RPSBLAST alignment for GI: 254780822 and conserved domain: COG3118

>gnl|CDD|32932 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]. Length = 304
 Score = 94.6 bits (235), Expect = 6e-21
 Identities = 35/102 (34%), Positives = 62/102 (60%), Gaps = 3/102 (2%)

Query: 4   LKVDTKSFDSEVLECS--NPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEE 61
             V   +F+ EV++ S   PV+VDFWA WC PC +L+P ++ +A E   K K+ K++ + 
Sbjct: 26  KDVTEANFEQEVIQSSREVPVLVDFWAPWCGPCKQLTPTLEKLAAEYKGKFKLAKVNCDA 85

Query: 62  SSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
              ++ ++ + SIPT+  FKDG+ +D    GA  +S + +++
Sbjct: 86  EPMVAAQFGVQSIPTVYAFKDGQPVDGFQ-GAQPESQLRQFL 126