RPSBLAST alignment for GI: 254780822 and conserved domain: PTZ00443

>gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional. Length = 224
 Score = 56.2 bits (135), Expect = 2e-09
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 19  SNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLI 78
           + P  V F+A WC  C K++P  + +A  L  +V +  LD   +  ++ R+ I   PTL+
Sbjct: 52  TGPWFVKFYAPWCSHCRKMAPAWERLAKALKGQVNVADLDATRALNLAKRFAIKGYPTLL 111

Query: 79  LFKDGKV 85
           LF  GK+
Sbjct: 112 LFDKGKM 118