HHsearch alignment for GI: 254780824 and conserved domain: PRK06921

>PRK06921 hypothetical protein; Provisional.
Probab=95.15  E-value=0.058  Score=32.52  Aligned_cols=44  Identities=23%  Similarity=0.254  Sum_probs=30.7

Q ss_pred             HHHHHHHHHHHHHC-----CCCCEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             99999999999845-----899699998787868899999999760788
Q gi|254780824|r   17 KNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHD   60 (162)
Q Consensus        17 ~~t~~la~~la~~l-----~~g~ii~L~GdLGaGKTtfvr~i~~~lg~~   60 (162)
T Consensus        95 k~a~~~a~eY~~~F~~i~~~~~~~l~f~G~~G~GKThLa~aIa~~Ll~~  143 (265)
T PRK06921         95 KDAYECAVEYVKDFEKIQGCRKNSIALLGQPGSGKTHLLTAAANELMRK  143 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             9999999999997787607776627997289898899999999999996