RPSBLAST alignment for GI: 254780822 and conserved domain: PRK03147

>gnl|CDD|179545 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Provisional. Length = 173
 Score = 46.9 bits (112), Expect = 1e-06
 Identities = 24/106 (22%), Positives = 52/106 (49%), Gaps = 25/106 (23%)

Query: 22  VVVDFWASWCRPCVKLSPIIDDIADELADK-VKITKLDIEES------------------ 62
           V ++FW +WC+PC K  P ++++  +  +K V+I  ++++E+                  
Sbjct: 64  VFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIAVNVDETELAVKNFVNRYGLTFPVA 123

Query: 63  ----SEISTRYQISSIPTLILF-KDGKVIDRMMPGASSQSDIIEWI 103
                ++   Y +  +PT  L  KDGKV+  ++ G  ++  + E++
Sbjct: 124 IDKGRQVIDAYGVGPLPTTFLIDKDGKVVK-VITGEMTEEQLEEYL 168