gi|24195605|gb|AAN49127.1| thioredoxin [Leptospira interrogans serovar Lai str. 56601]
          Length = 119

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 69/106 (65%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V+  +F SE       V++D WA WC PC  ++P++++++ EL   VKI KL+++
Sbjct: 16  MALAEVNDTNFKSET--SGGLVLIDCWAEWCGPCRMVAPVLEELSGELDGLVKIKKLNVD 73

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++ + +    ISSIPTL+L+KDG+++D+++ GA  ++ I  +I   
Sbjct: 74  DNQDTAQSLGISSIPTLLLYKDGQLVDKVI-GALPKAQIKNFIERH 118


>gi|157377242|ref|YP_001475842.1| thioredoxin [Shewanella sediminis HAW-EB3]
 gi|157319616|gb|ABV38714.1| thioredoxin [Shewanella sediminis HAW-EB3]
          Length = 108

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++V+    PV+VDFWA WC PC  ++PI+DD+A+E A KV I KL+
Sbjct: 1   MSDKIVYLSDDSFENDVINSELPVIVDFWAEWCGPCKMIAPILDDVAEEYAGKVTIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL++FK+G++    + GA S++ + E+I +++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLIFKNGELAGTKV-GALSKTQLKEFIDAQL 108


>gi|47779353|gb|AAT38582.1| predicted thiol-disulfide isomerase/thioredoxin [uncultured gamma
           proteobacterium eBACHOT4E07]
          Length = 108

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MSALKV--DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS + V  +   F +EV+    PV+VDFWA WC PC +L+P+++D ++E  DK+K+ K+D
Sbjct: 1   MSNVVVVENKDDFQNEVINTEGPVLVDFWAEWCGPCKQLAPLVEDASEEFKDKIKVCKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + E +  Y I SIPTL++F++G+++   + GA S+  + E+I S++
Sbjct: 61  VDANRETAAEYGIRSIPTLMIFENGELVGTEI-GALSKLQLEEFIRSKI 108


>gi|300859518|ref|YP_003784501.1| thioredoxin [Corynebacterium pseudotuberculosis FRC41]
 gi|300686972|gb|ADK29894.1| thioredoxin [Corynebacterium pseudotuberculosis FRC41]
 gi|302331762|gb|ADL21956.1| Thioredoxin [Corynebacterium pseudotuberculosis 1002]
          Length = 107

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + +   +F + V++   PV+VDFWA WC PC KL PII++IA E+ D+V + K+D++ 
Sbjct: 3   APIALTEATFKTTVIDSDKPVLVDFWAEWCGPCKKLGPIINEIAAEMGDEVVVGKVDVDA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
              +   +QI SIPT+++FKDG+ +   + G   +S+I+  + S 
Sbjct: 63  ERNLGAMFQIMSIPTVLIFKDGQKVAEFV-GVRPKSEIVAKLRSH 106


>gi|317509440|ref|ZP_07967058.1| thioredoxin [Segniliparus rugosus ATCC BAA-974]
 gi|316252269|gb|EFV11721.1| thioredoxin [Segniliparus rugosus ATCC BAA-974]
          Length = 109

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S L V   SF  +VL    PV+VDFWASWC PC  ++P++++IA E A K+ + KLD++ 
Sbjct: 7   STLTVTDSSFAQDVLASEQPVLVDFWASWCGPCRMVAPVLEEIAKEQAGKLVVAKLDVDA 66

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + + ST+Y+I SIP LILFK+G+ + +++ GA  ++ I+  +
Sbjct: 67  NPKTSTKYEIGSIPNLILFKNGEPVKQIV-GAKPKAAILREL 107


>gi|261250981|ref|ZP_05943555.1| thioredoxin 2 [Vibrio orientalis CIP 102891]
 gi|260937854|gb|EEX93842.1| thioredoxin 2 [Vibrio orientalis CIP 102891]
          Length = 144

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +FD+ +L    PVVVDFWA+WC PCV  +P+  D+A+E A  V+  K+D E 
Sbjct: 39  APIEGTESNFDA-ILNSPVPVVVDFWATWCNPCVGFAPVFSDVANERAKNVRFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++ +YQI SIPT+++FK+GK +D ++ GA  +    +W+   +
Sbjct: 98  QQNLAAKYQIRSIPTIMVFKNGKRVD-VINGALPKGQFDQWLNQAL 142


>gi|257057904|ref|YP_003135736.1| thioredoxin [Saccharomonospora viridis DSM 43017]
 gi|256587776|gb|ACU98909.1| thioredoxin [Saccharomonospora viridis DSM 43017]
          Length = 108

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 69/102 (67%), Gaps = 2/102 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  ++V   +F  EVL    PV+VDFWA+WC PC  ++P++++IA E  DK+++ KLD 
Sbjct: 1   MTNTVEVTDSNFADEVLAHDKPVLVDFWATWCGPCKMIAPVLEEIAAEHGDKLRVAKLDT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           + +   +  YQ+ SIPT+ILF+DGK + +++ GA  ++ ++ 
Sbjct: 61  DANPNTTRDYQVMSIPTMILFQDGKPVKQIV-GAKPKAALLN 101


>gi|108757097|ref|YP_634591.1| thioredoxin [Myxococcus xanthus DK 1622]
 gi|108460977|gb|ABF86162.1| thioredoxin [Myxococcus xanthus DK 1622]
          Length = 109

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +D   F  EVLE S PV+VDF A+WC PC  L+ ++D IA +   ++K+T L+++++
Sbjct: 5   VISLDDAHFQREVLESSEPVLVDFTATWCPPCRALALVLDAIAADFRGRLKVTSLNVDDN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            E + RY + ++P L+LFK+GKV+ R M GA  ++ + + + + +
Sbjct: 65  PESAMRYGVRAVPALLLFKEGKVV-RQMLGAQPRAKLEQELRTHL 108


>gi|119511940|ref|ZP_01631038.1| Thioredoxin [Nodularia spumigena CCY9414]
 gi|119463436|gb|EAW44375.1| Thioredoxin [Nodularia spumigena CCY9414]
          Length = 109

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S   V   +F  EVLE   PV+VDFWA WC PC  ++P++D++A E A +VK+ KL+ ++
Sbjct: 3   SVTNVTEATFKKEVLESEIPVLVDFWAPWCGPCRMVTPVVDEVAGEYAGQVKVVKLNTDQ 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  +++ Y I SIPTL++FK G+ +D ++ GA  ++ + + +   +
Sbjct: 63  NPTVASHYGIRSIPTLMVFKGGRQVD-IVVGAVLKTTLTQTLGQHI 107


>gi|153800780|ref|ZP_01955366.1| thioredoxin [Vibrio cholerae MZO-3]
 gi|124123755|gb|EAY42498.1| thioredoxin [Vibrio cholerae MZO-3]
          Length = 144

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L    PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E 
Sbjct: 39  APIQGTEANF-SALLRSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  +QI SIPT+++FK+G+ ID M+ GA  +S   +W+   +
Sbjct: 98  QQNLAAHFQIRSIPTIMVFKNGQRID-MINGALPKSQFDQWLNQAL 142


>gi|227876527|ref|ZP_03994639.1| thioredoxin [Mobiluncus mulieris ATCC 35243]
 gi|269977728|ref|ZP_06184688.1| thioredoxin [Mobiluncus mulieris 28-1]
 gi|306817488|ref|ZP_07451232.1| thioredoxin [Mobiluncus mulieris ATCC 35239]
 gi|307699872|ref|ZP_07636923.1| thioredoxin [Mobiluncus mulieris FB024-16]
 gi|227843068|gb|EEJ53265.1| thioredoxin [Mobiluncus mulieris ATCC 35243]
 gi|269934032|gb|EEZ90606.1| thioredoxin [Mobiluncus mulieris 28-1]
 gi|304649712|gb|EFM46993.1| thioredoxin [Mobiluncus mulieris ATCC 35239]
 gi|307614910|gb|EFN94128.1| thioredoxin [Mobiluncus mulieris FB024-16]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS AL+V+  +F  EVL    PV+VDFWA+WC PC ++ PIID +A E  + +KI K D+
Sbjct: 1   MSNALEVNESNFSEEVLRSETPVLVDFWATWCAPCRQMGPIIDQLAAEYGNDLKIVKCDV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  +  +YQISSIP   LFK G+ I   + G   ++ + + I + +
Sbjct: 61  DQNPALQMKYQISSIPAFHLFKGGESIAEFIGG-RPKNQLRDEISTAL 107


>gi|126663021|ref|ZP_01734019.1| thioredoxin [Flavobacteria bacterium BAL38]
 gi|126624679|gb|EAZ95369.1| thioredoxin [Flavobacteria bacterium BAL38]
          Length = 105

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L +   +FD  VL+   PVVVDFWA+WC PC  + P+ID+I  E   K  + K+D++
Sbjct: 1   MA-LAITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPVIDEIHGEYEGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++F++G+V+ R + G + +    + I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLIFQNGEVVGRQV-GVAPKKTYTDAIDALL 105


>gi|29655365|ref|NP_821057.1| thioredoxin [Coxiella burnetii RSA 493]
 gi|154707163|ref|YP_001425487.1| thioredoxin [Coxiella burnetii Dugway 5J108-111]
 gi|161829780|ref|YP_001597821.1| thioredoxin [Coxiella burnetii RSA 331]
 gi|212213530|ref|YP_002304466.1| thioredoxin [Coxiella burnetii CbuG_Q212]
 gi|29542637|gb|AAO91571.1| thioredoxin [Coxiella burnetii RSA 493]
 gi|154356449|gb|ABS77911.1| thioredoxin [Coxiella burnetii Dugway 5J108-111]
 gi|161761647|gb|ABX77289.1| thioredoxin [Coxiella burnetii RSA 331]
 gi|212011940|gb|ACJ19321.1| thioredoxin [Coxiella burnetii CbuG_Q212]
          Length = 112

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS        ++F++EVL+   PV+VDFWA WC+PC  +SP++++IA E A +VK+ KL+
Sbjct: 1   MSEHVHTASDENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+++  T+Y +  IP+L++F++G+V+DR + GA ++S +  ++   +
Sbjct: 61  VDENAQTPTKYGVRGIPSLLIFREGEVVDRKV-GALNKSQLAAFLDESL 108


>gi|149184294|ref|ZP_01862612.1| thiol-disulfide isomerase [Erythrobacter sp. SD-21]
 gi|148831614|gb|EDL50047.1| thiol-disulfide isomerase [Erythrobacter sp. SD-21]
          Length = 106

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V    F  +VL+   PV+VDFWA WC PC  ++P +++++DEL DKV I K+DI 
Sbjct: 1   MATINVTDDGFQKDVLDSDKPVLVDFWADWCGPCKMIAPALEELSDELGDKVTIAKMDIM 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E++ +     + SIP L+LFK+G+     M GA+ +  + +W+   +
Sbjct: 61  ENTGVPGAMGVQSIPYLVLFKNGEPAA-HMRGAAPKGQLKQWLEGEL 106


>gi|45644646|gb|AAS73034.1| predicted thiol-disulfide [uncultured marine gamma proteobacterium
           EBAC20E09]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MS-ALKV-DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS  ++V +   F   V+    PV+VDFWA WC PC +L+P+++  A+E  + + + K+D
Sbjct: 1   MSNVVEVQNRDDFVETVINSDKPVLVDFWAEWCGPCKQLAPLVEAAAEEFKNDITVCKMD 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + E +  Y I SIPTL++F +G+ +   + GA ++  + E+I S++
Sbjct: 61  VDANRETAAEYGIRSIPTLMIFTNGESVGTEI-GALTKPQLDEFIRSKI 108


>gi|89895175|ref|YP_518662.1| hypothetical protein DSY2429 [Desulfitobacterium hafniense Y51]
 gi|89334623|dbj|BAE84218.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 109

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 73/109 (66%), Gaps = 4/109 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+        T +++ EVL     V+VDFWA+WC PC  ++PII+++ADE+A KV I KL
Sbjct: 1   MAGENVKTFTTANWNEEVLGSDKAVLVDFWAAWCGPCRMVAPIIEELADEMAGKVIIGKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +++E   I+ +YQ+ SIPTL +FK+G+V+D+ + G   ++D+++ I   
Sbjct: 61  NVDEEPAIAGQYQVMSIPTLAVFKNGQVVDKSV-GFRGKADLVKMIEKH 108


>gi|729442|sp|P38661|PDIA6_MEDSA RecName: Full=Probable protein disulfide-isomerase A6; AltName:
           Full=P5; Flags: Precursor
 gi|166380|gb|AAB46930.1| glucose-regulated endoplasmic reticular protein precursor [Medicago
           sativa]
          Length = 364

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDI--ADELADKVKITKLDIE 60
            + +  ++F+  VL+ +  V+V+F+A WC  C  L+PI + +    +  D V I  LD +
Sbjct: 149 VVVLTPETFNEVVLDGTKDVLVEFYAPWCGHCKSLAPIYEKVAAVFKSEDDVVIANLDAD 208

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 209 KYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEK 254



 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 48/101 (47%), Gaps = 3/101 (2%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVK--ITKLDIEESS 63
           +  ++F+ EV       +V+F+A WC  C KL+P  + + +         I K+D +E  
Sbjct: 34  LTEENFEKEV-GHDKGALVEFYAPWCGHCKKLAPEYEKLPNSFKKAKSVLIAKVDCDEHK 92

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            + ++Y +S  PT+  F  G +  +   G  +   + E++ 
Sbjct: 93  SVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLAEFVN 133


>gi|103485899|ref|YP_615460.1| thioredoxin [Sphingopyxis alaskensis RB2256]
 gi|98975976|gb|ABF52127.1| thioredoxin [Sphingopyxis alaskensis RB2256]
          Length = 146

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 63/106 (59%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + +  + FD  +     PVVVDFWA+WC PC  ++P    +   +  + +  K+DI++
Sbjct: 41  SPVDLLGQRFDRHITRSDIPVVVDFWATWCGPCRAMAPSFAQVTIAIEPRARFAKVDIDK 100

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + E++ RY +  +P L++FK+G+++D+   GA   S + +W+ + +
Sbjct: 101 APELAARYGVQGVPALLIFKNGRLVDQR-SGALPPSALRQWVEAHI 145


>gi|269967726|ref|ZP_06181774.1| thioredoxin [Vibrio alginolyticus 40B]
 gi|269827632|gb|EEZ81918.1| thioredoxin [Vibrio alginolyticus 40B]
          Length = 144

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S ++    +F S +L+   PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E 
Sbjct: 39  SPIEGTQDNF-SALLQSDMPVVVDFWAPWCNPCVGFAPVFSDVAHEQAGTARFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++T++ I SIPT+++FK+G+ +D M+ GA  ++   +W+   +
Sbjct: 98  QQQLATQFGIRSIPTIMVFKNGQRVD-MINGALPKTQFDQWLNQAL 142


>gi|154686984|ref|YP_001422145.1| hypothetical protein RBAM_025560 [Bacillus amyloliquefaciens FZB42]
 gi|308174546|ref|YP_003921251.1| thioredoxin [Bacillus amyloliquefaciens DSM 7]
 gi|154352835|gb|ABS74914.1| TrxA [Bacillus amyloliquefaciens FZB42]
 gi|307607410|emb|CBI43781.1| thioredoxin [Bacillus amyloliquefaciens DSM 7]
 gi|328554468|gb|AEB24960.1| thioredoxin [Bacillus amyloliquefaciens TA208]
 gi|328912872|gb|AEB64468.1| Thioredoxin [Bacillus amyloliquefaciens LL3]
          Length = 104

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K   +SF +E       V+ DFWA WC PC  ++P+++++  E+ DK+KI K+D++
Sbjct: 1   MAIVKATDQSFSAET--SEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E + +Y + SIPTL++ KDG+V++  + G   +  + E +   +
Sbjct: 59  ENQETAGKYGVMSIPTLLVLKDGEVVETSV-GFKPKEALEELVNKHL 104


>gi|332289532|ref|YP_004420384.1| thioredoxin protein [Gallibacterium anatis UMN179]
 gi|330432428|gb|AEC17487.1| thioredoxin protein [Gallibacterium anatis UMN179]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +     SF+++VL+   PV++D WA WC PC  ++P++DD+A+E   KVKI K++
Sbjct: 1   MSDKIVYSSDASFEADVLKSDVPVLLDLWAPWCGPCKMIAPVLDDLAEEFDGKVKIVKIN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   +  + SIPTLI+FK+G+ +   + GA  ++ +  +I + +
Sbjct: 61  IDENQQTPAQLGVRSIPTLIIFKNGQPVATQV-GAVPKAQLAAFINNSI 108


>gi|241758531|ref|ZP_04756650.1| thioredoxin [Neisseria flavescens SK114]
 gi|241321366|gb|EER57514.1| thioredoxin [Neisseria flavescens SK114]
          Length = 110

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     SF+ +VL+   PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 1   MSSELIIHASDASFEQDVLKSDVPVLLDFWAPWCGPCKMIAPILDDIASEFQGRLKVVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+     ++ +  IPTL++FK+GK +   + GA ++  +  ++ + +
Sbjct: 61  NIDENEVTPAKFGVRGIPTLMVFKNGKNVATKV-GALAKGQLTAFVEASI 109


>gi|167625798|ref|YP_001676092.1| thioredoxin [Shewanella halifaxensis HAW-EB4]
 gi|167355820|gb|ABZ78433.1| thioredoxin [Shewanella halifaxensis HAW-EB4]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++V+    PV+VDFWA WC PC  ++PI+DD+A+E   K+ I KL+
Sbjct: 1   MSDKIVYLSDDSFENDVINSELPVLVDFWAEWCGPCKMIAPILDDVAEEYEGKITIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL+LFK G++    + GA S++ + E+I +++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLLFKAGELAATKV-GALSKTQLKEFIDAQL 108


>gi|117929356|ref|YP_873907.1| thioredoxin [Acidothermus cellulolyticus 11B]
 gi|117649819|gb|ABK53921.1| thioredoxin [Acidothermus cellulolyticus 11B]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 74/105 (70%), Gaps = 2/105 (1%)

Query: 1   MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+    V  ++F+SEVL    PV+VDFWA WC PC  ++P++++IA E  DK++I KL++
Sbjct: 1   MTVTTAVTDETFESEVLASDKPVLVDFWAEWCGPCRMVAPVLEEIAAEYGDKLRIVKLNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           +E+ + +  Y I SIPTL +F++G+V+ +++ GA S++ +++ + 
Sbjct: 61  DENPKTTQAYSILSIPTLNVFQNGQVVKQIV-GAKSKAALLKDLE 104


>gi|329938648|ref|ZP_08288044.1| thioredoxin [Streptomyces griseoaurantiacus M045]
 gi|329302139|gb|EGG46031.1| thioredoxin [Streptomyces griseoaurantiacus M045]
          Length = 110

