RPSBLAST alignment for GI: 254780822 and conserved domain: KOG3414

>gnl|CDD|38624 KOG3414, KOG3414, KOG3414, Component of the U4/U6.U5 snRNP/mitosis protein DIM1 [RNA processing and modification, Cell cycle control, cell division, chromosome partitioning]. Length = 142
 Score = 37.9 bits (88), Expect = 6e-04
 Identities = 18/83 (21%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 22  VVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFK 81
           VV+ F   W   C+K+  ++  IA+++++   I  +DI+E  +    Y++   PT++ F 
Sbjct: 26  VVIRFGRDWDPTCMKMDELLSSIAEDVSNFAVIYLVDIDEVPDFVKMYELYDPPTVMFFF 85

Query: 82  DGKVIDRMMPGASSQSDIIEWIL 104
           + K +   +   +  ++ I +  
Sbjct: 86  NNKHM--KIDLGTGDNNKINFAF 106