HHsearch alignment for GI: 254780824 and conserved domain: PRK10771

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional.
Probab=95.58  E-value=0.015  Score=36.07  Aligned_cols=34  Identities=29%  Similarity=0.407  Sum_probs=28.8

Q ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             9845899699998787868899999999760788
Q gi|254780824|r   27 ASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD   60 (162)
Q Consensus        27 a~~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg~~   60 (162)
T Consensus        19 sl~i~~GE~v~iiG~nGaGKSTLl~~i~Gll~p~   52 (233)
T PRK10771         19 TLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPA   52 (233)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             8898899899999999981999999996599998