HHsearch alignment for GI: 254780824 and conserved domain: PRK10851

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional.
Probab=94.89  E-value=0.028  Score=34.42  Aligned_cols=31  Identities=32%  Similarity=0.384  Sum_probs=26.8

Q ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             4589969999878786889999999976078
Q gi|254780824|r   29 ILRLGDCLTLSGDLGSGKSFLARSIIRFLMH   59 (162)
Q Consensus        29 ~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg~   59 (162)
T Consensus        24 ~i~~GE~~~llGpSGsGKSTLlr~iaGL~~p   54 (352)
T PRK10851         24 DIPSGQMVALLGPSGSGKTTLLRIIAGLEHQ   54 (352)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             9999989999999984699999999769999