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 65/102 (63%), Gaps = 3/102 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+     V   +F+ EVL+   PV+VDFWA+WC PC +++P ++ IA E  DK++I KL+
Sbjct: 1   MAGTVKHVTDDTFEQEVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHGDKIQIVKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           I+E+   + RY + SIPTL +++ G  + + + GA  ++ I 
Sbjct: 61  IDENPGTAARYGVMSIPTLNVYQGG-EVAKTIVGAKPKAAIE 101


>gi|225734077|pdb|3DIE|A Chain A, Domain Swapping Of Staphylococcus Aureus Thioredoxin W28a
           Mutant
 gi|225734078|pdb|3DIE|B Chain B, Domain Swapping Of Staphylococcus Aureus Thioredoxin W28a
           Mutant
          Length = 106

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV    FDS+V   S   +VDFWA+ C PC  ++P+++++A +   K  I KLD++
Sbjct: 3   MAIVKVTDADFDSKV--ESGVQLVDFWATACGPCKMIAPVLEELAADYEGKADILKLDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 61  ENPSTAAKYEVMSIPTLIVFKDGQPVDKVV-GFQPKENLAEVLDKHL 106


>gi|291530321|emb|CBK95906.1| thioredoxin [Eubacterium siraeum 70/3]
          Length = 102

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V +++F  EVL+   PV+VDFWASWC PC  L P+++++ +E   ++KI K++ +
Sbjct: 1   MSHIDVTSENFKQEVLQSDKPVLVDFWASWCGPCRMLGPVLEELGEE-HPEIKICKVNTD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           +  E++ R+ I SIP +I FKDGK ID+ + G  S+  ++  + 
Sbjct: 60  DERELAIRFGIDSIPCVISFKDGKQIDKSV-GFVSKDKLLALLD 102


>gi|325954954|ref|YP_004238614.1| thioredoxin [Weeksella virosa DSM 16922]
 gi|323437572|gb|ADX68036.1| thioredoxin [Weeksella virosa DSM 16922]
          Length = 105

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 71/105 (67%), Gaps = 2/105 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L V   SFD E++    P +VDFWA WC PC  + PI+++IA E ++K  + K+D++
Sbjct: 1   MA-LDVTDASFDKEIINSGKPAMVDFWAVWCGPCRMVGPIVEEIAGEYSEKAVVAKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            + E++ +Y I +IPT++ FK+G+V+D+++ G + +  +IE + +
Sbjct: 60  NNQEVAAKYGIRNIPTILYFKNGEVVDKVV-GVAPKEQLIEKLEA 103


>gi|309791097|ref|ZP_07685632.1| thioredoxin domain-containing protein [Oscillochloris trichoides
           DG6]
 gi|308226881|gb|EFO80574.1| thioredoxin domain-containing protein [Oscillochloris trichoides
           DG6]
          Length = 283

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 62/108 (57%), Gaps = 3/108 (2%)

Query: 2   SALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           + ++VD  +F+ EVL  S   PVV+DFWA WC PC  L P ++ +A E      + K+++
Sbjct: 16  AVIEVDEHNFEQEVLARSKDVPVVIDFWAPWCGPCRSLGPTLERLASESKGAWVLAKVNV 75

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+  +   +++ SIP +    +GK++D  + GA  +S I  W+   +
Sbjct: 76  DENQRLGASFRVQSIPAVKAVFNGKIVDEFV-GALPESQIRTWLKRFL 122


>gi|254462618|ref|ZP_05076034.1| thioredoxin [Rhodobacterales bacterium HTCC2083]
 gi|206679207|gb|EDZ43694.1| thioredoxin [Rhodobacteraceae bacterium HTCC2083]
          Length = 106

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD+EV   S PVVVDFWA WC PC ++ P +++++ E  DKVK+ K+D++
Sbjct: 1   MATVAVTDATFDAEVKNSSVPVVVDFWAEWCGPCKQIGPALEELSAEYGDKVKVVKVDVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  SNPNSAAAMGVRGIPALFIFKDGEVVSNR-AGAAPKAALQSWIDDAI 106


>gi|91224652|ref|ZP_01259913.1| thioredoxin 2 [Vibrio alginolyticus 12G01]
 gi|91190540|gb|EAS76808.1| thioredoxin 2 [Vibrio alginolyticus 12G01]
          Length = 144

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S ++    +F S +L+   PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E 
Sbjct: 39  SPIEGTQDNF-SALLQSDMPVVVDFWAPWCNPCVGFAPVFSDVAHEQAGTARFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++ ++ I SIPT+++FK+G+ +D M+ GA  ++   +W+   +
Sbjct: 98  QQQLAAQFGIRSIPTIMVFKNGQRVD-MINGALPKTQFDQWLNQAL 142


>gi|302207201|gb|ADL11543.1| Thioredoxin [Corynebacterium pseudotuberculosis C231]
 gi|308277454|gb|ADO27353.1| Thioredoxin [Corynebacterium pseudotuberculosis I19]
          Length = 107

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + +   +F + V++   PV+VDFWA WC PC KL PIID+IA E+ D+V + K+D++ 
Sbjct: 3   APIALTEATFKTTVIDSDKPVLVDFWAEWCGPCKKLGPIIDEIAAEMGDEVVVGKVDVDA 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
              +   +QI SIPT+++FKDG+ +   + G   +S+I+  + S 
Sbjct: 63  ERNLGAMFQIMSIPTVLIFKDGQKVAEFV-GVRPKSEIVAKLRSH 106


>gi|225450628|ref|XP_002282610.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
          Length = 333

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + + + SFD  VL     V+V+F+A WC  C  L+PI +    A +    V I  LD +
Sbjct: 142 VVVLTSDSFDEVVLNEKKDVLVEFYAPWCGHCKSLAPIYEKVATAFKSEGDVVIANLDAD 201

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 202 KYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLEDFVTFINDK 247



 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ E+       +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 24  VVVLTEANFEQEI-GKDRSALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCD 82

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   GA S   + E++ + 
Sbjct: 83  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARSAEALAEFVNNE 128


>gi|225457807|ref|XP_002266022.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302142749|emb|CBI19952.3| unnamed protein product [Vitis vinifera]
          Length = 183

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   S+ + V+   NPV+V+FWA WC PC  ++P+ID++A E A K+   K++ ++ 
Sbjct: 78  VQVVTDSSWSNVVIASENPVLVEFWAPWCGPCRMIAPVIDELAKEYAGKIVCCKVNTDDC 137

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T+Y I SIPT++ FK+G+     + GA  +S +   I   V
Sbjct: 138 PNIATQYGIRSIPTVLFFKNGER-KESVIGAVPKSTLTATIEKYV 181


>gi|121078481|gb|ABM47397.1| TrxA [Rhizobium leguminosarum bv. trifolii]
          Length = 110

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/107 (47%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+++KVD  +F SEVLE + PVVVDFWA WC PC  ++PII++IA E+  KVK+ KL+I+
Sbjct: 1   MASVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPIIEEIAVEMEGKVKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E++ ++ + SIPTL +FK G+V D  + G   +S  ++WI   V
Sbjct: 61  ENPELAAQFGVRSIPTLAIFKGGEVADISV-GEKPKSFFVDWIQRMV 106


>gi|269467939|gb|EEZ79674.1| thioredoxin [uncultured SUP05 cluster bacterium]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L V   SF+++V+  S  V+VDFWA WC PC  L+P++D+IADE   K+ I K++++E+
Sbjct: 5   ILAVTDTSFEADVINSSQAVLVDFWAEWCGPCKALAPVLDEIADEYDGKLIIAKINVDEN 64

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +Y I  IPT++LFKDG V    M GA S++++  +I + +
Sbjct: 65  DQTPPKYGIRGIPTVLLFKDGAVEATKM-GALSKAELSAFIDANI 108


>gi|262403796|ref|ZP_06080354.1| thioredoxin 2 [Vibrio sp. RC586]
 gi|262350300|gb|EEY99435.1| thioredoxin 2 [Vibrio sp. RC586]
          Length = 144

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +L+   PVVVDFWA WC PCV  +PI  D+A E   +++  K+D E 
Sbjct: 39  APIEGTEANF-SALLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  +QI SIPT+++FK+G+ ID M+ GA  +    +W+   +
Sbjct: 98  QQNLAAHFQIRSIPTIMVFKNGQRID-MINGALPKFQFDQWLNQAL 142


>gi|219847602|ref|YP_002462035.1| thioredoxin domain-containing protein [Chloroflexus aggregans DSM
           9485]
 gi|219541861|gb|ACL23599.1| Thioredoxin domain protein [Chloroflexus aggregans DSM 9485]
          Length = 282

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           + ++V+  +F+ +VL+ S   PVV+DFWA WC PC  L P ++ +A E      + K+++
Sbjct: 16  AVIEVNEATFERDVLQRSQTTPVVIDFWAPWCGPCRVLGPTLERLAHEAGGSWVLAKINV 75

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           +E+  ++  +++  IP +     GK++D    GA  +S +  W+ 
Sbjct: 76  DENPRLAQMFRVQGIPAVKAVYQGKIVDEF-TGALPESQVRAWLK 119


>gi|289705885|ref|ZP_06502264.1| thioredoxin [Micrococcus luteus SK58]
 gi|289557370|gb|EFD50682.1| thioredoxin [Micrococcus luteus SK58]
          Length = 184

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/96 (39%), Positives = 61/96 (63%), Gaps = 1/96 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V    FD +VL+   PV+VDFWA WC PC  L P+++D+A E   K  I KL+++
Sbjct: 23  MSTITVTDADFDQKVLQSELPVLVDFWAEWCGPCRMLGPVLEDMAVEHEGKAVIAKLNVD 82

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQ 96
           E+  I+ RY ++SIP ++ F++G+ +   + GA  +
Sbjct: 83  ENPAIAARYGVTSIPLVVGFQNGEKVVESV-GAKPK 117


>gi|160894313|ref|ZP_02075090.1| hypothetical protein CLOL250_01866 [Clostridium sp. L2-50]
 gi|156864014|gb|EDO57445.1| hypothetical protein CLOL250_01866 [Clostridium sp. L2-50]
          Length = 101

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 73/103 (70%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F++EVL     V++DFWASWC PC  + PI+++IA E    +K+ K++++
Sbjct: 1   MSAININKNNFENEVLNSDKTVLLDFWASWCAPCRMVVPIVEEIAGE-RRDIKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA S++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIV-QQVSGARSKNAILEML 101


>gi|325660975|ref|ZP_08149602.1| thioredoxin [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325472482|gb|EGC75693.1| thioredoxin [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 103

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+++ +++F  EVLE   PV+VDFWA WC PC  + PII+++A+E    VKI K++++
Sbjct: 1   MAAIQLTSETFQKEVLEAKEPVLVDFWAPWCGPCQMVLPIIEELAEE-VTDVKICKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  +I+  Y++ SIPTLILFKDGK+  + + GA ++ +++E I
Sbjct: 60  EQMKIAKEYRVMSIPTLILFKDGKIAKQEL-GAKTKEELLEMI 101


>gi|149183292|ref|ZP_01861733.1| TrxA [Bacillus sp. SG-1]
 gi|148848985|gb|EDL63194.1| TrxA [Bacillus sp. SG-1]
          Length = 104

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+      ++F +EV   S  V+ DFWA WC PC  ++P+++++  ++ DKVKI K+D++
Sbjct: 1   MAITHATDQTFKNEV--SSGLVLADFWAPWCGPCKMIAPVLEELDSDMGDKVKIVKVDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E +  Y + SIPTL++ KDG+V+D+++ G   +  + E +   
Sbjct: 59  ENQETAGNYGVMSIPTLVVLKDGEVVDKVI-GFQPKEALAEMLNKH 103


>gi|157835499|pdb|2O89|A Chain A, S. Aureus Thioredoxin P31tC32S MUTANT
          Length = 107

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KV    FDS+V   S   +VDFWA+WC     ++P+++++A +   K  I KLD++
Sbjct: 4   MAIVKVTDADFDSKV--ESGVQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVD 61

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+   + +Y++ SIPTLI+FKDG+ +D+++ G   + ++ E +   +
Sbjct: 62  ENPSTAAKYEVMSIPTLIVFKDGQPVDKVV-GFQPKENLAEVLDKHL 107


>gi|91791812|ref|YP_561463.1| thioredoxin [Shewanella denitrificans OS217]
 gi|91713814|gb|ABE53740.1| thioredoxin [Shewanella denitrificans OS217]
          Length = 108

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++VL+   PV+VDFWA WC PC  ++PI+DD+A E A +V + KL+
Sbjct: 1   MSDKIVYLSDDSFENDVLKSELPVLVDFWAEWCGPCKMIAPILDDVAQEYAGRVTVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL++FK G+++   + GA S++ + E++ +++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLMFKGGELVATKV-GALSKTQLKEFMDAQI 108


>gi|255020752|ref|ZP_05292811.1| Thioredoxin domain-containing protein [Acidithiobacillus caldus
           ATCC 51756]
 gi|254969814|gb|EET27317.1| Thioredoxin domain-containing protein [Acidithiobacillus caldus
           ATCC 51756]
          Length = 289

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 65/105 (61%), Gaps = 3/105 (2%)

Query: 2   SALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           S + V   +F + VL  S   PVVVDFWA WC PC  L P+++ +A+E+A    + K++ 
Sbjct: 6   SVIDVREDNFAAAVLAESQQRPVVVDFWAPWCGPCRALGPVLEKLAEEMAGAFLLAKVNS 65

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           +E+ E+S RYQ+  IP +  F+DGKV+D    GA  +S + +++ 
Sbjct: 66  DENPELSRRYQVRGIPAVKAFRDGKVVDEF-TGALPESAVRKFLE 109


>gi|153004238|ref|YP_001378563.1| thioredoxin [Anaeromyxobacter sp. Fw109-5]
 gi|152027811|gb|ABS25579.1| thioredoxin [Anaeromyxobacter sp. Fw109-5]
          Length = 110

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +   +F++EVL+   PV+VDFWA WC PC  ++P ++++A +   KVK+ K+D+++  
Sbjct: 7   VILQDSTFETEVLKSDVPVLVDFWAVWCGPCKAIAPTVEELASQYKGKVKVAKMDVDQHQ 66

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  +Y I SIPTL++FK G+V+D ++ GA  ++ + E +   +
Sbjct: 67  NVPQQYGIRSIPTLLVFKGGRVVDTIV-GAVPKAKLEESLKKAI 109


>gi|154505020|ref|ZP_02041758.1| hypothetical protein RUMGNA_02530 [Ruminococcus gnavus ATCC 29149]
 gi|153794499|gb|EDN76919.1| hypothetical protein RUMGNA_02530 [Ruminococcus gnavus ATCC 29149]
          Length = 101

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K+   +F+ EVL+   PV+VDF+A WC PC  LSPI+D++A+E  D +K+ K++++
Sbjct: 1   MAIIKLTKDNFEQEVLKSEKPVLVDFYADWCGPCQMLSPIVDEVAEE-RDDIKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ +Y + +IPTL++ K+G++ ++ + GA S+S +IE +
Sbjct: 60  EQMELAQKYGVMTIPTLLVIKNGEIANKHI-GALSKSGVIELL 101


>gi|260901494|ref|ZP_05909889.1| thioredoxin-2 [Vibrio parahaemolyticus AQ4037]
 gi|308107681|gb|EFO45221.1| thioredoxin-2 [Vibrio parahaemolyticus AQ4037]
 gi|328470730|gb|EGF41641.1| thioredoxin 2 [Vibrio parahaemolyticus 10329]
          Length = 144

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +LE S PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E 
Sbjct: 39  APIEGTLDNF-SALLESSTPVVVDFWAPWCNPCVGFAPVFSDVAQEQAGTARFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++ ++ I SIPT+++FK+G+ +D M+ GA  +S   +W+   +
Sbjct: 98  QQQLAAQFGIRSIPTIMVFKNGQRVD-MLNGALPKSQFDQWLNQAL 142


>gi|89067402|ref|ZP_01154915.1| thioredoxin [Oceanicola granulosus HTCC2516]
 gi|89046971|gb|EAR53025.1| thioredoxin [Oceanicola granulosus HTCC2516]
          Length = 106

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FDSEV +   PVVVDFWA WC PC ++ P +++IA E+  KVKI K++++
Sbjct: 1   MATVAVTDDTFDSEVRQSDIPVVVDFWAEWCGPCKQIGPALEEIAAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+     +  I  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 61  ENPNSPAQMGIRGIPALFIFKDGEVVSNR-AGAAPKAALQGWIQDSI 106


>gi|332978171|gb|EGK14905.1| thioredoxin [Desmospora sp. 8437]
          Length = 105

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 72/107 (67%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V  ++F+ +V   S  V+VDFWA WC PC  ++P ++ +  E+ DK+ I KL+++
Sbjct: 2   MAIKQVTDQTFNDDV--ASGTVLVDFWAPWCGPCKMIAPELEGLDQEIGDKLTIAKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ + + ++ + SIPTL++FKDG+++D++  G   ++ ++EW+   +
Sbjct: 60  ENPDTAGKFGVMSIPTLMVFKDGQMVDKL-TGFQPKAQLLEWVTPHL 105


>gi|189500150|ref|YP_001959620.1| thioredoxin [Chlorobium phaeobacteroides BS1]
 gi|189495591|gb|ACE04139.1| thioredoxin [Chlorobium phaeobacteroides BS1]
          Length = 109

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 70/101 (69%), Gaps = 1/101 (0%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F + +L+     +VDFWA+WC PC  L P+I+++A E   K  I+KL+++E+ + +
Sbjct: 9   TDQNFKASILDSDKVALVDFWAAWCGPCQMLGPVIEELAGEFEGKAVISKLNVDENPDTA 68

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +Y + SIPT+++FK+G+V+D+M+ GA  ++ I E I +++
Sbjct: 69  AQYGVRSIPTMLIFKNGEVVDQMV-GAMPKNMIAEKINAQL 108


>gi|325144499|gb|EGC66798.1| thioredoxin [Neisseria meningitidis M01-240013]
          Length = 129

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL    PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 20  MSSELIVHTSDAAFEKDVLNADIPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKI 79

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++    +R+ +  IPTL++FK+G+V+   + GA ++  +  ++ + +
Sbjct: 80  NIDDNEATPSRFGVRGIPTLMVFKNGEVVATKV-GALAKGQLTAFVEASI 128


>gi|302531345|ref|ZP_07283687.1| thioredoxin [Streptomyces sp. AA4]
 gi|302440240|gb|EFL12056.1| thioredoxin [Streptomyces sp. AA4]
          Length = 107

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 70/102 (68%), Gaps = 2/102 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  +KV  KSF  +VL    PV+VDFWA+WC PC  ++P++++IA E  DK+ + KLDI
Sbjct: 1   MSEPVKVTDKSFVDDVLTSEKPVLVDFWATWCGPCKMVAPVLEEIAKENGDKITVAKLDI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +E+   +  YQ+ SIPTLILF+ GK + +++ GA  ++ ++ 
Sbjct: 61  DENPNTARDYQVMSIPTLILFQGGKPVKQIV-GAKPKAALLS 101


