HHsearch alignment for GI: 254780824 and conserved domain: PRK07003

>PRK07003 DNA polymerase III subunits gamma and tau; Validated.
Probab=96.01  E-value=0.038  Score=33.61  Aligned_cols=90  Identities=18%  Similarity=0.224  Sum_probs=55.3

Q ss_pred             HHHHHHHHHCCCC---CEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHC-------CCC-CCEEEEEEEC
Q ss_conf             9999999845899---6999987878688999999997607888530245202011003-------788-6089998651
Q gi|254780824|r   21 CLGRHLASILRLG---DCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-------DAS-IPVAHFDFYR   89 (162)
Q Consensus        21 ~la~~la~~l~~g---~ii~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~l~~~Y-------~~~-~~i~H~DlYR   89 (162)
T Consensus        23 ~v~~~l~nal~~~rl~haylf~G~rGvGKTt~aRi~Ak~lnC~~-----~~~~~pcg~C~~C~~i~~g~~~d~iEiDaAS   97 (816)
T PRK07003         23 HVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCET-----GVTSQPCGVCRACREIDEGRFVDYVEMDAAS   97 (816)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCC-----CCCCCCCCCCHHHHHHHCCCCCCEEEEECCC
T ss_conf             99999999997098631475117898888899999999867899-----9998978775557877558877547863554


Q ss_pred             CCCHHHHHCCCHHH--HCC----CCEEEEECHH
Q ss_conf             78977753058367--508----9789999855
Q gi|254780824|r   90 LSSHQEVVELGFDE--ILN----ERICIIEWPE  116 (162)
Q Consensus        90 L~~~~E~~~lg~~e--~~~----~~i~lIEWpe  116 (162)
T Consensus        98 ~~~vd~~r~l-~~~~~y~p~~~r~KvyiiDEvH  129 (816)
T PRK07003         98 NRGVDEMAAL-LERAVYAPVDARFKVYMIDEVH  129 (816)
T ss_pred             CCCHHHHHHH-HHHCCCCCCCCCEEEEEEECHH
T ss_conf             3576899999-9862247866744799984154