HHsearch alignment for GI: 254780824 and conserved domain: PRK13342

>PRK13342 recombination factor protein RarA; Reviewed.
Probab=94.67  E-value=0.039  Score=33.59  Aligned_cols=83  Identities=23%  Similarity=0.262  Sum_probs=46.1

Q ss_pred             HHHHCCCCC--EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHC-----------CCCCCEEEEE-EECCC
Q ss_conf             998458996--999987878688999999997607888530245202011003-----------7886089998-65178
Q gi|254780824|r   26 LASILRLGD--CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----------DASIPVAHFD-FYRLS   91 (162)
Q Consensus        26 la~~l~~g~--ii~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~l~~~Y-----------~~~~~i~H~D-lYRL~   91 (162)
T Consensus        28 L~~~i~~~~~~s~Il~GPPG~GKTTlA~iiA~~~~~~f~--~lnA~~~gv~dir~ii~~a~~~~~~~~tilfiDEIHRfn  105 (417)
T PRK13342         28 LRRMIEAGRLSSMILWGPPGTGKTTLARIIAGATDAEFE--ALSAVTSGVKDLREVIEEAKQSRLGRRTILFIDEIHRFN  105 (417)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE--EEECCCCCHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC
T ss_conf             999997699975998896999899999999998689889--961410388999999999886314896599997820058


Q ss_pred             CHHHHHCCCHHHHCCCC-EEEEE
Q ss_conf             97775305836750897-89999
Q gi|254780824|r   92 SHQEVVELGFDEILNER-ICIIE  113 (162)
Q Consensus        92 ~~~E~~~lg~~e~~~~~-i~lIE  113 (162)
T Consensus       106 K~QQ--D~-LLp~vE~g~iiLIg  125 (417)
T PRK13342        106 KAQQ--DA-LLPHVEDGTITLIG  125 (417)
T ss_pred             HHHH--HH-HHHHHHCCCEEEEE
T ss_conf             8999--99-98751126569997