>gi|224284188|gb|ACN39830.1| unknown [Picea sitchensis]
          Length = 445

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 55/104 (52%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++ + +FD  VL+  +P +V+F+A WC  C KL P     A+ L  KV + +++ +   
Sbjct: 171 VELTSNNFDDIVLKSKDPWLVEFYAPWCGHCKKLGPEWKKAANNLKGKVNMGQVNCDSEK 230

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + +R+ +   PT+++F   K       GA + S I  + L ++
Sbjct: 231 SLMSRFNVQGFPTILVFGSDKESPVPYEGARTASAIESFALEQL 274



 Score = 86.0 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L +   +F S+VL     V+V+F+A WC  C  L+PI +  A  L   V +  LD +  
Sbjct: 41  VLLLTPSTFKSKVLNSDGIVLVEFFAPWCGHCQALTPIWEKTAAILKGFVTVAALDADAH 100

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             ++  Y I   PT+ +F  GK       GA     I E+ + ++
Sbjct: 101 KSLAQEYGIQGFPTIKVFTPGKP-PIAYQGARDPKPIAEFAIQQL 144


>gi|254436635|ref|ZP_05050129.1| thioredoxin [Octadecabacter antarcticus 307]
 gi|198252081|gb|EDY76395.1| thioredoxin [Octadecabacter antarcticus 307]
          Length = 106

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V   +FD EV + + PVVVDFWA WC PC ++ P +++++ E+  KVKI K++++
Sbjct: 1   MATVAVTDDTFDVEVRQSTIPVVVDFWAEWCGPCKQIGPALEELSAEMDGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           E+     +  +  IP L LFKDG+V+     GA+ ++ +  WI  
Sbjct: 61  ENPNAPAQMGVRGIPALFLFKDGEVVSNK-TGAAPKAALQSWIEE 104


>gi|254362807|ref|ZP_04978886.1| thioredoxin [Mannheimia haemolytica PHL213]
 gi|261493176|ref|ZP_05989707.1| thioredoxin [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495902|ref|ZP_05992324.1| thioredoxin [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153094437|gb|EDN75282.1| thioredoxin [Mannheimia haemolytica PHL213]
 gi|261308423|gb|EEY09704.1| thioredoxin [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311179|gb|EEY12351.1| thioredoxin [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 109

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKL 57
           MS  +     +F+ +VL+   PV++DFWA WC PC  + P++DD  +  +   KVKI K+
Sbjct: 1   MSNVIHTTDATFEQDVLKSDVPVLLDFWAPWCGPCRMIGPVLDDLSVDAQFDGKVKIVKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+  +  ++ + SIP L+LFK+G+VI + + GA   + + E+I   +
Sbjct: 61  NVDENPSVPAQFGVRSIPFLLLFKNGEVIAQQV-GAIPHAQMAEFIKQAL 109


>gi|237786644|ref|YP_002907349.1| thioredoxin [Corynebacterium kroppenstedtii DSM 44385]
 gi|237759556|gb|ACR18806.1| thioredoxin [Corynebacterium kroppenstedtii DSM 44385]
          Length = 107

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + V T SF S V++   PV+VDFWA+WC PC  ++P++++IADE   K  I K++++E
Sbjct: 3   SPVNVTTDSFRSTVVDSDKPVLVDFWATWCGPCRTMNPVLEEIADEYDGKAVIAKVNVDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +++ +Q+ SIPT++LFKDGK ++  + GA  +S I   +   +
Sbjct: 63  NAPLASMFQVMSIPTMLLFKDGKKVEE-IHGAHPKSHITTALEKLL 107


>gi|307330007|ref|ZP_07609159.1| thioredoxin [Streptomyces violaceusniger Tu 4113]
 gi|306884383|gb|EFN15417.1| thioredoxin [Streptomyces violaceusniger Tu 4113]
          Length = 109

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V    F+ +VL+   PV+VDFWA+WC PC +++P ++ IA E  DK+ I KL+I+E
Sbjct: 4   ATVTVTDADFEEKVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHPDKIVIAKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +   + +Y + SIPTL +++ G  + + + GA  ++ I 
Sbjct: 64  NPATAAKYGVMSIPTLNVYQGG-EVAKTIVGAKPKAAIE 101


>gi|93007116|ref|YP_581553.1| thioredoxin [Psychrobacter cryohalolentis K5]
 gi|92394794|gb|ABE76069.1| thioredoxin [Psychrobacter cryohalolentis K5]
          Length = 120

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +     +FD +VL+   PV+VDFWA+WC PC  ++PI++D+A E   KVKI K+D
Sbjct: 13  MSDLIVNTTDANFDQDVLQSDVPVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVD 72

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ + + ++R+ I +IPTL +FK G+ +D  + G   ++++ + +   +
Sbjct: 73  VDNNPQAASRFGIRNIPTLFVFKGGEKVDS-VMGLQPKAELAKVLDKHL 120


>gi|17545498|ref|NP_518900.1| thioredoxin protein [Ralstonia solanacearum GMI1000]
 gi|17427791|emb|CAD14481.1| putative thioredoxin protein [Ralstonia solanacearum GMI1000]
          Length = 280

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V +++F  EV+E S   PV+VDFWA WC PC  L P+++ +  E A K K+ K++
Sbjct: 1   MS--DVTSQNFAQEVIETSRQVPVLVDFWAPWCGPCRTLGPMLEKLEHEYAGKWKLAKVN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            +ES E+S  + + SIP ++ F DGK +D+ + G   +S +  ++ 
Sbjct: 59  SDESPELSAHFNVRSIPHVVAFVDGKPVDQFV-GVLPESQLRGFLD 103


>gi|157960227|ref|YP_001500261.1| thioredoxin [Shewanella pealeana ATCC 700345]
 gi|157845227|gb|ABV85726.1| thioredoxin [Shewanella pealeana ATCC 700345]
          Length = 108

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++V+    PV+VDFWA WC PC  ++PI+DD+A+E   K+KI KL+
Sbjct: 1   MSDKIVYLSDDSFENDVINSELPVLVDFWAEWCGPCKMIAPILDDVAEEYEGKIKIAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL+LFK G++    + GA S++ + E+I +++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLLFKAGELAATKV-GALSKTQLKEFIDAQL 108


>gi|302520503|ref|ZP_07272845.1| thioredoxin [Streptomyces sp. SPB78]
 gi|302429398|gb|EFL01214.1| thioredoxin [Streptomyces sp. SPB78]
          Length = 186

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V    F+  VL+   PV+VDFWA WC PC +++P ++ IA E  ++++I KLDI+ + E 
Sbjct: 82  VTDADFEEVVLKSDKPVLVDFWAEWCGPCRQIAPSLEAIAKEYGEQIEIVKLDIDANQET 141

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T+Y + SIPTL +++ G+V+  ++ GA  ++ I+  + + V
Sbjct: 142 ATKYGVMSIPTLNVYQGGEVVKTIV-GAKPKAAILRDLDAFV 182


>gi|123443446|ref|YP_001007419.1| thioredoxin 2 [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122090407|emb|CAL13275.1| thioredoxin 2 [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 146

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +    ++ D  +L+   PVV+DFWA WC PC   +PI  ++A E A KV+  K++ E 
Sbjct: 36  SIINATAETLDK-LLQDDLPVVIDFWAPWCGPCRSFAPIFTEVAAERAGKVRFVKVNTEA 94

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +STR++I SIPT++L+++GK++D M+ GA  ++    W+  ++
Sbjct: 95  EPALSTRFRIRSIPTIMLYRNGKMVD-MLSGALPKAAFDNWLNEQL 139


>gi|238923597|ref|YP_002937113.1| thiol-disulfide isomerase and thioredoxin [Eubacterium rectale ATCC
           33656]
 gi|238875272|gb|ACR74979.1| thiol-disulfide isomerase and thioredoxin [Eubacterium rectale ATCC
           33656]
 gi|291528214|emb|CBK93800.1| thioredoxin [Eubacterium rectale M104/1]
          Length = 101

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 74/103 (71%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ ++  +F++EVL     V++DFWASWC PC ++ PI+++IADE    +K+ K++++
Sbjct: 1   MSAININKNNFENEVLNSDKTVLLDFWASWCAPCRRVVPIVEEIADE-RMDIKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++ K+GK++ + + GA  ++ I+E +
Sbjct: 60  EEPELANKFSIMSIPTLVVMKNGKIV-QQVSGARPKNAILEML 101


>gi|219850309|ref|YP_002464742.1| thioredoxin [Chloroflexus aggregans DSM 9485]
 gi|219544568|gb|ACL26306.1| thioredoxin [Chloroflexus aggregans DSM 9485]
          Length = 110

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + V+   F+ +VL+ S PVVVDFWA WC PC  ++PI+D +A E   ++ I K++ 
Sbjct: 1   MAKPIVVNDADFEEKVLKSSTPVVVDFWAPWCGPCRVIAPILDKLAGEYEGRLTIAKVNT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +++   +++  I  IPTL++FK+GK + R++ GA  ++   E    
Sbjct: 61  DDNIRYASQLGIQGIPTLVIFKNGKEVGRLI-GARPEAMYREVFDK 105


>gi|218961129|ref|YP_001740904.1| thioredoxin [Candidatus Cloacamonas acidaminovorans]
 gi|167729786|emb|CAO80698.1| thioredoxin [Candidatus Cloacamonas acidaminovorans]
          Length = 107

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L+V++ +F++EVL+ + PV+VDFWA WC PC  LSP ID IA+E   K+K+ K++++
Sbjct: 1   MAILEVNSANFETEVLKSTQPVLVDFWAPWCGPCKALSPTIDKIANETEGKIKVVKINVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +I+ +Y + SIPTL++F +G V D+++ G   +  I++ +   +
Sbjct: 61  EAQDIAAKYSVMSIPTLLIFVNGVVSDQLI-GLVQKDKIMDKLNKFI 106


>gi|78212139|ref|YP_380918.1| thioredoxin [Synechococcus sp. CC9605]
 gi|78196598|gb|ABB34363.1| thioredoxin [Synechococcus sp. CC9605]
          Length = 111

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +        F  EVL+ S  V+VDFWA+WC PC  ++P++D +A +  D+V + KL+++ 
Sbjct: 7   AVADFTDAGFKREVLKASGTVLVDFWAAWCGPCRLIAPLMDWVASDYGDRVSVGKLEVDA 66

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +    Y++  IPTLILF++G+V+ R   GA ++  +  ++ + +
Sbjct: 67  NPQTRDAYEVQGIPTLILFRNGEVVARH-EGAIAKPQLQSFLDANL 111


>gi|194098820|ref|YP_002001883.1| putative thioredoxin I [Neisseria gonorrhoeae NCCP11945]
 gi|193934110|gb|ACF29934.1| putative thioredoxin I [Neisseria gonorrhoeae NCCP11945]
 gi|317164401|gb|ADV07942.1| putative thioredoxin I [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 129

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL+   PV++DFWA WC PC  ++PI+DDIA E   ++K+ K+
Sbjct: 20  MSSELIVHTGDAAFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKI 79

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++    +R+ +  IPTL++FK+G+V+   + GA ++  +  ++ + +
Sbjct: 80  NIDDNEATPSRFGVRGIPTLMVFKNGEVVATKV-GALAKGQLTAFVEASI 128


>gi|153853836|ref|ZP_01995192.1| hypothetical protein DORLON_01183 [Dorea longicatena DSM 13814]
 gi|149753586|gb|EDM63517.1| hypothetical protein DORLON_01183 [Dorea longicatena DSM 13814]
          Length = 102

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +   +F+ EVLE   PV+VDFWA+WC PC  ++PI+++IA+E    +K+ K+D++
Sbjct: 1   MAVIHLSKDNFNEEVLESKVPVMVDFWATWCGPCKTMAPIVEEIAEE-RTDIKVCKIDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +  E++ +Y++ SIPT ++FKDG+V+ R M G  S+ ++   I
Sbjct: 60  QEPELARQYRVMSIPTFLVFKDGEVVKRDM-GVMSKDELEGLI 101


>gi|153951052|ref|YP_001397405.1| thioredoxin [Campylobacter jejuni subsp. doylei 269.97]
 gi|107784829|gb|ABF83906.1| thioredoxin [Campylobacter jejuni subsp. doylei]
 gi|152938498|gb|ABS43239.1| thioredoxin [Campylobacter jejuni subsp. doylei 269.97]
          Length = 104

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 67/104 (64%), Gaps = 4/104 (3%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++ + +FD          +VDFWA WC PC  L+P+ID++A++   K KI K++ +E  
Sbjct: 5   IELTSDNFDQ---AKEGIALVDFWAPWCGPCRMLAPVIDELANDFDGKAKICKVNTDEQG 61

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++  + + SIPTLI FK+G+V+D+++ GA S+  I + + S +
Sbjct: 62  DLAAEFGVRSIPTLIFFKNGEVVDQLV-GAQSKQAISDKLNSLL 104


>gi|226322282|ref|ZP_03797800.1| hypothetical protein COPCOM_00042 [Coprococcus comes ATCC 27758]
 gi|225209312|gb|EEG91666.1| hypothetical protein COPCOM_00042 [Coprococcus comes ATCC 27758]
          Length = 102

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 67/104 (64%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + + T++F+ EVL    PV+VDFWA+WC PC  + P++D++A E    VK+ K++++
Sbjct: 1   MSVINLTTENFEEEVLNAKEPVLVDFWATWCGPCQTMGPVVDELAQE-FTDVKVGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   ++  Y++ SIPT ++FKDGK +     G   +S++ + I 
Sbjct: 60  EQMALAREYKVMSIPTFLVFKDGK-VAERTLGVQEKSELEQLIR 102


>gi|225569203|ref|ZP_03778228.1| hypothetical protein CLOHYLEM_05285 [Clostridium hylemonae DSM
           15053]
 gi|225162002|gb|EEG74621.1| hypothetical protein CLOHYLEM_05285 [Clostridium hylemonae DSM
           15053]
          Length = 103

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 67/104 (64%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+ +   +F  EVLE   PV+VDFWA WC PC  + PI++++A E     KI K++++
Sbjct: 1   MAAIHLTKDNFKQEVLESEVPVLVDFWAEWCGPCQMVLPIVEELAGE-VKNAKICKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E  E++  +++ SIPTL++FKDG+ +   + GA S+ ++   + 
Sbjct: 60  EQMELAKEFRVMSIPTLMVFKDGQKVKSEV-GAKSKEELKAMLE 102


>gi|11498883|ref|NP_070112.1| thioredoxin (trx-3) [Archaeoglobus fulgidus DSM 4304]
 gi|2649295|gb|AAB89961.1| thioredoxin (trx-3) [Archaeoglobus fulgidus DSM 4304]
          Length = 134

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 73/106 (68%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +K+++ +FD E L+ +  VVVDFWA WC PC  ++P+I+++A E A KV   KL+ +E
Sbjct: 31  SPVKLNSSNFD-ETLKNNENVVVDFWAEWCMPCKMIAPVIEELAKEYAGKVVFGKLNTDE 89

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  I+ RY IS+IPTLI FK GK +D+++ GA  +S++  W+   +
Sbjct: 90  NPTIAARYGISAIPTLIFFKKGKPVDQLV-GAMPKSELKRWVQRNL 134


>gi|315649370|ref|ZP_07902459.1| thioredoxin [Paenibacillus vortex V453]
 gi|315275358|gb|EFU38727.1| thioredoxin [Paenibacillus vortex V453]
          Length = 105

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 71/106 (66%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  ++F +EV E    VVVDFWA WC PC  L+PI+D+++ EL D VKI K++++
Sbjct: 1   MAIVNVTDQTFVNEV-EGEGTVVVDFWAPWCGPCKMLAPILDELSSELGDDVKIAKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E + R+ + SIPT+I FKDG+ +D+++ G +S+  +   I   
Sbjct: 60  ENPESAARFGVMSIPTMIFFKDGQPVDKVV-GLNSKEALKGIIAKH 104


>gi|254292399|ref|YP_003058422.1| thioredoxin [Hirschia baltica ATCC 49814]
 gi|254040930|gb|ACT57725.1| thioredoxin [Hirschia baltica ATCC 49814]
          Length = 304

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 63/106 (59%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
            +    ++F  +V+E S    V+VDFWA WC PC  L P ++ + ++   +V++ K++I+
Sbjct: 18  IIDGSDQTFMQDVVEASKHSLVLVDFWAPWCGPCKTLIPSLEKVVNQANGEVRMVKINID 77

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+  ++ +  + S+PT+  FKDG+ +D    GA  +S I+E+I   
Sbjct: 78  ENQGVAGQLGVRSVPTVFAFKDGQPVDGFQ-GAIPESQIVEFIKKA 122


>gi|327402280|ref|YP_004343118.1| thioredoxin [Fluviicola taffensis DSM 16823]
 gi|327317788|gb|AEA42280.1| thioredoxin [Fluviicola taffensis DSM 16823]
          Length = 105

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +++   +F+  VL+   PV+VDFWA WC PC  + PI++++A+E   K  I K++++
Sbjct: 1   MA-IEITDANFEELVLKSDKPVMVDFWAEWCGPCRLIGPIVEEMANEYEGKAIIGKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +  +S ++ I +IPT+I  K G++ D+ + GA  +  +   + + +
Sbjct: 60  LNPGVSAQFGIRNIPTIIFVKGGEIADKSV-GAVPKGQLTAKLDALI 105


>gi|255659620|ref|ZP_05405029.1| thioredoxin [Mitsuokella multacida DSM 20544]
 gi|260848181|gb|EEX68188.1| thioredoxin [Mitsuokella multacida DSM 20544]
          Length = 102

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 69/103 (66%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+ +  ++FDSEVL+    V++DFWA+WC PC  LSPI+D++A E    VK+ K++++
Sbjct: 1   MAAIVITKENFDSEVLKAEGTVLIDFWATWCGPCRMLSPIVDEVASE-HPDVKVGKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ I SIPTL++FK+G+ +   + G   +  +   +
Sbjct: 60  EQPELAQQFGIMSIPTLLVFKNGEKVQESV-GLIPKEKVEALL 101


>gi|295695287|ref|YP_003588525.1| thioredoxin [Bacillus tusciae DSM 2912]
 gi|295410889|gb|ADG05381.1| thioredoxin [Bacillus tusciae DSM 2912]
          Length = 106

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS  +V   +F S V + + PV+VDFWA WC PC  L+P++D++  E A K++I +L+++
Sbjct: 1   MS-KEVTDATFASRVEQVAGPVLVDFWAPWCGPCRMLAPVLDELEKEWAGKLEIYRLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++   + R+ I SIPTL+LFK+G+V+ + + G  +++ +   +   +
Sbjct: 60  DNPSTAGRFGIMSIPTLLLFKNGQVV-QQVIGYQNKARLSATLRPHL 105


