RPSBLAST alignment for GI: 254780822 and conserved domain: KOG0190

>gnl|CDD|35411 KOG0190, KOG0190, KOG0190, Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]. Length = 493
 Score = 63.0 bits (153), Expect = 1e-11
 Identities = 30/103 (29%), Positives = 56/103 (54%), Gaps = 5/103 (4%)

Query: 4   LKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADK---VKITKLDIE 60
           L +   +F  E +     V+V+F+A WC  C  L+P  +  A EL ++   VK+ K+D  
Sbjct: 28  LVLTKDNFK-ETINGHEFVLVEFYAPWCGHCKALAPEYEKAATELKEEGSPVKLAKVDAT 86

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWI 103
           E S+++++Y++   PTL +F++G+       G      I++W+
Sbjct: 87  EESDLASKYEVRGYPTLKIFRNGRSAQD-YNGPREADGIVKWL 128