RPSBLAST alignment for GI: 254780822 and conserved domain: KOG1731

>gnl|CDD|36942 KOG1731, KOG1731, KOG1731, FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning]. Length = 606
 Score = 41.5 bits (97), Expect = 5e-05
 Identities = 25/114 (21%), Positives = 50/114 (43%), Gaps = 8/114 (7%)

Query: 2   SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELAD---KVKITKLD 58
             +++D  +F++ V       +V+F+ SWC  C   +P     A +L      V++  +D
Sbjct: 40  PIIELDVDTFNAAVFGSRKAKLVEFYNSWCGHCRAFAPTFKKFAKDLEKWRPVVRVAAVD 99

Query: 59  --IEESSEISTRYQISSIPTLILFKDG---KVIDRMMPGASSQSDIIEWILSRV 107
              EE+ ++   + +S  PTL  F      K     + G    S+I + ++  +
Sbjct: 100 CADEENVKLCREFSVSGYPTLRYFPPDSQNKTDGSDVSGPVIPSEIRDQLIRTL 153