>gi|242309921|ref|ZP_04809076.1| thioredoxin [Helicobacter pullorum MIT 98-5489]
 gi|239523218|gb|EEQ63084.1| thioredoxin [Helicobacter pullorum MIT 98-5489]
          Length = 105

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++   +FD  +      V+VDFWA WC PC  ++P+ID +A E A K KI K++ +E  
Sbjct: 5   IELTEANFDETI--KDGVVMVDFWAPWCGPCRMIAPVIDKLAGEYAGKAKICKVNTDEQQ 62

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+++++ I SIPT+  +K+G+ +D M+ GA++++   + I   +
Sbjct: 63  ELASKFGIRSIPTIFFYKNGEKVDEMI-GAATEAAFKDKIDKLL 105


>gi|152995552|ref|YP_001340387.1| thioredoxin [Marinomonas sp. MWYL1]
 gi|150836476|gb|ABR70452.1| thioredoxin [Marinomonas sp. MWYL1]
          Length = 148

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +    ++F   + +   PVVVDFWASWC PC + +PI   +A E++ K    KLD E++ 
Sbjct: 43  INGSDQNFRRYINDNDLPVVVDFWASWCGPCQQFAPIFAQVASEMSTKACFLKLDTEQNQ 102

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +  + I SIPTL++F  GK + R+  GA  ++   +W+   +
Sbjct: 103 MTAGGFNIRSIPTLMIFHHGKEVARL-SGALPKAQFKQWLDQNL 145


>gi|254500797|ref|ZP_05112948.1| thioredoxin, putative [Labrenzia alexandrii DFL-11]
 gi|222436868|gb|EEE43547.1| thioredoxin, putative [Labrenzia alexandrii DFL-11]
          Length = 314

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 65/105 (61%), Gaps = 3/105 (2%)

Query: 3   ALKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
              V T++F ++V+E S   PV+VDFWA WC PC +L+P+I+D        VK+ K++I+
Sbjct: 29  IFDVTTQTFMADVMEASRQQPVLVDFWAPWCGPCKQLTPLIEDAVKAAGGAVKLAKMNID 88

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           +  EI+ +  I SIP +I FKDG+ +D  M GA  +S I  +I  
Sbjct: 89  DHPEIAGQMGIQSIPAVIAFKDGQPVDGFM-GAQPESQIKAFIEK 132


>gi|218288416|ref|ZP_03492706.1| thioredoxin [Alicyclobacillus acidocaldarius LAA1]
 gi|218241389|gb|EED08563.1| thioredoxin [Alicyclobacillus acidocaldarius LAA1]
          Length = 106

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + +   +F    ++   PV+VDFWA+WC PC  ++P++++ A+  ADKVK+ KL+++
Sbjct: 1   MATMTLTDANFQQ-AIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVKVAKLNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+   ++++ I SIPTLILFK G+ + +++ G   +  +   +
Sbjct: 60  ENPVTTSQFGIMSIPTLILFKGGRPVKQLI-GYQPKEQLEAQL 101


>gi|148717317|dbj|BAF63672.1| protein disulfide isomerase-1 [Haemaphysalis longicornis]
          Length = 435

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++D  +F+  VL+  +  +V+F+A WC  C  L+P     A EL  KVK+  +D    
Sbjct: 153 VVELDESNFEELVLKSDDLWLVEFFAPWCGHCKNLAPHWAKAATELKGKVKLGAVDATVH 212

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRM----MPGASSQSDIIEW 102
             +++++ +   PT+  F  GK  DR       G  +  DI++W
Sbjct: 213 QGLASQFDVKGYPTIKFFPGGKK-DRHSAXEYNGGRTADDIVQW 255



 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 41/97 (42%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + +   +F + V++     +V+F+A WC  C   +P     A  L   VK+  +D ++ 
Sbjct: 26  VVDLSPANFKNRVVDSDEVWIVEFYAPWCGHCQSFAPEYTKAAAALKGIVKVGAVDADKD 85

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
             +  +Y +   PT+ +F   K       G  +   +
Sbjct: 86  KSLGGQYGVRGFPTVKIFGANKHNPTDYSGPRTADGV 122


>gi|194477218|ref|YP_002049397.1| Thioredoxin [Paulinella chromatophora]
 gi|171192225|gb|ACB43187.1| Thioredoxin [Paulinella chromatophora]
          Length = 111

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           SA  V   SF++E+L  + PV+VDFWA WC PC  L+PI+D+IA E   K+K+ KL+ +E
Sbjct: 6   SAADVTDASFETEILMSNIPVLVDFWAPWCGPCRMLAPIVDEIAKEFEGKLKVFKLNTDE 65

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +  I+++Y I SIPTL++F +G+ +D ++ GA  +S +   I   V
Sbjct: 66  NPTIASQYGIRSIPTLMIFNEGQKVDTVV-GAVPKSTLSVTIEKHV 110


>gi|291561706|emb|CBL40505.1| thioredoxin [butyrate-producing bacterium SS3/4]
          Length = 101

 Score = 97.6 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 66/103 (64%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MSA+ V+  +F+ EVL    PV++DFWA WC PC  + P + +   E    +K+ K++++
Sbjct: 1   MSAINVNKNNFNQEVLNSDKPVLMDFWAPWCGPCRMVVP-LVEEIAEERSDIKVVKINVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E  E++ ++ + SIPTL++ K+GKV+++   GA  ++ I+  +
Sbjct: 60  EEQELAMQFGVMSIPTLVVMKNGKVVNQA-TGARPKAQILAML 101


>gi|16079902|ref|NP_390728.1| thioredoxin [Bacillus subtilis subsp. subtilis str. 168]
 gi|221310791|ref|ZP_03592638.1| thioredoxin [Bacillus subtilis subsp. subtilis str. 168]
 gi|221315116|ref|ZP_03596921.1| thioredoxin [Bacillus subtilis subsp. subtilis str. NCIB 3610]
 gi|221320034|ref|ZP_03601328.1| thioredoxin [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221324316|ref|ZP_03605610.1| thioredoxin [Bacillus subtilis subsp. subtilis str. SMY]
 gi|296331602|ref|ZP_06874071.1| thioredoxin [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305675439|ref|YP_003867111.1| thioredoxin [Bacillus subtilis subsp. spizizenii str. W23]
 gi|321312383|ref|YP_004204670.1| thioredoxin [Bacillus subtilis BSn5]
 gi|135765|sp|P14949|THIO_BACSU RecName: Full=Thioredoxin; Short=Trx
 gi|134104434|pdb|2GZY|A Chain A, Solution Structures Of The Reduced Form Of Thioredoxin
           From Bacillus Subtilis
 gi|134104435|pdb|2GZZ|A Chain A, Solution Structures Of The Oxidized Form Of Thioredoxin
           From Bacillus Subtilis
 gi|142520|gb|AAA87315.1| thioredoxin [Bacillus subtilis subsp. subtilis str. 168]
 gi|1770044|emb|CAA99577.1| thioredoxin [Bacillus subtilis]
 gi|2635315|emb|CAB14810.1| thioredoxin [Bacillus subtilis subsp. subtilis str. 168]
 gi|291485281|dbj|BAI86356.1| thioredoxin [Bacillus subtilis subsp. natto BEST195]
 gi|296151197|gb|EFG92077.1| thioredoxin [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305413683|gb|ADM38802.1| thioredoxin [Bacillus subtilis subsp. spizizenii str. W23]
 gi|320018657|gb|ADV93643.1| thioredoxin [Bacillus subtilis BSn5]
          Length = 104

 Score = 97.6 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K   +SF +E       V+ DFWA WC PC  ++P+++++  E+ DK+KI K+D++
Sbjct: 1   MAIVKATDQSFSAET--SEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E + +Y + SIPTL++ KDG+V++  + G   +  + E +   +
Sbjct: 59  ENQETAGKYGVMSIPTLLVLKDGEVVETSV-GFKPKEALQELVNKHL 104


>gi|323702186|ref|ZP_08113853.1| thioredoxin [Desulfotomaculum nigrificans DSM 574]
 gi|323532873|gb|EGB22745.1| thioredoxin [Desulfotomaculum nigrificans DSM 574]
          Length = 108

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 65/109 (59%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+     +  ++F S + E   PV+VDFWA WC PC  ++P +  +ADEL  +V + KL+
Sbjct: 1   MAGNVTVLTDQNFKSTLQEAKIPVLVDFWADWCGPCKMIAPEVQKLADELQGQVLVCKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++E+ E      I SIPT+++FK+G+ ++R + G   + ++ E +   +
Sbjct: 61  VDENRETPNSLGIMSIPTMVIFKEGQEVERTI-GYRKKDELKEILQKHL 108


>gi|73540525|ref|YP_295045.1| thioredoxin [Ralstonia eutropha JMP134]
 gi|72117938|gb|AAZ60201.1| Thioredoxin [Ralstonia eutropha JMP134]
          Length = 310

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 67/105 (63%), Gaps = 5/105 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V  ++F+ EV+E S   PV+VDFWA WC PC  L P+++ +  E   K K+TK++
Sbjct: 30  MS--DVTLQNFEPEVIEASRQAPVLVDFWAPWCGPCRTLGPMLEKLEAEANGKWKLTKVN 87

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ++E+ E++  + + SIP ++ F DG+ +D+ + G   +S + E++
Sbjct: 88  VDENPELAAHFGVRSIPHVVAFADGEAVDQFI-GVLPESGLREFL 131


>gi|291303861|ref|YP_003515139.1| thioredoxin [Stackebrandtia nassauensis DSM 44728]
 gi|290573081|gb|ADD46046.1| thioredoxin [Stackebrandtia nassauensis DSM 44728]
          Length = 106

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   SF ++VL+   PV+VDFWA WC PC K+SP+++++A E++DKV++ K+D + +   
Sbjct: 7   VTDASFKADVLDADKPVLVDFWAEWCGPCRKVSPVLEELATEMSDKVRVVKVDTDANPNT 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
             +YQI S+PT++LFK G+ +  ++ GA  +S+I + I S
Sbjct: 67  MRQYQIMSVPTIMLFKGGEQVGAIV-GAKPKSEIRKLIES 105


>gi|94311572|ref|YP_584782.1| thioredoxin [Cupriavidus metallidurans CH34]
 gi|93355424|gb|ABF09513.1| thioredoxin domain-containing protein [Cupriavidus metallidurans
           CH34]
          Length = 280

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 67/106 (63%), Gaps = 5/106 (4%)

Query: 1   MSALKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   V  ++F+++V+E S   PV+VDFWA WC PC  L P+++ +  E   K ++ K++
Sbjct: 1   MS--DVTLQNFEADVIEMSRQVPVLVDFWAPWCGPCRTLGPMLEKLEAESGGKWRLAKVN 58

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           ++E+ E++  + + SIP ++ F DG+ +D+ + G   +S + E++ 
Sbjct: 59  VDENQELAAHFGVRSIPHVVAFADGQAVDQFI-GVLPESQLREFLD 103


>gi|296137592|ref|YP_003644834.1| thioredoxin [Thiomonas intermedia K12]
 gi|295797714|gb|ADG32504.1| thioredoxin [Thiomonas intermedia K12]
          Length = 138

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 57/102 (55%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + +   +F+  + +   PV+VDFWA WC PC  ++P     A +L  +  + K+D + 
Sbjct: 36  APVTLTDANFERFIAKSELPVLVDFWAEWCGPCKMMAPQFAQAAIQLQGRAVLAKVDTDA 95

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + ++S R +I SIPTL L++ G+ + R   G     +++ W+
Sbjct: 96  NPQVSVRSRIRSIPTLALYRGGQEVKR-QSGVMPAQELVRWV 136


>gi|255693698|ref|ZP_05417373.1| thioredoxin [Bacteroides finegoldii DSM 17565]
 gi|260620515|gb|EEX43386.1| thioredoxin [Bacteroides finegoldii DSM 17565]
          Length = 104

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   ++  E+L    PVVVDFWA WC PC  ++PII+++A E   +V I K D++
Sbjct: 1   MA-LEITDSNY-KEILAEGKPVVVDFWAPWCGPCKMVAPIIEELAAEFEGQVIIGKCDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+S++   Y I +IPT++ FK+G+++D+ + GA S+   +E +   +
Sbjct: 59  ENSDLPAEYGIRNIPTVLFFKNGEIVDKQV-GAVSKPVFVEKVKKLL 104


>gi|294341951|emb|CAZ90380.1| Thioredoxin C-3 [Thiomonas sp. 3As]
          Length = 138

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 57/102 (55%), Gaps = 1/102 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + +   +F+  + +   PV+VDFWA WC PC  ++P     A +L  +  + K+D + 
Sbjct: 36  APVTLTDANFERFIAKSELPVLVDFWAEWCGPCKMMAPQFAQAATQLQGRAVLAKVDTDA 95

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + ++S R +I SIPTL L++ G+ + R   G     +++ W+
Sbjct: 96  NPQVSVRSRIRSIPTLALYRGGQEVKR-QSGVMPAQELVRWV 136


>gi|225024209|ref|ZP_03713401.1| hypothetical protein EIKCOROL_01081 [Eikenella corrodens ATCC
           23834]
 gi|224943234|gb|EEG24443.1| hypothetical protein EIKCOROL_01081 [Eikenella corrodens ATCC
           23834]
          Length = 108

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   +     +F+ +VL+   PV++DFWA WC PC  ++PI+DDIA+E   K+++ K++
Sbjct: 1   MSNQIIHTSDAAFEKDVLKAELPVLLDFWAPWCGPCKMIAPILDDIAEEFQGKLQVVKMN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I+E+ +   ++ +  IPTL++F  G+ +   + GA S+  + +++ + +
Sbjct: 61  IDENEQTPAQFGVRGIPTLMVFNGGQRVATKV-GALSKGQLTDFLNASL 108


>gi|323705240|ref|ZP_08116815.1| thioredoxin [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535142|gb|EGB24918.1| thioredoxin [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 110

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 78/111 (70%), Gaps = 5/111 (4%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   +FD+EV     PV+VDFWA+WC PC  ++P+++++A+E +DK+K+ KL+++
Sbjct: 1   MKPINVTDMNFDTEVYNSDKPVLVDFWAAWCGPCRMMAPVLEEVAEEYSDKIKVVKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII----EWILSRV 107
           E+  I+++Y+I SIPTL +F++G+++D+++ G   +  +      +I ++V
Sbjct: 61  ENPLIASQYRIMSIPTLGVFQNGQLVDKVI-GFMPKEQLEYRLARYIDAQV 110


>gi|224128157|ref|XP_002329095.1| thioredoxin m [Populus trichocarpa]
 gi|222869764|gb|EEF06895.1| thioredoxin m [Populus trichocarpa]
          Length = 119

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S VLE  +PV+V+FWA WC PC  + PIID++A +   K+K  K++ ++ 
Sbjct: 16  VASVTDATWKSVVLESESPVLVEFWAPWCGPCRMIHPIIDELATQYTGKLKCYKVNTDDC 75

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+T+Y I SIPT+I+FK+G+  + ++ GA  ++ +   I   +
Sbjct: 76  PSIATQYGIRSIPTVIIFKNGEKKEAII-GAVPKTTLTTTIEKFL 119


>gi|298207575|ref|YP_003715754.1| thioredoxin [Croceibacter atlanticus HTCC2559]
 gi|83850211|gb|EAP88079.1| thioredoxin [Croceibacter atlanticus HTCC2559]
          Length = 105

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+   PV+VDFWA+WC PC  + PIIDDI+ +   K  + KLD++
Sbjct: 1   MA-LEITDANFEDTVLKSDKPVMVDFWAAWCGPCRMVGPIIDDISKDYEGKAVVGKLDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++F++G+V+ R + G + ++   E + + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFQNGEVVGRQV-GVAPKNTYAEALDALL 105


>gi|302543975|ref|ZP_07296317.1| thioredoxin [Streptomyces hygroscopicus ATCC 53653]
 gi|302461593|gb|EFL24686.1| thioredoxin [Streptomyces himastatinicus ATCC 53653]
          Length = 109

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V    F+  VL+   PV+VDFWA+WC PC +++P ++ IA E ADK+ I KL+I+E
Sbjct: 4   ATVTVTDADFEETVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHADKIVIAKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +   + +Y + SIPTL +++ G  + + + GA  ++ I 
Sbjct: 64  NPATAAKYGVMSIPTLNVYQGG-EVAKTIVGAKPKAAIE 101


>gi|114798336|ref|YP_760583.1| thioredoxin [Hyphomonas neptunium ATCC 15444]
 gi|114738510|gb|ABI76635.1| thioredoxin [Hyphomonas neptunium ATCC 15444]
          Length = 106

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+A+ V+   FD  V E   PVVVDFWA WC PC ++SP ++ +++E+  KVKI K++++
Sbjct: 1   MAAINVNEDDFDGVVTESETPVVVDFWAEWCGPCKQMSPHLEAVSEEMTGKVKIVKVNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   +  RY +  +PTL++FK GKV      GA ++  + +WI   +
Sbjct: 61  DYPLVGARYGVRGLPTLLMFKGGKVTATR-NGAMNRQALTDWIKQSL 106


>gi|225012069|ref|ZP_03702506.1| thioredoxin [Flavobacteria bacterium MS024-2A]
 gi|225003624|gb|EEG41597.1| thioredoxin [Flavobacteria bacterium MS024-2A]
          Length = 105

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 68/105 (64%), Gaps = 2/105 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +FD  VL+   PV+VDFWA+WC PC  + PII++++++   K  + K+D++
Sbjct: 1   MA-LEITDATFDEVVLKSDKPVLVDFWAAWCGPCRMVGPIIEELSNDYIGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            + E + +Y + +IPT+++F  G+++ R + G S ++   E I +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFDKGELVGRHV-GVSPKTTYAEAIDA 103


>gi|239909076|ref|YP_002955818.1| thioredoxin [Desulfovibrio magneticus RS-1]
 gi|239798943|dbj|BAH77932.1| thioredoxin [Desulfovibrio magneticus RS-1]
          Length = 146

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/101 (37%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + + + +FD  + +   PVVVDFWA WC PC  ++P  D  A  L  +V + K D E   
Sbjct: 44  VTLTSANFDVFLAKSDLPVVVDFWAPWCGPCRGMAPAFDQAAAMLHPRVILAKCDTEAEP 103

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            I++R +I  +PTL LF+ G+   R + GA S +DI+ W+ 
Sbjct: 104 AIASRLRIQGVPTLALFQGGREKAR-ISGARSAADIVAWVR 143


>gi|330959951|gb|EGH60211.1| thioredoxin [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 290

