HHsearch alignment for GI: 254780824 and conserved domain: PRK09518

>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed.
Probab=93.36  E-value=0.11  Score=30.84  Aligned_cols=30  Identities=20%  Similarity=0.256  Sum_probs=27.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             996999987878688999999997607888
Q gi|254780824|r   32 LGDCLTLSGDLGSGKSFLARSIIRFLMHDD   61 (162)
Q Consensus        32 ~g~ii~L~GdLGaGKTtfvr~i~~~lg~~~   61 (162)
T Consensus         3 ~~iiIAIDGPagsGKSTvak~lA~~Lg~~y   32 (714)
T PRK09518          3 GMIIVAIDGPAGVGKSSVSRALAQYFGYAY   32 (714)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCEE
T ss_conf             988999778986589999999999949918