HHsearch alignment for GI: 254780824 and conserved domain: PRK12323

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional.
Probab=96.03  E-value=0.036  Score=33.76  Aligned_cols=79  Identities=18%  Similarity=0.131  Sum_probs=52.2

Q ss_pred             HHHHHHHHHCCCC---CEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCC-------CC-CCEEEEEEEC
Q ss_conf             9999999845899---69999878786889999999976078885302452020110037-------88-6089998651
Q gi|254780824|r   21 CLGRHLASILRLG---DCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-------AS-IPVAHFDFYR   89 (162)
Q Consensus        21 ~la~~la~~l~~g---~ii~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~l~~~Y~-------~~-~~i~H~DlYR   89 (162)
T Consensus        23 ~v~~~l~na~~~~r~~haylf~G~rGvGKTt~ari~Ak~lnc~~~~~~~g~~~~pcg~C~~C~~i~~g~~~d~~EiDaas  102 (721)
T PRK12323         23 HVVRALTHALEQQRLHHAYLFTGTRGVGKTTLSRILAKSLNCTGPDGEGGITAQPCGQCRACTEIDAGRFVDYIEMDAAS  102 (721)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCC
T ss_conf             99999999997199754475027998889899999999976899866789878878776546877568987647743676


Q ss_pred             CCCHHHHHCC
Q ss_conf             7897775305
Q gi|254780824|r   90 LSSHQEVVEL   99 (162)
Q Consensus        90 L~~~~E~~~l   99 (162)
T Consensus       103 ~~~v~~~r~l  112 (721)
T PRK12323        103 NRGVDEMAQL  112 (721)
T ss_pred             CCCHHHHHHH
T ss_conf             7888999999