 Score = 97.6 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 60/107 (56%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
                T +FD  V++     PV+VDFWA WC PC  L P++  I +    ++ + K+D +
Sbjct: 8   IFDATTATFDQLVIDKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVDCD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  R+ I S+PT++LFKDG+ +D    GA  +S+I + +   V
Sbjct: 68  AEPDVVARFGIRSLPTVVLFKDGQPVDGF-AGAQPESEIRKILEQHV 113


>gi|167751539|ref|ZP_02423666.1| hypothetical protein EUBSIR_02540 [Eubacterium siraeum DSM 15702]
 gi|167655347|gb|EDR99476.1| hypothetical protein EUBSIR_02540 [Eubacterium siraeum DSM 15702]
 gi|291557134|emb|CBL34251.1| thioredoxin [Eubacterium siraeum V10Sc8a]
          Length = 102

 Score = 97.6 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V +++F  EVL+   PV+VDFWASWC PC  L P+++++ +E   ++KI K++ +
Sbjct: 1   MSHIDVTSENFKQEVLQSDKPVLVDFWASWCGPCRMLGPVLEELGEE-HPEIKICKVNTD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           +  E++  + I SIP +I FKDGK ID+ + G  S+  ++  + 
Sbjct: 60  DERELAISFGIDSIPCVISFKDGKQIDKSV-GFVSKDKLLALLD 102


>gi|115352027|ref|YP_773866.1| thioredoxin [Burkholderia ambifaria AMMD]
 gi|115282015|gb|ABI87532.1| thioredoxin [Burkholderia ambifaria AMMD]
          Length = 109

 Score = 97.6 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+     T  F+ +V++   PV+VDFWA WC PC  ++P +++I++EL  K+++ K+DI+
Sbjct: 1   MATRSTTTFDFEDDVIQSKTPVLVDFWAPWCPPCRAIAPSLEEISNELEGKLQVIKVDID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           ++ E++ R+ + SIPTL +F DGK + + + GA  +  +   I
Sbjct: 61  QNPELAQRFGVRSIPTLKVFVDGK-VAKEIVGAMPKQALQAQI 102


>gi|167855578|ref|ZP_02478338.1| thioredoxin [Haemophilus parasuis 29755]
 gi|167853269|gb|EDS24523.1| thioredoxin [Haemophilus parasuis 29755]
          Length = 104

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 67/104 (64%), Gaps = 2/104 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  +     SF+ +VL+   PV++DFWA WC PC  + P++DD+A  L +K +I K+++
Sbjct: 1   MSRVIHTTDASFEQDVLKSDVPVLLDFWAPWCGPCRAIGPVLDDLAINLGNKARIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +E+ +I   + + SIP L++FK+G+V+ + + GA +    +E +
Sbjct: 61  DENQQIPAEFGVRSIPFLLIFKNGEVVAQQV-GAQNLPAFLEHL 103


>gi|288921195|ref|ZP_06415481.1| thioredoxin [Frankia sp. EUN1f]
 gi|288347402|gb|EFC81693.1| thioredoxin [Frankia sp. EUN1f]
          Length = 108

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F +EVL+   PV+VDFWA WC PC  ++P++++IA E  +K++I KL+I+++ ++
Sbjct: 8   VTDDTFATEVLKSDKPVLVDFWAEWCGPCKMVAPVLEEIAKEHGEKLRIVKLNIDDNPQV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +  YQI SIPT+ +F +G  +DR + GA  ++ ++
Sbjct: 68  AREYQIMSIPTMAVFVNG-EVDRTIVGAKPKAALL 101


>gi|148655160|ref|YP_001275365.1| thioredoxin [Roseiflexus sp. RS-1]
 gi|148567270|gb|ABQ89415.1| thioredoxin [Roseiflexus sp. RS-1]
          Length = 259

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M    +   +FD  V     PV+VDFWA WC PC  ++P ++ +A E A +  + KL+++
Sbjct: 150 MPV-TLSDATFDQIVARSDQPVLVDFWAPWCGPCRAVAPAVERLAQEFAGRAVVAKLNVD 208

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           ++   + R+ ISSIP L +FK G+V++R++ GA     + + +   
Sbjct: 209 DNPRTAQRFGISSIPALYIFKGGRVVERLI-GAQPYPVLRQALARH 253



 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 15  VLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSI 74
           VL    PVV+ F    C  C +L  +I+ +A   A +V + ++D +++  +  +Y I+++
Sbjct: 17  VLRAGLPVVLIFDRHGCPTCQQLDGVIERLAKLFAGRVLLARVDADDNPALVRKYAITAL 76

Query: 75  PTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           P L+  K+G  + +   GA ++  +  W+
Sbjct: 77  PGLVFVKNGAPVAQ-TTGAVAEESLRAWL 104


>gi|158319046|ref|YP_001511554.1| thioredoxin [Frankia sp. EAN1pec]
 gi|158114451|gb|ABW16648.1| thioredoxin [Frankia sp. EAN1pec]
          Length = 108

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   +F +EVL+   PV+VDFWA WC PC  ++P++++IA E  +K++I KL+I+E+ E+
Sbjct: 8   VTDGTFAAEVLKSDKPVLVDFWAEWCGPCKMVAPVLEEIAKEHGEKLRIVKLNIDENPEV 67

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + +YQI SIPT+ +F +G  ID+ + GA  ++ ++  + S +
Sbjct: 68  ARQYQIMSIPTMAVFVNG-EIDKSIVGAKPKAALLRDLSSYI 108


>gi|330983631|gb|EGH81734.1| thioredoxin [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 105

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +  ++F+ +VL    PV+VDFWA WC PC  ++P +  IADE  + + I K++
Sbjct: 1   MSDRIITITAENFEEKVLRSEKPVLVDFWAEWCGPCKMIAPTLSRIADE-REGLVIGKVN 59

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           I+E   I+ +Y +  +PTL+LFK+G  +DR   GA S   + +++ +
Sbjct: 60  IDEFWSIAEKYGVRGVPTLMLFKNG-EVDRTKVGALSGEQLKKFLDA 105


>gi|21325864|dbj|BAC00485.1| Thiol-disulfide isomerase and thioredoxins [Corynebacterium
           glutamicum ATCC 13032]
          Length = 124

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + V  ++F S V++   PV+VDFWA WC PC KLSPII++IA E  DK  +  +D+
Sbjct: 18  MSNVVAVTEQTFKSTVIDSDKPVIVDFWAEWCGPCKKLSPIIEEIAGEYGDKAVVASVDV 77

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +    +   +QI SIP++++FK+G  ++  + G   +++I+E +   +
Sbjct: 78  DAERTLGAMFQIMSIPSVLIFKNGAKVEEFV-GLRPKNEIVEKLEKHL 124


>gi|224146552|ref|XP_002326048.1| thioredoxin m [Populus trichocarpa]
 gi|222862923|gb|EEF00430.1| thioredoxin m [Populus trichocarpa]
          Length = 195

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V  +++ S ++E   PV+V+FWA WC PC  + P+I +++ E   K+K  KL+ +ES   
Sbjct: 95  VTDETWQSLIIEADGPVLVEFWAPWCGPCRIIHPVIAELSTEYDGKLKCFKLNTDESPST 154

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +T+Y I SIPT+++FK+G+  D ++ G+  ++ +I  +   +
Sbjct: 155 TTKYGIRSIPTIMIFKNGEKKDAII-GSVPKTTLISNMKKFL 195


>gi|167747399|ref|ZP_02419526.1| hypothetical protein ANACAC_02119 [Anaerostipes caccae DSM 14662]
 gi|317471129|ref|ZP_07930500.1| thioredoxin [Anaerostipes sp. 3_2_56FAA]
 gi|167652761|gb|EDR96890.1| hypothetical protein ANACAC_02119 [Anaerostipes caccae DSM 14662]
 gi|316901344|gb|EFV23287.1| thioredoxin [Anaerostipes sp. 3_2_56FAA]
          Length = 147

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 7   DTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEIS 66
             ++F +EVL+   PV+VD +A+WC PC  + P+++++A E    VK+ KLDI+E+S+I+
Sbjct: 48  TNENFQAEVLDSEQPVLVDMFATWCGPCRMMGPVVEELAKEYEGSVKVGKLDIDENSDIA 107

Query: 67  TRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
            +Y + S+PT ++FK+G+ +   + GA  + ++   +   
Sbjct: 108 GQYGVMSVPTFLVFKNGQ-VAAKVVGAVPKEELKAAVDKA 146


>gi|86136736|ref|ZP_01055314.1| thioredoxin [Roseobacter sp. MED193]
 gi|85826060|gb|EAQ46257.1| thioredoxin [Roseobacter sp. MED193]
          Length = 108

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           MS + V  ++FD+EV   + PVVVDFWA WC PC ++ P ++++A E  DKVK+ K+D++
Sbjct: 3   MSTVAVTDETFDAEVKNSAVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKVVKVDVD 62

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +   +    +  IP L +FKDG+V+     GA+ ++ +  WI   +
Sbjct: 63  SNPNSAAAMGVRGIPALFIFKDGQVVSNR-AGAAPKAALQSWINESI 108


>gi|312200967|ref|YP_004021028.1| thioredoxin [Frankia sp. EuI1c]
 gi|311232303|gb|ADP85158.1| thioredoxin [Frankia sp. EuI1c]
          Length = 108

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +   V   +FD+EVL+   PV+VDFWA WC PC  ++P++++IA    D++++ KL+I+E
Sbjct: 4   ATTPVTDSTFDAEVLKSDKPVLVDFWAEWCGPCKMVAPVLEEIAATHGDQLRVVKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + + +  YQI SIPT+ +F DG  I + + GA  +S +++ +   +
Sbjct: 64  NPQTARAYQIMSIPTMAVFVDG-AIAKSIVGAKPKSVLLKDLAEYI 108


>gi|295394856|ref|ZP_06805069.1| thioredoxin [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972189|gb|EFG48051.1| thioredoxin [Brevibacterium mcbrellneri ATCC 49030]
          Length = 106

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +V   +F  EVL    PV+VDFWA WC PC  + PI+D+IA E ADK+K+ KL+ +
Sbjct: 1   MA-QEVTDATFKEEVLSSDLPVLVDFWAPWCGPCRMVGPIVDEIAQEQADKLKVVKLNTD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ E ++ Y I+SIP L +FK G  + + + GA  +  + + +   +
Sbjct: 60  DNLETASAYGITSIPALYVFKGG-EVAKTIIGARPKPALEQELAEFI 105


>gi|212633328|ref|YP_002309853.1| thioredoxin [Shewanella piezotolerans WP3]
 gi|212554812|gb|ACJ27266.1| Thioredoxin [Shewanella piezotolerans WP3]
          Length = 108

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           MS   + +   SF+++V+    PV+VDFWA WC PC  ++PI+DD+A+E A K+ + KL+
Sbjct: 1   MSDKIVYLSDDSFENDVINSELPVLVDFWAEWCGPCKMIAPILDDVAEEYAGKITVAKLN 60

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++++    +Y +  IPTL+LFK G++    + GA S++ + E+I  ++
Sbjct: 61  VDQNNVSPAKYGVRGIPTLLLFKAGELAATKV-GALSKTQLKEFIDGQL 108


>gi|261856921|ref|YP_003264204.1| thioredoxin [Halothiobacillus neapolitanus c2]
 gi|261837390|gb|ACX97157.1| thioredoxin [Halothiobacillus neapolitanus c2]
          Length = 147

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 61/103 (59%), Gaps = 1/103 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + +  ++F  ++     PV+VDFWA+WC PC  ++P+ + +A     K+++ KL+ E++ 
Sbjct: 43  ITLTDQNFARQIGRNDLPVLVDFWATWCGPCQMMAPVFEQLAGRQKTKLRVGKLETEQAP 102

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           + + R+ I SIPTLILF+ G+ + R   GA     +  W+  +
Sbjct: 103 QTAARFGIRSIPTLILFRGGQEVAR-TSGAMPLQALESWLQQQ 144


>gi|261409220|ref|YP_003245461.1| thioredoxin [Paenibacillus sp. Y412MC10]
 gi|329926890|ref|ZP_08281293.1| thioredoxin [Paenibacillus sp. HGF5]
 gi|261285683|gb|ACX67654.1| thioredoxin [Paenibacillus sp. Y412MC10]
 gi|328938877|gb|EGG35250.1| thioredoxin [Paenibacillus sp. HGF5]
          Length = 105

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 71/106 (66%), Gaps = 2/106 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ + V  ++F +EV E    VVVDFWA WC PC  L+PI+D+++ EL D VKI K++++
Sbjct: 1   MAIVNVTDQTFVNEV-EGQGTVVVDFWAPWCGPCKMLAPILDELSSELGDDVKIAKVNVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E + R+ + SIPT+I FKDG+ +D+++ G +S+  +   I   
Sbjct: 60  ENPESAARFGVMSIPTMIFFKDGQPVDKVV-GLNSKEALKGIIAKH 104


>gi|1729942|sp|P80579|THIO_ALIAC RecName: Full=Thioredoxin; Short=Trx
 gi|6980431|pdb|1QUW|A Chain A, Solution Structure Of The Thioredoxin From Bacillus
           Acidocaldarius
          Length = 105

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 66/102 (64%), Gaps = 2/102 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + +   +F    ++   PV+VDFWA+WC PC  ++P++++ A+  ADKV + KL+++E
Sbjct: 1   ATMTLTDANFQQ-AIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDE 59

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E ++++ I SIPTLILFK G+ + +++ G   +  +   +
Sbjct: 60  NPETTSQFGIMSIPTLILFKGGRPVKQLI-GYQPKEQLEAQL 100


>gi|269964191|ref|ZP_06178484.1| thioredoxin [Vibrio harveyi 1DA3]
 gi|269831074|gb|EEZ85240.1| thioredoxin [Vibrio harveyi 1DA3]
          Length = 144

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F S +LE + PVVVDFWA WC PCV  +P+  D+A E     +  K+D E 
Sbjct: 39  APIEGTVDNF-SALLESNTPVVVDFWAPWCNPCVGFAPVFSDVAQEQTGNARFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++ ++ I SIPT+++FK+G+ +D M+ GA  ++   +W+   +
Sbjct: 98  QQQLAAQFGIRSIPTIMVFKNGQRVD-MINGALPKTQFDQWLNQAL 142


>gi|325677535|ref|ZP_08157199.1| thioredoxin [Rhodococcus equi ATCC 33707]
 gi|325551782|gb|EGD21480.1| thioredoxin [Rhodococcus equi ATCC 33707]
          Length = 107

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 70/102 (68%), Gaps = 2/102 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + ++  SF  EVL+   PV+VDFWA+WC PC  ++P++++IA E  DK+ I KLDI
Sbjct: 1   MANTITINDDSFKQEVLDAEKPVLVDFWATWCGPCKMVAPVLEEIAGEHGDKLTIAKLDI 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIE 101
           +++   +  +Q+ SIPT+ILF+ GK +  ++ GA  ++ +++
Sbjct: 61  DQNPGAARDFQVMSIPTMILFQGGKPVKTIV-GAKGKAALLK 101


>gi|34810800|pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of Thioredoxin
           From Alicyclobacillus Acidocaldarius
 gi|34810801|pdb|1NW2|B Chain B, The Crystal Structure Of The Mutant R82e Of Thioredoxin
           From Alicyclobacillus Acidocaldarius
 gi|34810802|pdb|1NW2|C Chain C, The Crystal Structure Of The Mutant R82e Of Thioredoxin
           From Alicyclobacillus Acidocaldarius
 gi|34810803|pdb|1NW2|D Chain D, The Crystal Structure Of The Mutant R82e Of Thioredoxin
           From Alicyclobacillus Acidocaldarius
 gi|34810804|pdb|1NW2|E Chain E, The Crystal Structure Of The Mutant R82e Of Thioredoxin
           From Alicyclobacillus Acidocaldarius
 gi|34810805|pdb|1NW2|F Chain F, The Crystal Structure Of The Mutant R82e Of Thioredoxin
           From Alicyclobacillus Acidocaldarius
 gi|34810806|pdb|1NW2|G Chain G, The Crystal Structure Of The Mutant R82e Of Thioredoxin
           From Alicyclobacillus Acidocaldarius
 gi|34810807|pdb|1NW2|H Chain H, The Crystal Structure Of The Mutant R82e Of Thioredoxin
           From Alicyclobacillus Acidocaldarius
          Length = 105

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 66/102 (64%), Gaps = 2/102 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + +   +F    ++   PV+VDFWA+WC PC  ++P++++ A+  ADKV + KL+++E
Sbjct: 1   ATMTLTDANFQQ-AIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDE 59

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           + E ++++ I SIPTLILFK G+ + +++ G   +  +   +
Sbjct: 60  NPETTSQFGIMSIPTLILFKGGEPVKQLI-GYQPKEQLEAQL 100


>gi|325290211|ref|YP_004266392.1| thioredoxin [Syntrophobotulus glycolicus DSM 8271]
 gi|324965612|gb|ADY56391.1| thioredoxin [Syntrophobotulus glycolicus DSM 8271]
          Length = 107

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 73/108 (67%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+      ++++ +EVL+   PV+VDFWASWC PC  + P+++++A +   KV + KL++
Sbjct: 1   MADVKTFTSQNWQNEVLDADKPVLVDFWASWCGPCRMIGPVVEELAGDYDGKVIVGKLNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E  EI+ +Y I SIP+L+LFK+G++ ++ + G   + D+++ I S +
Sbjct: 61  DEQGEIAQKYGIMSIPSLLLFKNGQIKEKTV-GFRGKGDLVKIIDSSL 107


>gi|88807561|ref|ZP_01123073.1| Thioredoxin [Synechococcus sp. WH 7805]
 gi|88788775|gb|EAR19930.1| Thioredoxin [Synechococcus sp. WH 7805]
          Length = 108

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +        FD +VL+ S  V+VDFWA WC PC  + P++D  A+  + ++++ KL+++ 
Sbjct: 4   AVSDFTDAGFDQDVLKASGTVLVDFWAPWCGPCRLMVPLMDWAAETYSGRLQVGKLEVDG 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +      YQ+  IPTLILF+DG  I R   GA ++  +  ++ + +
Sbjct: 64  NPATRDAYQVQGIPTLILFRDGGEIGRH-EGAIARPQLQAFLDAHL 108


>gi|113968800|ref|YP_732593.1| thioredoxin [Shewanella sp. MR-4]
 gi|113883484|gb|ABI37536.1| thioredoxin [Shewanella sp. MR-4]
          Length = 140

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++ + +F +   +   P+VVDFWASWC PC   +P     A     + +  K++ EE
Sbjct: 36  APIELTSANFINHAHKSELPIVVDFWASWCGPCKSFAPTFSAAAKAWEPQFRFGKINTEE 95

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
              ++ ++ I SIPTL++FK G +I +   GA  +S + +W+ S
Sbjct: 96  QQALAAQFGIRSIPTLMIFKQGHLIAQ-QAGALPKSALDQWLQS 138


