HHsearch alignment for GI: 254780824 and conserved domain: PRK11388

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional.
Probab=94.07  E-value=0.12  Score=30.61  Aligned_cols=38  Identities=24%  Similarity=0.170  Sum_probs=27.1

Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             99999999984589969999878786889999999976
Q gi|254780824|r   19 TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRF   56 (162)
Q Consensus        19 t~~la~~la~~l~~g~ii~L~GdLGaGKTtfvr~i~~~   56 (162)
T Consensus       334 ~~~~~~~a~~~a~~~~pVLI~GE~GtGKe~lAraIH~~  371 (639)
T PRK11388        334 MRRLIHFGRQAAKSSFPILLCGEEGVGKALLAQAIHNE  371 (639)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHC
T ss_conf             99999999999688996898898981099999999955