HHsearch alignment for GI: 254780824 and conserved domain: PRK06674

>PRK06674 DNA polymerase III subunits gamma and tau; Validated.
Probab=94.92  E-value=0.13  Score=30.39  Aligned_cols=131  Identities=15%  Similarity=0.181  Sum_probs=73.3

Q ss_pred             HHHHHHHHHCCCC---CEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHC-------CCC-CCEEEEEEEC
Q ss_conf             9999999845899---6999987878688999999997607888530245202011003-------788-6089998651
Q gi|254780824|r   21 CLGRHLASILRLG---DCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-------DAS-IPVAHFDFYR   89 (162)
Q Consensus        21 ~la~~la~~l~~g---~ii~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~l~~~Y-------~~~-~~i~H~DlYR   89 (162)
T Consensus        23 ~v~~~L~nai~~~ri~HAyLF~GprGtGKts~Ari~AkaLnC~~-----~~~~~pC~~C~~C~~i~~g~~~DviEiDaas   97 (563)
T PRK06674         23 HVTKTLQNALLQEKVSHAYLFSGPRGTGKTSIAKVFAKAVNCEH-----APVAEPCNECPSCLGITNGSISDVLEIDAAS   97 (563)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCC-----CCCCCCCCCCHHHHHHHCCCCCCEEEECCCC
T ss_conf             99999999998499650343128998689999999999857999-----9998877668789998558998779852555


Q ss_pred             CCCHHHHHCCCHHHHC--C-----CCEEEEECHHHHHC--------C---CCCCEEEEEEEECCC-------EEEEEEE-
Q ss_conf             7897775305836750--8-----97899998556320--------4---995409999987398-------7699999-
Q gi|254780824|r   90 LSSHQEVVELGFDEIL--N-----ERICIIEWPEIGRS--------L---LPKKYIDIHLSQGKT-------GRKATIS-  143 (162)
Q Consensus        90 L~~~~E~~~lg~~e~~--~-----~~i~lIEWpe~~~~--------~---lp~~~i~I~i~~~~~-------~R~i~i~-  143 (162)
T Consensus        98 n~gVd~IR~i--~~~v~~~P~~~~yKV~IIDeah~Lt~~A~NALLKtLEEPP~~viFILaTtep~ki~~TI~SRCQrf~F  175 (563)
T PRK06674         98 NNGVDEIRDI--RDKVKFAPSAVEYKVYIIDEVHMLSIGAFNALLKTLEEPPGHVIFILATTEPHKIPPTIISRCQRFDF  175 (563)
T ss_pred             CCCHHHHHHH--HHHHCCCCCCCCEEEEEEECHHHCCHHHHHHHHHHHHCCCCCEEEEEECCCHHHCCHHHHHHHEEEEC
T ss_conf             5787999999--99826488678737999854563799999999998638875649999659947584788733103127


Q ss_pred             ---ECCHHHHHHHHHHHH
Q ss_conf             ---586089999999998
Q gi|254780824|r  144 ---AERWIISHINQMNRS  158 (162)
Q Consensus       144 ---~~~~~~~~l~~~~~~  158 (162)
T Consensus       176 ~ri~~~~i~~rL~~I~~~  193 (563)
T PRK06674        176 RRISVNDIVERLSTVVTN  193 (563)
T ss_pred             CCCCHHHHHHHHHHHHHH
T ss_conf             889999999999999998