>gi|119385517|ref|YP_916573.1| thioredoxin [Paracoccus denitrificans PD1222]
 gi|119375284|gb|ABL70877.1| thioredoxin [Paracoccus denitrificans PD1222]
          Length = 107

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+    V    FDSEV +   PVVVDFWA WC PC ++ P ++++A E   +VKI K+++
Sbjct: 1   MANTQAVSDAEFDSEVRQSPTPVVVDFWAEWCGPCRQIGPSLEELAAEYEGRVKIVKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E+ E      +  IP L LFKDG+V+   + GA+ ++ +  WI   +
Sbjct: 61  DENPESPAALGVRGIPALFLFKDGQVVSNKI-GAAPKAALKAWIDESI 107


>gi|219872296|ref|YP_002476671.1| thioredoxin [Haemophilus parasuis SH0165]
 gi|219692500|gb|ACL33723.1| thioredoxin [Haemophilus parasuis SH0165]
          Length = 104

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 67/104 (64%), Gaps = 2/104 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  +     SF+ +VL+   PV++DFWA WC PC  + P++DD+A  L +K +I K+++
Sbjct: 1   MSTVIHTTDASFEQDVLKSDVPVLLDFWAPWCGPCRAIGPVLDDLAINLGNKARIVKMNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +E+ +I   + + SIP L++FK+G+V+ + + GA +    +E +
Sbjct: 61  DENQQIPAEFGVRSIPFLLIFKNGEVVAQQV-GAQNLPAFLEHL 103


>gi|311695614|gb|ADP98487.1| thioredoxin [marine bacterium HP15]
          Length = 127

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/104 (36%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L++  +SF +       PV+VDFWASWC PC  ++P  +  A +   KV+  KL+ E++
Sbjct: 22  VLELTDQSFAAHTGRSDVPVLVDFWASWCGPCKMMAPQFEQAAKDWRGKVRFAKLNTEQA 81

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
              + ++ I SIPT+ILF++G+ + R   GA +Q+ I +W+ S+
Sbjct: 82  QGPAGQFGIRSIPTMILFQNGREVAR-QSGAMNQAQISQWLQSK 124


>gi|239946630|ref|ZP_04698383.1| thioredoxin [Rickettsia endosymbiont of Ixodes scapularis]
 gi|241563468|ref|XP_002401716.1| thioredoxin, putative [Ixodes scapularis]
 gi|215501908|gb|EEC11402.1| thioredoxin, putative [Ixodes scapularis]
 gi|239920906|gb|EER20930.1| thioredoxin [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 105

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M++  V   SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+
Sbjct: 1   MAS-NVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELKGKVKVLKMNID 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+    + Y I SIPT++LFK+G+  D  + G   ++ +++WI   +
Sbjct: 60  ENPNTPSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWINKSI 105


>gi|6539614|gb|AAF15951.1|AF095752_1 thioredoxin m4 [Arabidopsis thaliana]
          Length = 193

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              +    + ++VLE   PV+V+FWA WC PC  + PI+D +A + A K K  K++ +ES
Sbjct: 88  VPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 147

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
                RY I S+PT+I+FK G+  D ++ GA  +  + + I   +
Sbjct: 148 PNTPNRYGIRSVPTVIIFKGGEKKDSII-GAVPRETLEKTIERFL 191


>gi|56421220|ref|YP_148538.1| thioredoxin (TRX) [Geobacillus kaustophilus HTA426]
 gi|56381062|dbj|BAD76970.1| thioredoxin (TRX) [Geobacillus kaustophilus HTA426]
          Length = 105

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +    ++F +E        +VDFWA WC PC  ++P+++++  E+ DKVKI K++++
Sbjct: 1   MAIVNATDQTFAAET--KDGLTLVDFWAPWCGPCRMIAPVLEELDREMGDKVKIVKVNVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E ++++ + SIPTL++FK+G+++D+ + G   +  +++ +   V
Sbjct: 59  ENQETASKFGVMSIPTLLVFKNGELVDKAI-GYQPKEALVQLVGKHV 104


>gi|294668875|ref|ZP_06733965.1| thioredoxin [Neisseria elongata subsp. glycolytica ATCC 29315]
 gi|291309172|gb|EFE50415.1| thioredoxin [Neisseria elongata subsp. glycolytica ATCC 29315]
          Length = 110

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +      F+ +VL+   PV++DFWA WC PC+ ++PI+D++A E   ++K+ K+
Sbjct: 1   MSSELIVHTSDADFERDVLQSDVPVLLDFWAPWCGPCIMIAPILDEVAAEFEGRLKVVKI 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+E+ +   ++ +  IPTL++FK+G+ +   + GA ++  +  ++ + +
Sbjct: 61  NIDENEQTPAKFGVRGIPTLMVFKNGQNVATKV-GALAKGQLTAFVNASI 109


>gi|224094047|ref|XP_002310066.1| thioredoxin x [Populus trichocarpa]
 gi|222852969|gb|EEE90516.1| thioredoxin x [Populus trichocarpa]
          Length = 120

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +  +++   F + VL    PV+V+F A+WC PC  +SP ++ +A E  D++ + K+D + 
Sbjct: 8   AITEINESEFQNVVLNSDRPVLVEFVATWCGPCRLISPAMESVAQEYGDRLTVVKIDHDA 67

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDR-MMPGASSQSDIIEWILSRV 107
           + ++   Y++  +P L+LFKDGK +      GA +++ + E++ + +
Sbjct: 68  NPKLIKEYKVYGLPALVLFKDGKEVPESRREGAITKAKLKEYVDALL 114


>gi|13474806|ref|NP_106376.1| thioredoxin [Mesorhizobium loti MAFF303099]
 gi|14025562|dbj|BAB52162.1| thioredoxin [Mesorhizobium loti MAFF303099]
          Length = 106

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 45/103 (43%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +KVD  +F SEVLE + PVVVDFWA WC PC  ++P +++I+ E+  K+K+ KL+I+
Sbjct: 1   MATVKVDINNFQSEVLESAAPVVVDFWAEWCDPCKMIAPSLEEISVEMESKIKVAKLNID 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E++ +  + SIP L +FK G+V D  + GA  ++ ++ WI
Sbjct: 61  ENPELAAQLGVRSIPALAIFKGGEVADFSV-GAKPKTALLNWI 102


>gi|307728044|ref|YP_003911257.1| thioredoxin [Burkholderia sp. CCGE1003]
 gi|307588569|gb|ADN61966.1| thioredoxin [Burkholderia sp. CCGE1003]
          Length = 408

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 1   MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS LK V    F+S V+    PV++DFWA WC PC  L P ++ ++     KV   K+++
Sbjct: 1   MSNLKSVTEADFESNVISNKLPVLLDFWAEWCGPCKSLMPTLEKVSTVYDGKVDFMKVNV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E++ +  R+ +  IPTLILF +G+ I R++ G  S S +  +I +++
Sbjct: 61  DENASVRDRFAVRGIPTLILFNEGREIARIV-GTKSSSQLSRFIDAQL 107


>gi|241161702|ref|XP_002408975.1| protein disulfide isomerase 1, putative [Ixodes scapularis]
 gi|215494444|gb|EEC04085.1| protein disulfide isomerase 1, putative [Ixodes scapularis]
          Length = 435

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            +++D  +F+  VL+  +  +V+F+A WC  C  L+P  +  A EL  KVK+  +D    
Sbjct: 153 VVELDESNFEELVLDSEDLWLVEFFAPWCGHCKNLAPHWEKAATELKGKVKLGAVDATVH 212

Query: 63  SEISTRYQISSIPTLILFKDGKV---IDRMMPGASSQSDIIEWILSR 106
             ++++Y I   PT+  F  GK          G  +  DI+ W L +
Sbjct: 213 QGLASKYGIKGFPTIKFFPGGKKDSSSAEEYNGGRTADDIVHWALEK 259



 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 49/113 (43%), Gaps = 8/113 (7%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            + + + +F + V++     +V+F+A WC  C   +P     A  L   VK+  +D ++ 
Sbjct: 26  VVDLSSANFRNRVVDSDEVWIVEFFAPWCGHCQSFAPEYIKAAAALKGVVKVGAVDADKD 85

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQS--------DIIEWILSRV 107
             ++ +Y +   PT+ +F   K       GA +          ++ + +  R+
Sbjct: 86  KSLAGQYGVRGFPTVKIFGVNKNSPTDFNGARTAEGVASAGLQELKKVVDQRL 138


>gi|189485014|ref|YP_001955955.1| thioredoxin [uncultured Termite group 1 bacterium phylotype Rs-D17]
 gi|170286973|dbj|BAG13494.1| thioredoxin [uncultured Termite group 1 bacterium phylotype Rs-D17]
          Length = 110

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+  +++  +F  EVL    PV+VDFWA WC PC  LSPII+++A E  D VK+ K++ +
Sbjct: 1   MAV-EINKNNFAQEVLSSDKPVLVDFWAPWCNPCKMLSPIIEELAAEYEDSVKVGKVNTD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+  +S ++QI SIP LILFK+GK + + + G  S++DI + I S +
Sbjct: 60  ENMSLSAKFQIVSIPCLILFKNGKTLHKTV-GFRSKNDIKKIIDSAL 105


>gi|297567396|ref|YP_003686368.1| thioredoxin [Meiothermus silvanus DSM 9946]
 gi|296851845|gb|ADH64860.1| thioredoxin [Meiothermus silvanus DSM 9946]
          Length = 112

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           M+  + V+  +FD  + E S  V+VDFWA WC PC  ++P+++++A E   KV + KLD+
Sbjct: 1   MAKPIDVNDGNFDQTLKENS-LVLVDFWAEWCGPCRMVAPVMEELASEYQGKVTVAKLDV 59

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           + + + + +Y++ SIPT+ILFK+G+    ++ GA  + +    +   V
Sbjct: 60  DANPKTAMKYRVMSIPTIILFKNGEP-AEVLVGAQPKRNFEARLQKHV 106


>gi|167765012|ref|ZP_02437133.1| hypothetical protein BACSTE_03406 [Bacteroides stercoris ATCC
           43183]
 gi|167697681|gb|EDS14260.1| hypothetical protein BACSTE_03406 [Bacteroides stercoris ATCC
           43183]
          Length = 104

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F  E+L    PVV+DFWA WC PC  + PII+++A E   K  I K D++
Sbjct: 1   MA-LEITDNNF-KEILAEGKPVVIDFWAPWCGPCKMVGPIIEELAGEYEGKALIGKCDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++  Y I +IPT++ FK+G+++D+ + G++ +      I + +
Sbjct: 59  ENGDVAAEYGIRNIPTVLFFKNGELVDKQV-GSAPKPTYAAKIEALL 104


>gi|114049060|ref|YP_739610.1| thioredoxin [Shewanella sp. MR-7]
 gi|113890502|gb|ABI44553.1| thioredoxin [Shewanella sp. MR-7]
          Length = 140

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++ + +F +   +   P+VVDFWASWC PC   +P     A     + +  K++ EE
Sbjct: 36  APIELTSANFINHAHKSELPIVVDFWASWCGPCKSFAPTFSAAAKAWEPQFRFGKINTEE 95

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
              ++ ++ I SIPTL++FK G +I +   GA  +S + +W+ S
Sbjct: 96  QQALAAQFGIRSIPTLMIFKQGHLIAQ-QAGALPKSALDQWLQS 138


>gi|241767385|ref|ZP_04765093.1| thioredoxin [Acidovorax delafieldii 2AN]
 gi|241361864|gb|EER58100.1| thioredoxin [Acidovorax delafieldii 2AN]
          Length = 302

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 63/106 (59%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + V  ++F++EV+      PV+VDFWA WC PC  L P+++ +  E A + K+ K+D ++
Sbjct: 2   IDVTVENFEAEVVAASMDVPVLVDFWAPWCGPCKSLGPVLEKLETEYAGRFKLVKIDSDQ 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++  + I SIPT +L  +G+ +D  M GA  +  + E++   V
Sbjct: 62  EQQLAGMFGIRSIPTCVLLMNGQPVDGFM-GALPEGQVREFLDKHV 106


>gi|224128376|ref|XP_002320314.1| predicted protein [Populus trichocarpa]
 gi|222861087|gb|EEE98629.1| predicted protein [Populus trichocarpa]
          Length = 358

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKIT--KLDIE 60
              +   +F++ VL+ +  V+V+F+A WC  C  L+P  + +A     +  +    LD +
Sbjct: 144 VAVLTADNFNNIVLDETKDVLVEFYAPWCGHCKNLAPTYEKVATAFKSEEDVVVANLDAD 203

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           +  +++ +Y +S  PTL  F  G        G     D + +I  +
Sbjct: 204 KHKDLAEKYGVSGFPTLKFFPKGNKAGEDYEGGRDLDDFVAFINEK 249



 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 3/104 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +F+ EV +     +V+F+A WC  C KL+P  +    +   A  V I K+D +
Sbjct: 26  VVVLTEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGSSFRKAKTVLIGKVDCD 84

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           E   + ++Y +S  PTL  F  G +  +   G  +   + E++ 
Sbjct: 85  EHKGVCSKYGVSGYPTLQWFPKGSLEPKKYEGPRTAEALTEYVN 128


>gi|161525474|ref|YP_001580486.1| thioredoxin [Burkholderia multivorans ATCC 17616]
 gi|189349797|ref|YP_001945425.1| thioredoxin 2 [Burkholderia multivorans ATCC 17616]
 gi|160342903|gb|ABX15989.1| thioredoxin [Burkholderia multivorans ATCC 17616]
 gi|189333819|dbj|BAG42889.1| thioredoxin 2 [Burkholderia multivorans ATCC 17616]
          Length = 145

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 36/104 (34%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           +++ T +F   V     P++VDFWA WC PC  ++P     A +L  +V++ K++ E   
Sbjct: 42  IELTTATFSRHVERSDLPLLVDFWAPWCGPCKMMAPQFQQAARQLEPRVRLAKVNTEAEP 101

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            ++ ++ I SIPTLILF+ G  + R   GA    D++ W+ SR+
Sbjct: 102 HLAAQFGIRSIPTLILFRGGHEVAR-QAGAMGAQDMVRWVASRL 144


>gi|330862874|emb|CBX73012.1| thioredoxin-2 [Yersinia enterocolitica W22703]
          Length = 138

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +    ++ D  +L+   PVV+DFWASWC PC   +PI  ++A E   KV+  K++ E 
Sbjct: 28  SVINATAETLDK-LLQDDLPVVIDFWASWCGPCRSFAPIFTEVAAERTGKVRFVKVNTEA 86

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +STR++I SIPT++L+++GK++D M+ GA  ++    W+  ++
Sbjct: 87  EPALSTRFRIRSIPTIMLYRNGKMVD-MLSGALPKAAFDNWLNEQL 131


>gi|332160629|ref|YP_004297206.1| thioredoxin 2 [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325664859|gb|ADZ41503.1| thioredoxin 2 [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 146

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +    ++ D  +L+   PVV+DFWASWC PC   +PI  ++A E   KV+  K++ E 
Sbjct: 36  SVINATAETLDK-LLQDDLPVVIDFWASWCGPCRSFAPIFTEVAAERTGKVRFVKVNTEA 94

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +STR++I SIPT++L+++GK++D M+ GA  ++    W+  ++
Sbjct: 95  EPALSTRFRIRSIPTIMLYRNGKMVD-MLSGALPKAAFDNWLNEQL 139


>gi|224538020|ref|ZP_03678559.1| hypothetical protein BACCELL_02909 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520367|gb|EEF89472.1| hypothetical protein BACCELL_02909 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 105

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   ++  E+L    PVV+DFWA WC PC  + PII+++A+    +V I K D++
Sbjct: 1   MA-LEITDSNY-KEILAEGKPVVIDFWAPWCGPCKMVGPIIEELAEMYEGQVLIGKCDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ +++  Y I +IPT++ FK+G+++D+ + G++S+S   + I   +
Sbjct: 59  ENGDVAAEYGIRNIPTVLFFKNGELVDKQV-GSASKSAFDDKIKKML 104


>gi|222112444|ref|YP_002554708.1| thioredoxin [Acidovorax ebreus TPSY]
 gi|221731888|gb|ACM34708.1| thioredoxin [Acidovorax ebreus TPSY]
          Length = 302

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 63/106 (59%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + V  ++F++EV+  S   PV+VDFWA WC PC  L P+++ +  E A +  + K+D ++
Sbjct: 2   IDVTLENFETEVVAASMQVPVLVDFWAPWCGPCKTLGPVLEKLEVEYAGRFTLAKIDSDQ 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++  + I SIPT +L  +G+ +D  M GA  +S +  ++   V
Sbjct: 62  EQQLAAMFGIRSIPTCVLMMNGQPVDGFM-GAQPESQLRAFLDKHV 106


>gi|305665419|ref|YP_003861706.1| thioredoxin [Maribacter sp. HTCC2170]
 gi|88710174|gb|EAR02406.1| thioredoxin [Maribacter sp. HTCC2170]
          Length = 105

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +FD  VL+   PVVVDFWA+WC PC  + PIID+++ E   K  + K+D++
Sbjct: 1   MA-LEITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPIIDEVSTEYDGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++FK G++++R + G S +    + I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFKGGEIVNRQV-GVSPKKVYTDAIDALL 105


>gi|331002703|ref|ZP_08326218.1| thioredoxin [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330407116|gb|EGG86620.1| thioredoxin [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 102

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 66/103 (64%), Gaps = 2/103 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+   + +++F+SEVL    PV+VD WA WC PC  LSPI+D++A+E          + +
Sbjct: 1   MAVKTITSENFESEVLNAKEPVLVDIWAPWCGPCKMLSPIVDEVAEEAVGFSVAKI-NAD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E+ E+  ++ + SIPTL++FK+G+V+++ + G  S+ ++   +
Sbjct: 60  ENPELVNKFHVMSIPTLLVFKNGEVVNKSV-GLISKDEVKALL 101


>gi|119773876|ref|YP_926616.1| thioredoxin 2 [Shewanella amazonensis SB2B]
 gi|119766376|gb|ABL98946.1| thioredoxin 2 [Shewanella amazonensis SB2B]
          Length = 140

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 34/104 (32%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++  ++FD+  ++   P+VVDFWA+WC PC   +P+    A+E+    +  KLD E 
Sbjct: 36  APMELTAENFDAHAVKSELPLVVDFWAAWCGPCQSFAPVFSAAAEEIEPGFRFGKLDTES 95

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
              ++ R+ I SIPTL++ K GK++ +   GA  +   I+W+  
Sbjct: 96  QQALAARFGIRSIPTLMVIKGGKILGQ-QAGAMPKQAFIQWLKQ 138


>gi|224131168|ref|XP_002328471.1| thioredoxin m [Populus trichocarpa]
 gi|222838186|gb|EEE76551.1| thioredoxin m [Populus trichocarpa]
          Length = 181

