HHsearch alignment for GI: 254780824 and conserved domain: PRK11174

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed.
Probab=95.51  E-value=0.02  Score=35.36  Aligned_cols=36  Identities=31%  Similarity=0.452  Sum_probs=29.6

Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             999998458996999987878688999999997607
Q gi|254780824|r   23 GRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLM   58 (162)
Q Consensus        23 a~~la~~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg   58 (162)
T Consensus       366 L~~is~~i~~Ge~vaIVG~SGsGKSTl~~LL~g~~p  401 (588)
T PRK11174        366 AGPLNFTLPAGQRVALVGPSGAGKTSLLNALLGFLP  401 (588)
T ss_pred             CCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             036469974997899989998649999999987289