HHsearch alignment for GI: 254780824 and conserved domain: PRK04195

>PRK04195 replication factor C large subunit; Provisional.
Probab=96.50  E-value=0.01  Score=37.03  Aligned_cols=49  Identities=29%  Similarity=0.259  Sum_probs=35.4

Q ss_pred             CCCHHHHHHHHHHHHHHC---CCCCEEEEECCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             299899999999999845---8996999987878688999999997607888
Q gi|254780824|r   13 IPNEKNTICLGRHLASIL---RLGDCLTLSGDLGSGKSFLARSIIRFLMHDD   61 (162)
Q Consensus        13 l~~~~~t~~la~~la~~l---~~g~ii~L~GdLGaGKTtfvr~i~~~lg~~~   61 (162)
T Consensus        17 vg~~~~v~~l~~Wl~~w~~g~~~~k~lLL~GPpGvGKTT~a~~lAk~~g~~v   68 (403)
T PRK04195         17 VGNEKAKKQLREWIESWLKGKPPKKALLLYGPPGVGKTSLAHALANDYGWEV   68 (403)
T ss_pred             HCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE
T ss_conf             5889999999999999873996574699889399879999999999849985