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V   S+DS V+ C  PV+V+FWA WC PC  ++P+ID++A E A K+   K++ ++   I
Sbjct: 79  VTDSSWDSLVIGCEIPVLVEFWAPWCGPCRMITPVIDELAAEYAGKIACFKVNTDDCPNI 138

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++Y I SIPT+++FK+G+  + ++ GA  ++ +   I   V
Sbjct: 139 ASQYAIRSIPTVLMFKNGEKKEGVI-GAVPKATLAAAIEKYV 179


>gi|87123716|ref|ZP_01079566.1| Thioredoxin [Synechococcus sp. RS9917]
 gi|86168285|gb|EAQ69542.1| Thioredoxin [Synechococcus sp. RS9917]
          Length = 108

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 63/106 (59%), Gaps = 1/106 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +       +F  EVL+ S PV+VDFWA+WC PC  ++P++D  A   AD++ + KL+++ 
Sbjct: 4   AVSDFTDAAFAQEVLQASKPVLVDFWATWCGPCRLMAPLMDWAAATYADRLDVGKLEVDG 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +      Y++  IPTLI+F++G  + R   GA ++  +  ++ + +
Sbjct: 64  NPATRDAYRVQGIPTLIIFQNGAELARH-EGAIAKPQLQAFLDAHL 108


>gi|147677386|ref|YP_001211601.1| thiol-disulfide isomerase and thioredoxins [Pelotomaculum
           thermopropionicum SI]
 gi|146273483|dbj|BAF59232.1| thiol-disulfide isomerase and thioredoxins [Pelotomaculum
           thermopropionicum SI]
          Length = 109

 Score = 97.2 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    L ++   F+  + E + PV+VDFWA WC PC  ++P++++IA+E   +V++ KL
Sbjct: 1   MASEKVLILNGSDFNRIISESATPVLVDFWADWCGPCKMIAPVVEEIAEEFEGQVRVGKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++E+  ++   ++ SIPTLILFK G+ ++R + G  ++ ++   +   +
Sbjct: 61  NVDENQSMAASLKVISIPTLILFKGGQEVERSI-GYKTKDELRRLLEKHL 109


>gi|330888059|gb|EGH20720.1| thioredoxin [Pseudomonas syringae pv. mori str. 301020]
          Length = 290

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
                  +FD  V+E     PV+VDFWA WC PC  L P++  I +    ++ + K++ +
Sbjct: 8   IFDATAANFDQLVIEKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +I  R+ I S+PT++LFKDG+ +D    GA  +S+I + +   V
Sbjct: 68  IEQDIVARFGIRSLPTVVLFKDGQPVDGF-AGAQPESEIRKILEQHV 113


>gi|312129864|ref|YP_003997204.1| thioredoxin [Leadbetterella byssophila DSM 17132]
 gi|311906410|gb|ADQ16851.1| thioredoxin [Leadbetterella byssophila DSM 17132]
          Length = 107

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 72/109 (66%), Gaps = 4/109 (3%)

Query: 1   MS--ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLD 58
           M+  AL++   +F  E++    PV+VDFWA WC PC  + P++++IA E  DK  + K+D
Sbjct: 1   MANNALEITDNNF-QEIISSDKPVLVDFWAEWCGPCKMIGPVVEEIAGEYQDKAVVGKMD 59

Query: 59  IEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++ +S I  ++ I SIPTL++FK G+++D+++ GA  +  +++ + + +
Sbjct: 60  VDANSAIPAQFGIRSIPTLMIFKGGELVDKIV-GAVPKHVLVQKLEAAL 107


>gi|302143024|emb|CBI20319.3| unnamed protein product [Vitis vinifera]
          Length = 188

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 65/106 (61%), Gaps = 4/106 (3%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +     ++ S VL+   PV+V+FWA WC PC  + P+I+++A +   K+K  K++ +E
Sbjct: 87  AVI---DATWQSLVLDADTPVLVEFWAPWCGPCRMIHPVINELAKQYTGKLKCYKVNTDE 143

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           S  I+TRY I SIPT+I+FK G+  + ++ GA  +S +   I   +
Sbjct: 144 SPSIATRYGIRSIPTVIIFKSGEKKEAII-GAVPKSTLTTSIEKFL 188


>gi|299469378|emb|CBG91907.1| putative PDI-like protein [Triticum aestivum]
          Length = 367

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+PI + +A        +   +++ 
Sbjct: 150 SVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVASVFKQDEGVVIANLDA 209

Query: 62  SS--EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
                ++ +Y +S  PTL  F  G              D +++I  +
Sbjct: 210 DKYTSLAEKYGVSGFPTLKFFPKGNKAGEEYESGRELDDFVKFINEK 256



 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            L +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 33  VLALTESTFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLAASFKKAKSVLIAKVDCD 91

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ S 
Sbjct: 92  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALTEYVNSE 137


>gi|225871920|ref|YP_002753374.1| thioredoxin [Acidobacterium capsulatum ATCC 51196]
 gi|225791288|gb|ACO31378.1| thioredoxin [Acidobacterium capsulatum ATCC 51196]
          Length = 110

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 66/102 (64%), Gaps = 4/102 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    ++V+  +F+ EVL+   PV+VDFWA WC PC  L+P +D++A + A K+K+ K+
Sbjct: 1   MAGAGVIEVNDATFEQEVLQSEQPVLVDFWAGWCGPCKALAPTVDEVAAQYAGKLKVAKM 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDI 99
           D++ ++    RY I  IP L++FK GKV D+++ G   +  I
Sbjct: 61  DVDRNASTPMRYGIRGIPALLIFKGGKVADQIV-GYVPKDVI 101


>gi|299469376|emb|CBG91906.1| putative PDI-like protein [Triticum aestivum]
          Length = 367

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+PI + +A        +   +++ 
Sbjct: 150 SVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVASVFKQDEGVVIANLDA 209

Query: 62  SS--EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
                ++ +Y +S  PTL  F  G              D +++I  +
Sbjct: 210 DKYTSLAEKYGVSGFPTLKFFPKGNKAGEEYESGRELDDFVKFINEK 256



 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            L +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 33  VLALTESTFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLAASFKKAKSVLIAKVDCD 91

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y IS  PT+  F  G +  +   G  +   + E++ S 
Sbjct: 92  EHKSVCSKYGISGYPTIQWFPKGSLEPKKYEGQRTAEALTEYVNSE 137


>gi|330447974|ref|ZP_08311622.1| thioredoxin [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328492165|dbj|GAA06119.1| thioredoxin [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 144

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  ++  + +F S +LE   PVVVDFWA WC PCV  +P+  D++ E   + +  K+D E
Sbjct: 39  MP-IEGTSDNF-STLLESDKPVVVDFWAPWCNPCVGFAPVFSDVSKERDGEARFVKIDTE 96

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +   ++ +Y+I SIPT+++FK GK++D M+ GA  +S   +W+   +
Sbjct: 97  DQQALAAQYRIRSIPTIMVFKGGKMVD-MLNGALPKSHFDQWLNEAL 142


>gi|213964027|ref|ZP_03392270.1| thioredoxin [Capnocytophaga sputigena Capno]
 gi|213953309|gb|EEB64648.1| thioredoxin [Capnocytophaga sputigena Capno]
          Length = 106

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/104 (33%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  VL+ S PV+VDFWA WC PC  L+P++++I+ E   +V + K+D++
Sbjct: 1   MA-LEITDGNFEELVLKSSQPVLVDFWAVWCGPCRMLAPVVEEISKEYEGRVVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
            + E + +Y I +IPT+++F++G+V+ R + G + +    + + 
Sbjct: 60  NNQEFAAKYGIRNIPTVLVFQNGEVVGRQV-GVAPKKTYTDALD 102


>gi|134104563|pdb|2IPA|A Chain A, Solution Structure Of Trx-Arsc Complex
          Length = 104

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ +K   +SF +E       V+ DFWA WC P   ++P+++++  E+ DK+KI K+D++
Sbjct: 1   MAIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           E+ E + +Y + SIPTL++ KDG+V++  + G   +  + E +   +
Sbjct: 59  ENQETAGKYGVMSIPTLLVLKDGEVVETSV-GFKPKEALQELVNKHL 104


>gi|91216592|ref|ZP_01253558.1| putative thioredoxin [Psychroflexus torquis ATCC 700755]
 gi|91185386|gb|EAS71763.1| putative thioredoxin [Psychroflexus torquis ATCC 700755]
          Length = 105

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            L++  K F  +VLE   PV+VDFWA+WC PC  + PIID++  E   K  I K+D++++
Sbjct: 2   TLEITDKDFQEKVLESDIPVLVDFWAAWCGPCRMVGPIIDELNTEYEGKAVIAKMDVDQN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            E + +Y + +IPT++ FK+G++++R + G + +    E I + +
Sbjct: 62  QEFAAKYGVRNIPTVLFFKNGEMVNRQV-GVAQKETYKEAIDNLL 105


>gi|297158781|gb|ADI08493.1| thioredoxin [Streptomyces bingchenggensis BCW-1]
          Length = 109

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 62/99 (62%), Gaps = 1/99 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + + V    F+  VL+   PV+VDFWA+WC PC +++P ++ IA E  DK+ I KL+I+E
Sbjct: 4   ATVTVTDADFEETVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIAAEHGDKIIIAKLNIDE 63

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDII 100
           +   + +Y + SIPTL +++ G  + + + GA  ++ I 
Sbjct: 64  NPTTAAKYGVMSIPTLNVYQGG-EVAKTIVGAKPKAAIE 101


>gi|296271528|ref|YP_003654160.1| thioredoxin [Thermobispora bispora DSM 43833]
 gi|296094315|gb|ADG90267.1| thioredoxin [Thermobispora bispora DSM 43833]
          Length = 107

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +  +V   +F  EVL+   PV+VDFWA WC PC +++PI+++IA+E ADK+ + K++I+E
Sbjct: 3   AIKEVTDATFQDEVLKSDKPVLVDFWAPWCGPCRQIAPILEEIANEYADKLTVVKMNIDE 62

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL 104
           + E    Y +  IPTL ++++G+V+ R + GA  +S ++  + 
Sbjct: 63  NMETPRNYGVLQIPTLNVYRNGEVV-RQIIGAKPKSMLLRELE 104


>gi|170734615|ref|YP_001773729.1| thioredoxin [Burkholderia cenocepacia MC0-3]
 gi|169820653|gb|ACA95234.1| thioredoxin [Burkholderia cenocepacia MC0-3]
          Length = 406

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 67/108 (62%), Gaps = 2/108 (1%)

Query: 1   MSALK-VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS LK V  ++ +++V+    PV+VDFWA WC PC  L+P +  ++++    V   K+D+
Sbjct: 1   MSNLKAVTLETIEADVINNPLPVLVDFWAPWCGPCKALAPTLSKLSEQFEGNVAFVKIDV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +E++ +  R+ +  IPTLIL +DGK + R++ G  S + +  +I + +
Sbjct: 61  DENAGVRERFGVRGIPTLILLRDGKELGRVV-GNRSATQLAGFIDNHL 107


>gi|120597382|ref|YP_961956.1| thioredoxin [Shewanella sp. W3-18-1]
 gi|120557475|gb|ABM23402.1| thioredoxin [Shewanella sp. W3-18-1]
          Length = 178

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + +++ + +F + V +   P+VVDFWASWC PC   +PI  + A     + +  K++ E+
Sbjct: 74  APIELTSANFTNHVTKSELPLVVDFWASWCGPCKSFAPIFSEAAKTWEPQFRFGKINTEQ 133

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
              ++ ++ I SIPTL++FK G ++ +   GA  +S   +W+ S
Sbjct: 134 QQSLAAQFNIRSIPTLMIFKQGHILAQ-QAGALPKSAFDQWLTS 176


>gi|153836887|ref|ZP_01989554.1| thioredoxin [Vibrio parahaemolyticus AQ3810]
 gi|149749845|gb|EDM60590.1| thioredoxin [Vibrio parahaemolyticus AQ3810]
          Length = 144

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++    +F S +LE S PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E   
Sbjct: 41  IEGTLDNF-SALLESSTPVVVDFWAPWCNPCVGFAPVFSDVAQEQAGTARFVKIDTEAQQ 99

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++ ++ + SIPT+++FK+G+ +D M+ GA  +S   +W+   +
Sbjct: 100 QLAAQFGVRSIPTIMVFKNGQRVD-MLNGALPKSQFDQWLNQAL 142


>gi|218676469|ref|YP_002395288.1| Thioredoxin 2 [Vibrio splendidus LGP32]
 gi|218324737|emb|CAV26384.1| Thioredoxin 2 [Vibrio splendidus LGP32]
          Length = 144

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++  + +F S +L  S PVVVDFWA+WC PCV  +P+  D+A E +  ++  K+D E 
Sbjct: 39  APIEGTSLNFQS-ILNSSQPVVVDFWATWCNPCVGFAPVFSDVAKERSGNIRFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++  YQI SIPT+++FKDGK +D  + GA  +    +W+   +
Sbjct: 98  QQQLAAMYQIRSIPTVMVFKDGKRVDT-INGALPKGQFDQWLNQAL 142


>gi|163753124|ref|ZP_02160248.1| thioredoxin [Kordia algicida OT-1]
 gi|161326856|gb|EDP98181.1| thioredoxin [Kordia algicida OT-1]
          Length = 106

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +F+  V+    PV+VDFWA+WC PC  L P+++ IA E   K  + KLD++
Sbjct: 1   MA-LEITDANFEEVVMNSDKPVLVDFWAAWCGPCKMLGPVVEQIAGEYEGKAVVGKLDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + + + ++ + +IPT+++F++G+++ R + G + ++   + +   +
Sbjct: 60  ANQQYAAQFGVRNIPTVLVFQNGELVGRQV-GVAPKNAYTDVLDKLL 105


>gi|28900827|ref|NP_800482.1| thioredoxin 2 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260362561|ref|ZP_05775481.1| thioredoxin-2 [Vibrio parahaemolyticus K5030]
 gi|260879193|ref|ZP_05891548.1| thioredoxin-2 [Vibrio parahaemolyticus AN-5034]
 gi|260896728|ref|ZP_05905224.1| thioredoxin-2 [Vibrio parahaemolyticus Peru-466]
 gi|28809273|dbj|BAC62315.1| thioredoxin 2 [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087292|gb|EFO36987.1| thioredoxin-2 [Vibrio parahaemolyticus Peru-466]
 gi|308094036|gb|EFO43731.1| thioredoxin-2 [Vibrio parahaemolyticus AN-5034]
 gi|308115249|gb|EFO52789.1| thioredoxin-2 [Vibrio parahaemolyticus K5030]
          Length = 144

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           ++    +F S +LE S PVVVDFWA WC PCV  +P+  D+A E A   +  K+D E   
Sbjct: 41  IEGTLDNF-SALLESSTPVVVDFWAPWCNPCVGFAPVFSDVAQEQAGTARFVKIDTEAQQ 99

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +++ ++ I SIPT+++FK+G+ +D M+ GA  +S   +W+   +
Sbjct: 100 QLAAQFGIRSIPTIMVFKNGQRVD-MLNGALPKSQFDQWLNQAL 142


>gi|311031407|ref|ZP_07709497.1| thioredoxin [Bacillus sp. m3-13]
          Length = 104

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 64/106 (60%), Gaps = 3/106 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+      ++F  E       V+ DFWA WC PC  ++P+++++  ++ DKVKI K+D++
Sbjct: 1   MAITNATDQNFTQET--GEGLVLADFWAPWCGPCKMIAPVLEELDQDMGDKVKIVKVDVD 58

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+ E + ++ + SIPTL++ K+G+V+D+ + G   +  + E +   
Sbjct: 59  ENQETAGKFGVMSIPTLLVIKNGEVVDKAV-GFQPKEALAELLNKH 103


>gi|237797508|ref|ZP_04585969.1| thioredoxin [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331020358|gb|EGI00415.1| thioredoxin [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 290

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 60/107 (56%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
                T +FD  V++     PV+VDFWA WC PC  L P++  I +    ++ + K++ +
Sbjct: 8   IFDATTATFDQMVIDKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              ++  R+ I S+PT++LFKDG+ +D    GA  +S+I + +   V
Sbjct: 68  AEPDVVARFGIRSLPTVVLFKDGQPVDGF-AGAQPESEIRKILEQHV 113


>gi|198284098|ref|YP_002220419.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218668168|ref|YP_002426752.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248619|gb|ACH84212.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218520381|gb|ACK80967.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 144

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 36/100 (36%), Positives = 59/100 (59%), Gaps = 1/100 (1%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           + + + SF   + +   PV+VDFWA WC PC  ++P  +     +  +V   K++ E+  
Sbjct: 41  VNLSSSSFSQYIQKNELPVLVDFWAPWCGPCRTMAPQFEQAGRAMRGRVLFAKVNTEDEP 100

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           +I  R+QI SIPT++LFK GK + RM  GA S +++  W+
Sbjct: 101 QIGNRFQIRSIPTMVLFKAGKELARM-SGAMSAAELQRWL 139


>gi|220923832|ref|YP_002499134.1| thioredoxin [Methylobacterium nodulans ORS 2060]
 gi|219948439|gb|ACL58831.1| thioredoxin [Methylobacterium nodulans ORS 2060]
          Length = 107

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 68/106 (64%), Gaps = 1/106 (0%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  + V   SF  +VLE S PVVV FWA  C  C  +SP +++I+ E+  +VKI KL+++
Sbjct: 1   MPTVMVTDASFKQDVLEASEPVVVVFWAEGCVSCQAISPALEEISSEMQGRVKIAKLNVD 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E+  I + Y I+ +PTL++FKDGK++ +   GA S+  ++ WI S 
Sbjct: 61  ENPGIVSEYGIAGVPTLMIFKDGKLVSQKF-GALSKGALLRWIQSA 105


>gi|318604498|emb|CBY25996.1| thioredoxin 2 [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 146

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S +    ++ D  +L+   PVV+DFWASWC PC   +PI  ++A E A KV+  K++ E 
Sbjct: 36  SVINATAETLDK-LLQDDLPVVIDFWASWCGPCRSFAPIFTEVAAERAGKVRFVKVNTEA 94

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +STR++I SIPT++L+++GK++D M+ GA  ++    W+  ++
Sbjct: 95  EPALSTRFRIRSIPTIMLYRNGKMVD-MLSGALPKAAFDNWLNEQL 139


>gi|222424840|dbj|BAH20372.1| AT2G47470 [Arabidopsis thaliana]
          Length = 249

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +FD  VL+ +  V+V+F+A WC  C  L+P  +      +  + V I  LD +
Sbjct: 31  VVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDAD 90

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               +  +Y +S  PTL  F           G     D + +I  +
Sbjct: 91  AHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEK 136


>gi|326334447|ref|ZP_08200659.1| thioredoxin [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325693414|gb|EGD35341.1| thioredoxin [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 158

