HHsearch alignment for GI: 254780824 and conserved domain: PRK05642

>PRK05642 DNA replication initiation factor; Validated.
Probab=93.07  E-value=0.32  Score=28.04  Aligned_cols=44  Identities=16%  Similarity=0.118  Sum_probs=30.4

Q ss_pred             HHHHHHHHHHHHHCC--CCCEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             999999999998458--99699998787868899999999760788
Q gi|254780824|r   17 KNTICLGRHLASILR--LGDCLTLSGDLGSGKSFLARSIIRFLMHD   60 (162)
Q Consensus        17 ~~t~~la~~la~~l~--~g~ii~L~GdLGaGKTtfvr~i~~~lg~~   60 (162)
T Consensus        27 ~~a~~~~~~l~~~~~~~~~~~l~i~G~~G~GKTHLL~A~~~~~~~~   72 (234)
T PRK05642         27 AAALGYVERLCEADAGWTESLIYLWGKDGVGRSHLLQAACLRFEQR   72 (234)
T ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             9999999998760678778838998899998899999999999807