HHsearch alignment for GI: 254780824 and conserved domain: COG1419

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion].
Probab=95.56  E-value=0.12  Score=30.57  Aligned_cols=73  Identities=15%  Similarity=0.267  Sum_probs=49.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCC-CCCCEEEEEEECCCCHHHHHCCCHHHHCCCCE
Q ss_conf             89969999878786889999999976078885302452020110037-88608999865178977753058367508978
Q gi|254780824|r   31 RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERI  109 (162)
Q Consensus        31 ~~g~ii~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~l~~~Y~-~~~~i~H~DlYRL~~~~E~~~lg~~e~~~~~i  109 (162)
T Consensus       201 ~~~~vi~LVGPTGVGKTTTlAKLAar~~---------------~~~~~~kVaiITtDtYRIGA~EQLk~--Ya~im~vp~  263 (407)
T COG1419         201 EQKRVIALVGPTGVGKTTTLAKLAARYV---------------MLKKKKKVAIITTDTYRIGAVEQLKT--YADIMGVPL  263 (407)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH---------------HHCCCCCEEEEEECCCHHHHHHHHHH--HHHHHCCCE
T ss_conf             4685799989988758879999999997---------------53257606899714411528999999--999869955


Q ss_pred             EEEECHHHHHC
Q ss_conf             99998556320
Q gi|254780824|r  110 CIIEWPEIGRS  120 (162)
Q Consensus       110 ~lIEWpe~~~~  120 (162)
T Consensus       264 ~vv~~~~el~~  274 (407)
T COG1419         264 EVVYSPKELAE  274 (407)
T ss_pred             EEECCHHHHHH
T ss_conf             99639999999