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   SFD  VL+   PV+VDFWA+WC PC  L P+I+++A E   KV + K+D++
Sbjct: 54  MA-LQITDASFDEVVLKSDKPVLVDFWATWCGPCRMLGPVIEEVAKEYEGKVVVGKVDVD 112

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++FK+G+V+ R + G + +    + + S +
Sbjct: 113 SNQEFAAKYGVRNIPTVLVFKNGEVVGRQV-GVAPKKTYTDALDSLL 158


>gi|289647760|ref|ZP_06479103.1| thioredoxin [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 290

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
                  +FD  V++     PV+VDFWA WC PC  L P++  I +    ++ + K++ +
Sbjct: 8   IFDATAANFDQLVIDKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +I  R+ I S+PT++LFKDG+ +D    GA  +S+I + +   V
Sbjct: 68  IEQDIVARFGIRSLPTVVLFKDGQPVDGF-AGAQPESEIRKILEQHV 113


>gi|289628397|ref|ZP_06461351.1| thioredoxin [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|330869903|gb|EGH04612.1| thioredoxin [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 290

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
                  +FD  V++     PV+VDFWA WC PC  L P++  I +    ++ + K++ +
Sbjct: 8   IFDATAANFDQLVIDKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +I  R+ I S+PT++LFKDG+ +D    GA  +S+I + +   V
Sbjct: 68  IEQDIVARFGIRSLPTVVLFKDGQPVDGF-AGAQPESEIRKILEQHV 113


>gi|257483261|ref|ZP_05637302.1| thioredoxin, putative [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|298488885|ref|ZP_07006909.1| predicted thioredoxin [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298156560|gb|EFH97656.1| predicted thioredoxin [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|331012484|gb|EGH92540.1| thioredoxin [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 290

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 3/107 (2%)

Query: 3   ALKVDTKSFDSEVLEC--SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
                  +FD  V++     PV+VDFWA WC PC  L P++  I +    ++ + K++ +
Sbjct: 8   IFDATAANFDQLVIDKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCD 67

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
              +I  R+ I S+PT++LFKDG+ +D    GA  +S+I + +   V
Sbjct: 68  IEQDIVARFGIRSLPTVVLFKDGQPVDGF-AGAQPESEIRKILEQHV 113


>gi|37676567|ref|NP_936963.1| thioredoxin 2 [Vibrio vulnificus YJ016]
 gi|37201109|dbj|BAC96933.1| thiol-disulfide isomerase and thioredoxins [Vibrio vulnificus
           YJ016]
          Length = 144

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++    +F + +L+   PVVVDFWA WC PCV  +P+  D+A E   KV+  K++ E 
Sbjct: 39  APIEGTNDNF-AHLLQSDQPVVVDFWAPWCNPCVGFAPVFQDVAAERKGKVRFIKINTEI 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++ ++QI SIPT+++FK+G+ +D ++ GA  +S   +W+   +
Sbjct: 98  EQQLAAQFQIRSIPTVMVFKNGQRVD-VINGALPKSQFDQWLNQAL 142


>gi|299469360|emb|CBG91898.1| putative PDI-like protein [Triticum aestivum]
          Length = 367

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           S + +  ++FDS VL+ +  V+V+F+A WC  C  L+PI + +A        +   +++ 
Sbjct: 150 SVVVLTEETFDSVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVASVFKQDEGVVIANLDA 209

Query: 62  SS--EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
                ++  Y +S  PTL  F  G              D +++I  +
Sbjct: 210 DKYTSLAEEYGVSGFPTLKFFPKGNKAGEEYESGRELDDFVKFINEK 256



 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            L +   +F+ EV +     +V+F+A WC  C KL+P  +    + + A  V I K+D +
Sbjct: 33  VLALTESTFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLAASFKKAKSVLIAKVDCD 91

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
           E   + ++Y +S  PT+  F  G +  +   G  +   + E++ S 
Sbjct: 92  EHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALTEYVNSE 137


>gi|148982246|ref|ZP_01816669.1| thioredoxin 2 [Vibrionales bacterium SWAT-3]
 gi|145960580|gb|EDK25934.1| thioredoxin 2 [Vibrionales bacterium SWAT-3]
          Length = 144

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + ++  + +F S +L  S PVVVDFWA+WC PCV  +P+  D+A E +  V+  K+D E 
Sbjct: 39  APIEGTSLNFQS-ILNSSQPVVVDFWATWCNPCVGFAPVFSDVAKERSGDVRFVKIDTEA 97

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++  YQI SIPT+++FKDGK +D  + GA  +    +W+   +
Sbjct: 98  QQQLAAMYQIRSIPTVMVFKDGKRVDT-INGALPKGQFDQWLNQAL 142


>gi|325285769|ref|YP_004261559.1| thioredoxin [Cellulophaga lytica DSM 7489]
 gi|324321223|gb|ADY28688.1| thioredoxin [Cellulophaga lytica DSM 7489]
          Length = 105

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M+ L++   +FD  VL+   PVVVDFWA+WC PC  + PIID+++ E   K  + K+D++
Sbjct: 1   MA-LEITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPIIDEVSSEYEGKAVVGKVDVD 59

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + E + +Y + +IPT+++FK G+++ R + G S +    + I + +
Sbjct: 60  ANQEFAAKYGVRNIPTVLVFKGGEMVSRQV-GVSPKQVYTDAIDALL 105


>gi|118487008|gb|ABK95335.1| unknown [Populus trichocarpa]
          Length = 182

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   S+DS V+ C  PV+V+FWA WC PC  ++P+ID++A E A K+   K++ ++ 
Sbjct: 77  VQVVTDSSWDSLVIGCEIPVLVEFWAPWCGPCRMITPVIDELAAEYAGKIACFKVNTDDC 136

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             I+++Y I SIPT+++FK+G+  + ++ GA  ++ +   I   V
Sbjct: 137 PNIASQYAIRSIPTVLMFKNGEKKEGVI-GAVPKATLAAAIEKYV 180


>gi|121596217|ref|YP_988113.1| thioredoxin [Acidovorax sp. JS42]
 gi|120608297|gb|ABM44037.1| thioredoxin [Acidovorax sp. JS42]
          Length = 302

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 64/106 (60%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           + V  ++F++EV+  S   PV+VDFWA WC PC  L P+++ +  E A +  + K+D ++
Sbjct: 2   IDVTLENFETEVVAASMQVPVLVDFWAPWCGPCKTLGPVLEKLEVEYAGRFTLAKIDSDQ 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             +++  + I SIPT +L  +G+ +D  M GA ++S +  ++   V
Sbjct: 62  EQQLAAMFGIRSIPTCVLMMNGQPVDGFM-GAQTESQLRAFLDKHV 106


>gi|256833756|ref|YP_003162483.1| thioredoxin [Jonesia denitrificans DSM 20603]
 gi|256687287|gb|ACV10180.1| thioredoxin [Jonesia denitrificans DSM 20603]
          Length = 109

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + V   +FD+ VL+   PV+VDFWA WC PC +++PI++++A+E A ++ I KLD 
Sbjct: 1   MSHTVAVTDATFDTAVLQSDIPVLVDFWAEWCGPCRQVAPILEELAEEYAGRITIAKLDT 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           + +   + +Y I SIPTL ++K G+V+  ++ G   +  + + I +
Sbjct: 61  DANPATTMKYGIVSIPTLNIYKGGEVVATIVGG-RPRRQLAQEIDA 105


>gi|169334899|ref|ZP_02862092.1| hypothetical protein ANASTE_01305 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257637|gb|EDS71603.1| hypothetical protein ANASTE_01305 [Anaerofustis stercorihominis DSM
           17244]
          Length = 108

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 47/108 (43%), Positives = 75/108 (69%), Gaps = 4/108 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           M+    + +  ++F+SEV+    PV+VDFWA+WC PC  L+PIID+IA+E +DKVK+ K+
Sbjct: 1   MASENIVIITNENFESEVVNSDKPVMVDFWANWCGPCKGLAPIIDEIANEYSDKVKVGKV 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
           D++ + E+S ++++ SIPT+I FK+G+ I R + GA  +    E I S
Sbjct: 61  DVDANGELSMKFRVMSIPTVIFFKNGEQIAREV-GAFPKEKYAEIINS 107


>gi|242065894|ref|XP_002454236.1| hypothetical protein SORBIDRAFT_04g027260 [Sorghum bicolor]
 gi|241934067|gb|EES07212.1| hypothetical protein SORBIDRAFT_04g027260 [Sorghum bicolor]
          Length = 174

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
              V   ++ S V+E   PV+V FWASWC PC  + PI+  ++ E   K+K  KL+ +E+
Sbjct: 68  VPDVSKSTWQSLVVESELPVLVQFWASWCGPCKMIDPIVGKLSKEYEGKLKCYKLNTDEN 127

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            +I+T+  I SIPT+++FK+G+  D ++ GA  +S ++  I   V
Sbjct: 128 PDIATQLGIRSIPTMMIFKNGEKKDAVI-GAVPESTLVTCIDKYV 171


>gi|121592934|ref|YP_984830.1| thioredoxin [Acidovorax sp. JS42]
 gi|120605014|gb|ABM40754.1| thioredoxin [Acidovorax sp. JS42]
          Length = 145

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESS 63
           L +D  SFD  V     PVVVDFWA WC PC +++P     A EL  ++++ KLD E   
Sbjct: 44  LALDAASFDRHVARSHLPVVVDFWAPWCGPCRQMAPAFAQAARELEPRMRLAKLDTEAHP 103

Query: 64  EISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILS 105
            I+ RY I SIPT+ILF+ G+   R + GA   +DI  W+ S
Sbjct: 104 AIAARYGIRSIPTMILFRGGQEAAR-ISGALGAADIARWVQS 144


>gi|296135276|ref|YP_003642518.1| thioredoxin [Thiomonas intermedia K12]
 gi|295795398|gb|ADG30188.1| thioredoxin [Thiomonas intermedia K12]
          Length = 298

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +     +F++EV+E S+  PV+VD WA WC PC  L PI++ +      + K+ K++ EE
Sbjct: 2   IDATVANFETEVVEASHTVPVLVDLWAPWCGPCRALGPILEKLEVAYEGRFKLVKINTEE 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             E++  + + SIP ++L KDG+ +D  + GA  +  I E++   V
Sbjct: 62  EQELAAAFGVRSIPMVMLLKDGQPVDGFV-GALPEGQIREFLDKHV 106


>gi|309378855|emb|CBX22560.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 110

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL+   PV++DFWA WC PC  ++PI+DDIA E   ++K+ KL
Sbjct: 1   MSSELIVHTGDAAFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++    +R+ +  IPTL++FK+G+V+   + GA ++  +  ++ + +
Sbjct: 61  NIDDNEATPSRFGVRGIPTLMVFKNGEVVATKV-GALAKGQLTAFVEASI 109


>gi|124053398|sp|Q4UNK3|THIO_RICFE RecName: Full=Thioredoxin; Short=Trx
          Length = 105

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 47/103 (45%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 5   KVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSE 64
            V   SF  EVLE   PV+VDFWA WC PC  L+PIID+I+ EL  KVK+ K++I+E+  
Sbjct: 4   NVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELKGKVKVLKMNIDENPN 63

Query: 65  ISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           I + Y I SIPT++LFK+G+  D  + G   ++ +++WI   +
Sbjct: 64  IPSEYGIRSIPTIMLFKNGEQKDTKI-GLQQKNSLLDWINKSI 105


>gi|90578149|ref|ZP_01233960.1| thioredoxin 2 [Vibrio angustum S14]
 gi|90441235|gb|EAS66415.1| thioredoxin 2 [Vibrio angustum S14]
          Length = 144

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M  ++    +F S +L+   PVVVDFWA WC PCV  +P+  D++ E   +++  K+D E
Sbjct: 39  MP-IEGTEDNF-STLLKSDKPVVVDFWAPWCNPCVGFAPVFADVSQERDGQIRCVKIDTE 96

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
               ++ +Y+I SIPT+++FK+GK++D M+ GA  +S   +W+   +
Sbjct: 97  AQQALAAQYRIRSIPTIMVFKEGKMVD-MLNGAMPKSHFDQWLNEAL 142


>gi|25029490|ref|NP_739544.1| putative thioredoxin [Corynebacterium efficiens YS-314]
 gi|259508328|ref|ZP_05751228.1| thioredoxin-1 [Corynebacterium efficiens YS-314]
 gi|23494779|dbj|BAC19744.1| putative thioredoxin [Corynebacterium efficiens YS-314]
 gi|259164085|gb|EEW48639.1| thioredoxin-1 [Corynebacterium efficiens YS-314]
          Length = 107

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 1   MS-ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDI 59
           MS  + V  ++F S V+E   PV+VDFWA WC PC KLSPII++IA E  DK+ +  +D+
Sbjct: 1   MSNVIAVTEQTFKSTVVESDKPVLVDFWAEWCGPCKKLSPIIEEIAGEYGDKIVVASVDV 60

Query: 60  EESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +    +   +QI SIP++++FK G+ +D  + G   +++I+  +   +
Sbjct: 61  DAERTLGAMFQIMSIPSVLIFKGGQKVDEFV-GLRPKTEIVAKLEQHL 107


>gi|119718905|ref|YP_925870.1| thioredoxin [Nocardioides sp. JS614]
 gi|119539566|gb|ABL84183.1| thioredoxin [Nocardioides sp. JS614]
          Length = 108

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEI 65
           V    F+++VL+   PV+VDFWA WC PC +++PI+D+IA    DK+   K++++E+   
Sbjct: 7   VTDAEFEAQVLKSDKPVLVDFWAEWCGPCRQVAPILDEIATSHGDKITFLKMNVDENPVT 66

Query: 66  STRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            + Y+++ IPT+ +++ G+V+  ++ GA  ++ I+  +   +
Sbjct: 67  PSSYRVTGIPTINVYQGGEVVKSIV-GARPKAAILNELSEFI 107


>gi|332531644|ref|ZP_08407541.1| thioredoxin [Hylemonella gracilis ATCC 19624]
 gi|332039007|gb|EGI75436.1| thioredoxin [Hylemonella gracilis ATCC 19624]
          Length = 320

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 60/106 (56%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVL--ECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           L +   +F++EV+    + PV++DFWA WC PC  LSPI++ +      +  + K++ +E
Sbjct: 2   LDITADNFETEVILASQTTPVLLDFWAPWCGPCKSLSPILEKLEVAYGGRFTLAKVNSDE 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             E++  + I SIPT IL   G+ +D  M GA  +  + E++   +
Sbjct: 62  QQELAGAFGIRSIPTCILMIGGRPVDGFM-GALPEGKLREFLDKHL 106


>gi|294339378|emb|CAZ87734.1| putative Thioredoxin [Thiomonas sp. 3As]
          Length = 298

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 4   LKVDTKSFDSEVLECSN--PVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
           +     +F++EV+E SN  PV+VD WA WC PC  L PI++ +      + K+ K++ EE
Sbjct: 2   IDATVANFETEVVEASNTVPVLVDLWAPWCGPCRALGPILEKLEVAYEGRFKLVKINTEE 61

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
             E++  + + SIP ++L KDG+ +D  + GA  +  I E++   V
Sbjct: 62  EQELAAAFGVRSIPMVMLLKDGQPVDGFV-GALPEGQIREFLDKHV 106


>gi|78042898|ref|YP_359411.1| thioredoxin [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995013|gb|ABB13912.1| thioredoxin [Carboxydothermus hydrogenoformans Z-2901]
          Length = 107

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEES 62
            LK    +F+ EV+    PV+VDFWA WC PC  ++PII+ +A +   +VK+ KL+++E+
Sbjct: 2   VLKFTDANFEDEVINSDMPVLVDFWAEWCGPCRMIAPIIERLAIDYLGQVKVGKLNVDEN 61

Query: 63  SEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
            E +    I SIPT+++FKDGKV+D ++ G   ++   E I   +
Sbjct: 62  RETAIALGIMSIPTVMIFKDGKVLDTII-GYQPENVFREKIEKAL 105


>gi|261377497|ref|ZP_05982070.1| thioredoxin [Neisseria cinerea ATCC 14685]
 gi|269146231|gb|EEZ72649.1| thioredoxin [Neisseria cinerea ATCC 14685]
          Length = 110

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1   MS---ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKL 57
           MS    +     +F+ +VL    PV++DFWA WC PC  ++PI+DDIA E   ++K+ KL
Sbjct: 1   MSSELIVHTSDAAFEKDVLNADIPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKL 60

Query: 58  DIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           +I+++    +R+ +  IPTL++FK+G+V+   + GA ++  +  ++ + +
Sbjct: 61  NIDDNEATPSRFGVRGIPTLMVFKNGEVVATKV-GALAKGQLTAFVEASI 109


>gi|15226610|ref|NP_182269.1| UNE5 (UNFERTILIZED EMBRYO SAC 5); protein disulfide isomerase
           [Arabidopsis thaliana]
 gi|11132051|sp|O22263|PDI21_ARATH RecName: Full=Protein disulfide-isomerase like 2-1;
           Short=AtPDIL2-1; AltName: Full=P5; AltName: Full=Protein
           MATERNAL EFFECT EMBRYO ARREST 30; AltName: Full=Protein
           UNFERTILIZED EMBRYO SAC 5; AltName: Full=Protein
           disulfide isomerase 11; Short=AtPDI11; AltName:
           Full=Protein disulfide-isomerase A6; AltName:
           Full=Protein disulfide-isomerase like 4-1;
           Short=AtPDIL4-1; Flags: Precursor
 gi|2529680|gb|AAC62863.1| putative protein disulfide-isomerase [Arabidopsis thaliana]
 gi|18377789|gb|AAL67044.1| putative protein disulfide-isomerase [Arabidopsis thaliana]
 gi|20259223|gb|AAM14327.1| putative protein disulfide-isomerase [Arabidopsis thaliana]
 gi|24417274|gb|AAN60247.1| unknown [Arabidopsis thaliana]
 gi|38453637|emb|CAC81060.1| PDI-like protein [Arabidopsis thaliana]
 gi|330255751|gb|AEC10845.1| protein disulfide-isomerase A6 [Arabidopsis thaliana]
          Length = 361

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 2/106 (1%)

Query: 3   ALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIE 60
            + +   +FD  VL+ +  V+V+F+A WC  C  L+P  +      +  + V I  LD +
Sbjct: 143 VVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDAD 202

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSR 106
               +  +Y +S  PTL  F           G     D + +I  +
Sbjct: 203 AHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEK 248



 Score = 83.7 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 6   VDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDD--IADELADKVKITKLDIEESS 63
           +   SF+ EV       +V+F+A WC  C KL+P  +    + + A  V I K+D +E  
Sbjct: 28  LTDDSFEKEV-GKDKGALVEFYAPWCGHCKKLAPEYEKLGA